current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 4glv_B mol:protein length:107 OBody AM3L09, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .
# Score Template Links and tools%idFirst VSPKKTHWTAEITPNLHGSEVVVAGWVAHLGDYGRVKIVKVSDREGGAAVPVYLERGKTPDHLFKVFAELSREDVVVIKGIVEATTVTRWDTGVEIFPSEIWILNKALast
1 -68.5004glv_B mol:protein length:107 OBody AM3L09  ali model  100  1VSPKKTHWTAEITPNLHGSEVVVAGWVAHLGDYGRVKIVKVSDREGGAAVPVYLERGKTPDHLFKVFAELSREDVVVIKGIVEATTVTRWDTGVEIFPSEIWILNKA 107
2 -67.2004gn4_B mol:protein length:108 OBody AM2EP06  ali model follow..  92  2VYPKKTHWTAEITPNLHGSEVVVAGWVAHLGDYGRVKIVKVSDREGGAAVPVYLERGKTPDHLFKVFAELSREDVVVIKGIVEASEQYGSATGVEIFPSEIWILNKA 108
3 -66.2004gn5_A mol:protein length:113 OBody AM3L15  ali model follow..  94  1VSPKKTHWTAEITPNLHGSEVVVAGWVAHLGDYGRVKIVKVSDREGGAAVPVYLERGKTPDHLFKVFAELSREDVVVIKGIVEAGWPVALDTGVEIFPSEIWILNKA 107
4 -63.8004gn3_B mol:protein length:113 OBody AM1L10  ali model follow..  87  5VYPKKTHWTAEITPNLHGTEVVVAGWVASLGDYGRVKIVKVSDREGGAAVSVYLEYGKTPDHLFKVFAELSREDVVVIKGIVEASKAADMHNGVEIFPSEIWILNKA 112
5 -60.9004gla_C mol:protein length:109 OBody NL8  ali model follow..  90  3VYPKKTHWTAEITPNLHGTEVVVAGWVASLGDYGRVKIVKVSDREGGAAVPVYLEAGKTPDHLFKVFAELSREDVVVIKGIVEASKGV--GRGVEIFPSEIWILNKA 107
6 -54.6005gro_A mol:protein length:115 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  26  3VGTMRSHFCTEISEKDVGKIVKVAGWCNTYRDHGGVVFIDLRDKSGLVQLVCDPS-----SKAYEKALEVRSEFVLVAKGKVRLRGAGLETGKIEIVLEELIIENKS 109
7 -39.4004wj3_M mol:protein length:599 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  28  1MGMMRSHYCGQLNESLDGQEVTLCGWVHRRRDHGGVIFLDVRDREGLAQVVFDPDR----AETFAKADRVRSEFVVKITGKVRLRPEGARSGSIEVLGYELEVLNQA 108
8 -39.3001efw_A mol:protein length:580 ASPARTYL-TRNA SYNTHETASE  ali model follow..  25  2...RRTHYAGSLRETHVGEEVVLEGWVNRRRDLGGLIFLDLRDREGLVQLVAHPA-----SPAYATAERVRPEWVVRAKGLVRLRPEPNPTGRVEVELSALEVLAEA 103
9 -38.3001eqr_A mol:protein length:590 ASPARTYL-TRNA SYNTHETASE  ali model follow..  25  2....RTEYCGQLRLSHVGQQVTLCGWVNRRRDLGSLIFIDMRDREGIVQVFFDPDR----ADALKLASELRNEFCIQVTGTVRARDEKNITGEIEVLASSLTIINRA 105
10 -38.2001b8a_A mol:protein length:438 PROTEIN (ASPARTYL-TRNA SYNTHETASE)  ali model follow..  39  2...YRTHYSSEITEELNGQKVKVAGWVWEVKDLGGIKFLWIRDRDGIVQITA--PKKKVDPELFKLIPKLRSEDVVAVEGVVNFTPKAK--LGFEILPEKIVVLNRA 101
11 -37.5005w25_A mol:protein length:616 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  21  16.FVLRSHAAGLLREGDAGQQVTLAGWVARRRDHGGVIFIDLRDASGIAQVVFRDPQ---DTEVLAQAHRLRAEFCVSVAGVVEIRPEGNATGEIEVNATSLTVLGEC 123
