current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 4gla_C mol:protein length:109 OBody NL8, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .
# Score Template Links and tools%idFirst GSVYPKKTHWTAEITPNLHGTEVVVAGWVASLGDYGRVKIVKVSDREGGAAVPVYLEAGKTPDHLFKVFAELSREDVVVIKGIVEASKGVGRGVEIFPSEIWILNKAKALast
1 -71.1004gla_C mol:protein length:109 OBody NL8  ali model  100  1GSVYPKKTHWTAEITPNLHGTEVVVAGWVASLGDYGRVKIVKVSDREGGAAVPVYLEAGKTPDHLFKVFAELSREDVVVIKGIVEASKGVGRGVEIFPSEIWILNKAKA 109
2 -63.4004gn4_B mol:protein length:108 OBody AM2EP06  ali model follow..  91  1.AVYPKKTHWTAEITPNLHGSEVVVAGWVAHLGDYGRVKIVKVSDREGGAAVPVYLERGKTPDHLFKVFAELSREDVVVIKGIVEASEQYATGVEIFPSEIWILNKA.. 108
3 -62.5004gn3_B mol:protein length:113 OBody AM1L10  ali model follow..  94  3GSVYPKKTHWTAEITPNLHGTEVVVAGWVASLGDYGRVKIVKVSDREGGAAVSVYLEYGKTPDHLFKVFAELSREDVVVIKGIVEASKAAHNGVEIFPSEIWILNKAK. 113
4 -61.3004gn5_A mol:protein length:113 OBody AM3L15  ali model follow..  90  1..VSPKKTHWTAEITPNLHGSEVVVAGWVAHLGDYGRVKIVKVSDREGGAAVPVYLERGKTPDHLFKVFAELSREDVVVIKGIVEAGWPVDTGVEIFPSEIWILNKAKP 109
5 -60.9004glv_B mol:protein length:107 OBody AM3L09  ali model follow..  90  1..VSPKKTHWTAEITPNLHGSEVVVAGWVAHLGDYGRVKIVKVSDREGGAAVPVYLERGKTPDHLFKVFAELSREDVVVIKGIVEATTVTDTGVEIFPSEIWILNKA.. 107
6 -54.8005gro_A mol:protein length:115 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  26  2.AVGTMRSHFCTEISEKDVGKIVKVAGWCNTYRDHGGVVFIDLRDKSGLVQLVCDPSS-----KAYEKALEVRSEFVLVAKGKVRLRGLKTGKIEIVLEELIIENKS.. 109
7 -42.4001b8a_A mol:protein length:438 PROTEIN (ASPARTYL-TRNA SYNTHETASE)  ali model follow..  37  2.....YRTHYSSEITEELNGQKVKVAGWVWEVKDLGGIKFLWIRDRDGIVQITA--PKKKVDPELFKLIPKLRSEDVVAVEGVVNFTPKAKLGFEILPEKIVVLNRAET 103
8 -41.3001x54_A mol:protein length:434 Asparaginyl-tRNA synthetase  ali model follow..  23  2.....IEKVYCQEVKPELDGKKVRLAGWVYTNMRVGKKIFLWIRDSTGIVQAVV--AKNVVGEETFEKAKKLGRESSVIVEGIVKADERAPGGAEVHVEKLEVIQAVSE 103
9 -40.4001wyd_A mol:protein length:429 hypothetical aspartyl-tRNA synthetase  ali model follow..  39  2.....YRSHFIADVTPEYDGKEVIWAGWVHLLRDLGGKKFIILRDKTGLGQVVVDKNS-----SAFGISQELTQESVIQVRGIVKADKRAPRGIELHAEEITLLSKAKA 100
10 -39.8001efw_A mol:protein length:580 ASPARTYL-TRNA SYNTHETASE  ali model follow..  25  2.....RRTHYAGSLRETHVGEEVVLEGWVNRRRDLGGLIFLDLRDREGLVQLVAHPAS-----PAYATAERVRPEWVVRAKGLVRLRPLATGRVEVELSALEVLAEAKT 105