12 -36.4001x54_A mol:protein length:434 Asparaginyl-tRNA synthetase  ali model follow..  24  3....EKVYCQEVKPELDGKKVRLAGWVYTNMRVGKKIFLWIRDSTGIVQAVV--AKNVVGEETFEKAKKLGRESSVIVEGIVKADERA--PGGAEVHVEKLEVIQAV 101
13 -36.2001wyd_A mol:protein length:429 hypothetical aspartyl-tRNA synthetase  ali model follow..  36  2...YRSHFIADVTPEYDGKEVIWAGWVHLLRDLGGKKFIILRDKTGLGQVVVDKNS-----SAFGISQELTQESVIQVRGIVKADKRA--PRGIELHAEEITLLSKA 98
14 -35.3004rmf_A mol:protein length:609 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  24  2...LRTHAAGSLRPADAGQTVTLAGWVARRRDHGGVIFIDLRDASGVSQVVFREG------DVLAAAHRLRAEFCVAVTGVVEVRPEGNETGQIEVNATELTVLGES 104
15 -35.3004ah6_A mol:protein length:617 ASPARTATE--TRNA LIGASE, MITOCHONDRIAL  ali model follow..  19  8.FVVRTNTCGELRSSHLGQEVTLCGWIQYRRQNT---FLVLRDFDGLVQVIIPQDE--SAASVKKILCEAPVESVVQVSGTVISRPAGQETGEIEIKVKTAELLNAC 113
16 -35.0004j15_A mol:protein length:521 Aspartate--tRNA ligase, cytoplasmic  ali model follow..  16  62........VRDLTIQKADEVVWVRARVHTSRAKGKQCFLVLRQQQFNVQALVAVGD-HASKQMVKFAANINKESIVDVEGVVRKVNQKITQQDVELHVQKIYVISLA 162
17 -34.7004o2d_A mol:protein length:620 Aspartate--tRNA ligase  ali model follow..  23  16.MVLRTHAAGSLRPADAGQTVTLAGWVARRRDHGGVIFIDLRDASGVSQVVFREG------DVLAAAHRLRAEFCVAVTGVVEVRPEGNETGQIEVNATELTVLGES 120
18 -31.7001asy_A mol:protein length:490 ASPARTYL-tRNA SYNTHETASE  ali model follow..  16  25...KRVKFVDLDEAKDSDKEVLFRARVHNTRQQGALAFLTLRQQASLIQGLVKANKGTISKNMVKWAGSLNLESIVLVRGIVKKVDEPIKSQNLEIHITKIYTISET 133
19 -30.0003i7f_A mol:protein length:548 Aspartyl-tRNA synthetase  ali model follow..  18  48...LKYTEIEELVPAMAEKTVTIRARVQAVRGKGNMVFLFLRKGIYTCQALVMKSE-TISKEFVQFCQKISAESICDITGIVKAVEKKATQQDVEIHVTSIAVVSLA 153
20 -29.7005xix_A mol:protein length:472 Asparagine--tRNA ligase, cytoplasmic  ali model follow..  21  39.............EGYRGQRVKVFGWVHRLRRQGKLMFLVLRDGTGYLQCVLADELCQC-----YNGVLLSTESSVAVYGMLNLTPKGKQAGGHELSCDFWELIGLA 129
21 -28.8003m4p_A mol:protein length:456 Asparaginyl-tRNA synthetase, putative  ali model follow..  18  15....ETPIVCNIRDGLEGKLVTFKGWAYHIRKARKLIFVELRDGSGYCQCVIFGKE----LCEPEKVKLLTRECSLEITGRLNAYAGKNDILNLEMQVTEWKVIGES 122
22 -28.7001n9w_A mol:protein length:422 aspartyl-tRNA synthetase 2  ali model follow..  23  9.............KAHVGQEVELLGFLHWRRDLGRIQFLLLRDRSGVVQVVTGGL------------KLPLPESALRVRGLVVENAKA--PGGLEVQAKEVEVLSPA 88
23 -28.0002xti_A mol:protein length:437 ASPARAGINYL-TRNA SYNTHETASE, CYTOPLASMIC, PUTATIVE  ali model follow..  17  9.............VKHRNERVCIKGWIHRMRRQGKLMFFILRDGTGFLQVLLMDKLCQT-----YDALTVNTECTVEIYGAIKEVPEGKEANGHELIADFWKIIGNA 99
24 -20.5003a74_A mol:protein length:493 Lysyl-tRNA synthetase  ali model follow..  21  31..FERTHKAEELFELYQQIEVAVAGRIMTKRGMGKAGFAHIQDVTGQIQIYV--RQDDVGEQQYELFKISDLGDIVGVRGTMFKTKVGELS----IKVSSYEFLTKA 139