11 -38.9004wj3_M mol:protein length:599 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  28  4.....MRSHYCGQLNESLDGQEVTLCGWVHRRRDHGGVIFLDVRDREGLAQVVFDPDR----AETFAKADRVRSEFVVKITGKVRLRPMASGSIEVLGYELEVLNQAET 110
12 -38.8001eqr_A mol:protein length:590 ASPARTYL-TRNA SYNTHETASE  ali model follow..  24  2......RTEYCGQLRLSHVGQQVTLCGWVNRRRDLGSLIFIDMRDREGIVQVFFDPDR----ADALKLASELRNEFCIQVTGTVRARDMATGEIEVLASSLTIINRADV 107
13 -38.4005w25_A mol:protein length:616 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  22  14.HVFVLRSHAAGLLREGDAGQQVTLAGWVARRRDHGGVIFIDLRDASGIAQVVFRDPQ---DTEVLAQAHRLRAEFCVSVAGVVEIRPIATGEIEVNATSLTVLGECAP 125
14 -36.1004ah6_A mol:protein length:617 ASPARTATE--TRNA LIGASE, MITOCHONDRIAL  ali model follow..  21  6.SSFVVRTNTCGELRSSHLGQEVTLCGWIQYRRQNT---FLVLRDFDGLVQVII--PQDESAASVKKILCEAPVESVVQVSGTVISRPMPTGEIEIKVKTAELLNACKK 115
15 -35.9004rmf_A mol:protein length:609 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  24  2.....LRTHAAGSLRPADAGQTVTLAGWVARRRDHGGVIFIDLRDASGVSQVVFREG------DVLAAAHRLRAEFCVAVTGVVEVRPIPTGQIEVNATELTVLGESAP 106
16 -35.7004o2d_A mol:protein length:620 Aspartate--tRNA ligase  ali model follow..  23  14.GSMVLRTHAAGSLRPADAGQTVTLAGWVARRRDHGGVIFIDLRDASGVSQVVFREG------DVLAAAHRLRAEFCVAVTGVVEVRPIPTGQIEVNATELTVLGESAP 122
17 -35.0004j15_A mol:protein length:521 Aspartate--tRNA ligase, cytoplasmic  ali model follow..  16  62..........VRDLTIQKADEVVWVRARVHTSRAKGKQCFLVLRQQQFNVQALVA-VGDHASKQMVKFAANINKESIVDVEGVVRKVNQTQQDVELHVQKIYVISLAEP 164
18 -31.8001n9w_A mol:protein length:422 aspartyl-tRNA synthetase 2  ali model follow..  23  9...............KAHVGQEVELLGFLHWRRDLGRIQFLLLRDRSGVVQVVTGGLK------------LPLPESALRVRGLVVENAKAPGGLEVQAKEVEVLSPALE 90
19 -31.0001asy_A mol:protein length:490 ASPARTYL-tRNA SYNTHETASE  ali model follow..  16  24....QKRVKFVDLDEAKDSDKEVLFRARVHNTRQQGALAFLTLRQQASLIQGLVKANKGTISKNMVKWAGSLNLESIVLVRGIVKKVDETVQNLEIHITKIYTISETPE 135
20 -30.4003m4p_A mol:protein length:456 Asparaginyl-tRNA synthetase, putative  ali model follow..  17  10.TTTPVETPIVCNIRDGLEGKLVTFKGWAYHIRKARKLIFVELRDGSGYCQCVIFGKE----LCEPEKVKLLTRECSLEITGRLNAYAADILNLEMQVTEWKVIGESPI 124
21 -29.7003i7f_A mol:protein length:548 Aspartyl-tRNA synthetase  ali model follow..  18  48.....LKYTEIEELVPAMAEKTVTIRARVQAVRGKGNMVFLFLRKGIYTCQALVM-KSETISKEFVQFCQKISAESICDITGIVKAVEATQQDVEIHVTSIAVVSLAEY 155
22 -29.5005xix_A mol:protein length:472 Asparagine--tRNA ligase, cytoplasmic  ali model follow..  20  28....PEPKCVKIGALEGYRGQRVKVFGWVHRLRRQGKLMFLVLRDGTGYLQCVLADELCQC-----YNGVLLSTESSVAVYGMLNLTPQAPGGHELSCDFWELIGLAPA 131