25 -20.4004ex5_A mol:protein length:529 Lysine--tRNA ligase  ali model follow..  19  55..FQPTHHAADLQTAYKSLEVAIAGRMMLKRVMGKASFATVQDGSGQIQFFV--TPADVGAETYDAFKKWDLGDIVAARGVLFRTNKGELS----VKCTQLRLLAKA 163
26 -20.1004up7_A mol:protein length:777 LYSINE--TRNA LIGASE  ali model follow..  13  30..FNVSITVPEFIAQVSDDIVSVAGRVLSKRSSSALMFIDLHDSQTKLQIMLNKSAYENKEDFVSLTKMIYRGDICGFTGHPTRTK----TGELSLIPISGMILSPC 139
27 -19.0003bju_A mol:protein length:521 Lysyl-tRNA synthetase  ali model follow..  15  31..FHVDISLTDFIQKYTDITLKVAGRIHAKRASGKLIFYDLRGEGVKLQVMANSRNYKSEEEFIHINNKLRRGDIIGVQGNPGKTKKGELS----IIPYEITLLSPC 141
28 -19.0001bbu_A mol:protein length:504 PROTEIN (LYSYL-TRNA SYNTHETASE)  ali model follow..  20  39..FRRDHTSDQLHAEFLNIEVAVAGRMMTRRIMGKASFVTLQDVGGRIQLYVARDDLP-EGVYNEQFKKWDLGDILGAKGKLFKTKTGELS----IHCTELRLLTKA 148
29 -19.0001e1o_A mol:protein length:504 LYSYL-TRNA SYNTHETASE, HEAT INDUCIBLE  ali model follow..  19  39..FRRDHTSDQLHEEFLNIEVSVAGRMMTRRIMGKASFVTLQDVGGRIQLYVARDSLP-EGVYNDQFKKWDLGDIIGARGTLFKTQTGELS----IHCTELRLLTKA 148
30 -18.5005hgq_A mol:protein length:524 Lysine--tRNA ligase  ali model follow..  14  33..FHVSISLADFIAKYNDIVQSVAGRVFSKRESGKLIFYDLHGEGTRLQVLANARFHSGDEAFDNLHDRIKRGDIIGVNGYPARSKSGELS----IIPYEIIQLTPC 143
31 -18.3006chd_A mol:protein length:597 Lysine--tRNA ligase  ali model follow..  15  99..FHVDISLTDFIQKYTDITLKVAGRIHAKRASGKLIFYDLRGEGVKLQVMANSRNYKSEEEFIHINNKLRRGDIIGVQGNPGKTKKGELS----IIPYEITLLSPC 209
32 -17.6005eln_A mol:protein length:535 Lysine--tRNA ligase  ali model follow..  12  40..FKISMSLPAYALKYKDTTLSLSGRVTSIRSSSKLIFYDIFCEEQKVQIIANIMEHDISTGEFSVSHSIRRGDVVGFTGFPGKSKRGELS----LFSKSVVLLSPC 151
33 -16.8005vl1_A mol:protein length:506 Lysine--tRNA ligase  ali model follow..  20  36..IERTHTLAEIRATYTEDIVGVAGRVVFARNTGKLCFATLQDGDGTQLQAMISLDEVGRESLDRWKADVDIGDVVYVHGTVISSRRGELS----VLADSWRMAAKA 144
34 -16.8004ycv_A mol:protein length:516 Lysine--tRNA ligase  ali model follow..  14  31..FERTISIPEFIEKYEDTILNITGRIMRVSASGKLRFFDLVGDGEKIQVLANYSFNHEKGNFAECYDKIRRGDIVGIVGFPGKSKKGELS----IFPKETILLSAC 142
35 -16.5006aqh_A mol:protein length:508 Lysine--tRNA ligase  ali model follow..  17  39..VPRTHTLLEIRQAYTGEIVGVTGRVVFARNSGKLCFATLQEGDGTQLQAMISLAEVGQEALDNWKTYVDIGDIVFVHGEVITSKRGELS----VLADSWQMAAKA 147
36 -14.9001nnx_A mol:protein length:109 Protein ygiW  ali model follow..  19  27.......TVESAKSLRDDTWVTLRGNIVERISDDLYVF---KDASGTINVDIDHKRWN---------VTVTPKDTVEIQGEV-----DKDWNSVEIDVKQIRKVNP. 109
37 -14.4004joi_A mol:protein length:166 CST complex subunit STN1  ali model follow..  13  37..................KQVDVLGTVIGVRERDAFYSYGVDDSTGVINCICWKKLNTESQETIEQKTKIEIGDTIRVRGSIRTYREER-----EIHATTYYKVDDP 140