23 -28.1002xti_A mol:protein length:437 ASPARAGINYL-TRNA SYNTHETASE, CYTOPLASMIC, PUTATIVE  ali model follow..  17  9...............VKHRNERVCIKGWIHRMRRQGKLMFFILRDGTGFLQVLLMDKLCQT-----YDALTVNTECTVEIYGAIKEVPEAPNGHELIADFWKIIGNAPP 101
24 -22.9004ex5_A mol:protein length:529 Lysine--tRNA ligase  ali model follow..  20  48GIAYPNDTHHAADLQTAYKSLEVAIAGRMMLKRVMGKASFATVQDGSGQIQFFV--TPADVGAETYDAFKKWDLGDIVAARGVLFRTN--KGELSVKCTQLRLLAKA.. 163
25 -22.5003a74_A mol:protein length:493 Lysyl-tRNA synthetase  ali model follow..  21  25.DPFGKRTHKAEELFELYQQIEVAVAGRIMTKRGMGKAGFAHIQDVTGQIQIYV--RQDDVGEQQYELFKISDLGDIVGVRGTMFKTK--VGELSIKVSSYEFLTKA.. 139
26 -21.7004up7_A mol:protein length:777 LYSINE--TRNA LIGASE  ali model follow..  16  24.NPWPNVSITVPEFIAQVSDDIVSVAGRVLSKRSSSALMFIDLHDSQTKLQIMLNKSAYENKEDFVSLTKMIYRGDICGFTGHPTRTK--TGELSLIPISGMILSPC.. 139
27 -21.4001bbu_A mol:protein length:504 PROTEIN (LYSYL-TRNA SYNTHETASE)  ali model follow..  21  32GIAFPNDDHTSDQLHAEFLNIEVAVAGRMMTRRIMGKASFVTLQDVGGRIQLYVARDDLP-EGVYNEQFKKWDLGDILGAKGKLFKTK--TGELSIHCTELRLLTKA.. 148
28 -21.4001e1o_A mol:protein length:504 LYSYL-TRNA SYNTHETASE, HEAT INDUCIBLE  ali model follow..  19  32GVAFPNDDHTSDQLHEEFLNIEVSVAGRMMTRRIMGKASFVTLQDVGGRIQLYVARDSLP-EGVYNDQFKKWDLGDIIGARGTLFKTQ--TGELSIHCTELRLLTKA.. 148
29 -20.9003bju_A mol:protein length:521 Lysyl-tRNA synthetase  ali model follow..  17  25.DPYPHKDISLTDFIQKYTDITLKVAGRIHAKRASGKLIFYDLRGEGVKLQVMANSRNYKSEEEFIHINNKLRRGDIIGVQGNPGKTK--KGELSIIPYEITLLSPC.. 141
30 -20.5005hgq_A mol:protein length:524 Lysine--tRNA ligase  ali model follow..  19  27.NPYPHKSISLADFIAKYNDIVQSVAGRVFSKRESGKLIFYDLHGEGTRLQVLANARFHSGDEAFDNLHDRIKRGDIIGVNGYPARSK--SGELSIIPYEIIQLTPC.. 143
31 -20.2006chd_A mol:protein length:597 Lysine--tRNA ligase  ali model follow..  17  93.DPYPHKDISLTDFIQKYTDITLKVAGRIHAKRASGKLIFYDLRGEGVKLQVMANSRNYKSEEEFIHINNKLRRGDIIGVQGNPGKTK--KGELSIIPYEITLLSPC.. 209
32 -19.5005eln_A mol:protein length:535 Lysine--tRNA ligase  ali model follow..  17  34.PFYPHKSMSLPAYALKYKDTTLSLSGRVTSIRSSSKLIFYDIFCEEQKVQIIANIMEHDISTGEFSVSHSIRRGDVVGFTGFPGKSK--RGELSLFSKSVVLLSPC.. 151
33 -18.9005vl1_A mol:protein length:506 Lysine--tRNA ligase  ali model follow..  23  30.DPYPVATHTLAEIRATYTEDIVGVAGRVVFARNTGKLCFATLQDGDGTQLQAMISLDEVGRESLDRWKADVDIGDVVYVHGTVISSR--RGELSVLADSWRMAAKA.. 144
34 -18.8004ycv_A mol:protein length:516 Lysine--tRNA ligase  ali model follow..  19  25.NPYPHKTISIPEFIEKYEDTILNITGRIMRVSASGKLRFFDLVGDGEKIQVLANYSFNHEKGNFAECYDKIRRGDIVGIVGFPGKSK--KGELSIFPKETILLSAC.. 142
35 -18.5006aqh_A mol:protein length:508 Lysine--tRNA ligase  ali model follow..  19  33.QPYPVDTHTLLEIRQAYTGEIVGVTGRVVFARNSGKLCFATLQEGDG-TQLQAMISLAEVGQEALDNWKTVDIGDIVFVHGEVITSK--RGELSVLADSWQMAAKA.. 147
36 -15.3004joi_A mol:protein length:166 CST complex subunit STN1  ali model follow..  12  37....................KQVDVLGTVIGVRERDAFYSYGVDDSTGVINCICWKKLNTESQETIEQKTKIEIGDTIRVRGSIRT----REEREIHATTYYKVDDPVW 142
37 -15.2001nnx_A mol:protein length:109 Protein ygiW  ali model follow..  19  27.........TVESAKSLRDDTWVTLRGNIVERISDDLYVF---KDASGTINVDIDHKR-----------VTVTPKDTVEIQGEV---DKDWNSVEIDVKQIRKVNP... 109
38 -14.6003kf6_A mol:protein length:159 Protein stn1  ali model follow..  17  48....................RWIQIVGYIAAIDIYEGKHVLTVDDCSGMVLRVVFIIQDDFSMS--KRAISMSPGNVVCVFGKINS----RSEVELIAQSFEELRDPND 131
39 -13.3003kf8_A mol:protein length:220 Protein stn1  ali model follow..  10  86....................NQINIFGKIVYEQYKESYVILVISDFIGIDSKIRVRLSQEQFKEVGLTLDKKNYGKIVELEGEIYN----YDSINVSKKPDRELKVSK. 178
40 -13.2004gnx_B mol:protein length:136 Putative uncharacterized protein  ali model follow..  12  37....................GQLTFVAVVRNISRNATNVAYSVEDGTGQIEVRQWLDS---SSDDSSKASEIRNNVYVRVLGTLKSFQ---NRRSISSGHMRPVIDYN. 118
41 -12.4002pi2_A mol:protein length:270 Replication protein A 32 kDa subunit  ali model follow..  10  72....................SQVTIVGIIRHAEKAPTNIVYKIDDMTAAPMDVRQWVDTDDTS---SENTVVPPETYVKVAGHLRS----QNKKSLVAFKIMPLEDMN. 153
42 -11.5002pi2_E mol:protein length:142 Replication protein A 14 kDa subunit  ali model follow..  25...........AGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDGEG-KNGTIELMEPLDEEISGIVEVVGRVTAKATILCTSYVQFKEDSHPDLGLYNEAVKIIHDFPQ 122
43 -11.3003nbh_B mol:protein length:147 RecQ-mediated genome instability protein 2  ali model follow..  16  56....................AAVWMQGRVVMADRGE----ARLRDPSGDFSVRGLERVP-------RGRPCLVPGKYVMVMGVVQACS---PEPCLQAVKMTDLSDNPI 130
44 -11.2004jbj_A mol:protein length:198 Interferon-activable protein 202  ali model follow..  19  108....AKETLKISKIKELDSGTLIYGVFAVEKKKVNDKSITFKIKDNEDNIKVVWDKEQHNINYEKGDKLQILHSGNHSFIKG........................... 198
45 -11.0003mxn_B mol:protein length:150 RecQ-mediated genome instability protein 2  ali model follow..  16  59....................AAVWMQGRVVMADRGE----ARLRDPSGDFSVRGLERVP-------RGRPCLVPGKYVMVMGVVQACS---PEPCLQAVKMTDLSDNPI 133
46 -10.9003dm3_A mol:protein length:105 Replication factor A  ali model follow..  20  1......EIKDTYNIGELSPGMTATFEGEVISALPIGKLKSFIVRDETGSIRVTLWDNLTD---------IDVGRGDYVRVRGYIREG---YGGLECTANYVEILKKGEK 102
47 -10.4003e0e_A mol:protein length:97 Replication protein A  ali model follow..  18  4............KISELMPNLSGTINAEVVTAYPKGQLKSLFLKDDTGSIRGTLWNELAD---------FEVKKGDIAEVSGYVKQGY---SGLEISVDNIGIIEKS.. 96
48 -10.2002k50_A mol:protein length:115 Replication factor A related protein  ali model follow..  19  9............TISKLEEGAETPVTGRVMKISSEGKLANVIIADDTGELRAVF--------TENIKLLKKFREGDVIRIKD-VNIRGGFGGRKEAHLMPRSTVEVLD. 106
49 -10.2004jbm_A mol:protein length:193 Interferon-inducible protein AIM2  ali model follow..  15  100..........ISKLKIQPCGTIVNGLFKVQKITEEKDRVLYGIHDKTGTMEVLVLGNPSKT---------KCEEGDKIRLTFFEVSK---GVKIQLKSGPCSFFKVIKA 187
50 -9.9603fhw_A mol:protein length:115 Primosomal replication protein n  ali model follow..  2....................NTLELSARVLECGAM-LLVHESEVVEAGHPRRVELTISAVALGDLALLLADTPLGTEMQVQGFLAPARKDSVKVKLHLQQARRIAGSMG 101
51 -9.8104l5t_A mol:protein length:203 Interferon-activable protein 202  ali model follow..  108....PIEHLKICDLHLQTEERLVDGEFKVYRKSSGNNCICYGIWDDTGAMKVVVSGQLTSV---------NCEIGNTIRLVCFELTSNADEWFLRATRYSMEVIMPEK. 203
52 -9.7902k5v_A mol:protein length:104 Replication protein A  ali model follow..  18  4............KISELMPNLSGTINAEVVAAYPKGQLKSLFLKDDTGSIRGTLWNELAD---------FEVKKGDIAEVSGYVKQGY---SGLEISVDNIGIIEKSL. 97
53 -9.1503rn2_A mol:protein length:208 Interferon-inducible protein AIM2  ali model follow..  11  113..........INTLQTQPLGTIVNGLFVVQKVTEKKKNILFDLSDNTGKMEVLGVRNEDTMKCKEGDKVR-LTFFTLSKNGEKLQLTSGVHSTIKVIKAKKKTAAAS.. 208
54 -9.0104lnq_A mol:protein length:197 Interferon-activable protein 202  ali model follow..  16  104....AKETLKISKIKELDSGTLIYGVFAVEKKKVNDKSITFKIKDNEDNIKVVWDKEQHNINYEKGDKLQ....................................... 169
55 -9.0103au7_A mol:protein length:402 Putative uncharacterized protein  ali model follow..  17  270...........EEVHRLENYRSYRLRGRVTLYDIEGGHVFFEIDTKFGSVKCAAFEPTKQFR----NVIRLLRKGDVVEVYGSMKKD-------TINLEKIQIVELAE. 357

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 7 6 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Awobuluyi M, Yang J, Ye Y, Chatterton JE, Godzik A, Lipton SA, Zhang D. Subunit-specific roles of glycine-binding domains in activation of NR1/NR3N-methyl-D-aspartate receptors. Mol Pharmacol. 2007 Jan;71(1):112-22. Epub 2006 Oct 17.