38 -13.8003kf6_A mol:protein length:159 Protein stn1  ali model follow..  17  48..................RWIQIVGYIAAIDIYEGKHVLTVDDCSGMVLRVVFIIQDDFSMS--KRAISMSPGNVVCVFGKINSFRSEV-----ELIAQSFEELRDP 129
39 -12.8003kf8_A mol:protein length:220 Protein stn1  ali model follow..  12  86..................NQINIFGKIVYEQYKESYVILVISDFIGIDSKIRVRLSQEQFKEVGLTLDKKNYGKIVELEGEIYNSINVSKKPDRELKVSKITVLSHR 185
40 -12.6004gnx_B mol:protein length:136 Putative uncharacterized protein  ali model follow..  13  37..................GQLTFVAVVRNISRNATNVAYSVEDGTGQIEVRQWLDS---SSDDSSKASEIRNNVYVRVLGTLKSFQNRR-----SISSGHMRPVID. 116
41 -12.0002pi2_A mol:protein length:270 Replication protein A 32 kDa subunit  ali model follow..  13  72..................SQVTIVGIIRHAEKAPTNIVYKIDDMTAAPMDVRQWVDTDDTS---SENTVVPPETYVKVAGHLRSFQNKK-----SLVAFKIMPLED. 151
42 -11.2004gnx_A mol:protein length:114 Putative uncharacterized protein  ali model follow..  13  1MEKPTPLINSSMLGQYVGQTVRIVGKVHKVT--GNTLLMQTSDL-GNVEIAMTPDSDVSSSTFVEVTGKVSDAGSSFQANQIREFTTVDCGHDVDLTLVENVV.... 100
43 -10.8002pi2_E mol:protein length:142 Replication protein A 14 kDa subunit  ali model follow..  25.........AGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDGEG-KNGTIELMEPLDEEISGIVEVVGRVTAKATILCTSYVQFKEDSH-PFDLGLYNEAVKIIHD. 119
44 -10.7003nbh_B mol:protein length:147 RecQ-mediated genome instability protein 2  ali model follow..  16  56..................AAVWMQGRVVMADRGE----ARLRDPSGDFSVRGLERVP-------RGRPCLVPGKYVMVMGVVQACSPEP-----CLQAVKMTDLSDN 128
45 -10.7004jbj_A mol:protein length:198 Interferon-activable protein 202  ali model follow..  18  109...KETLKISKIKELDSGTLIYGVFAVEKKKVNDKSITFKIKDNEDNIKVVWDKEQHNINYEKGDKLQILHSGNHSFIKG........................... 198
46 -10.4003mxn_B mol:protein length:150 RecQ-mediated genome instability protein 2  ali model follow..  16  59..................AAVWMQGRVVMADRGE----ARLRDPSGDFSVRGLERVP-------RGRPCLVPGKYVMVMGVVQACSPEP-----CLQAVKMTDLSDN 131
47 -9.6003e0e_A mol:protein length:97 Replication protein A  ali model follow..  18  4..........KISELMPNLSGTINAEVVTAYPKGQLKSLFLKDDTGSIRGTLWNELAD---------FEVKKGDIAEVSGYVK-----QGYSGLEISVDNIGIIEKS 96
48 -9.3603dm3_A mol:protein length:105 Replication factor A  ali model follow..  20  1....EIKDTYNIGELSPGMTATFEGEVISALPIGKLKSFIVRDETGSIRVTLWDNLTD---------IDVGRGDYVRVRGYIREGYY----GGLECTANYVEILKKG 100
49 -9.2701v1q_A mol:protein length:134 PRIMOSOMAL REPLICATION PROTEIN N  ali model follow..  20..................NRLVLSGTVCRAPLRSGIPHCQFEEAGFHRQAWCQMPVIVSGHENQAITHSITVGSRITVQGFISCHKAKNGLSKMVLHAEQIELIDSV 120
50 -9.1504hsp_A mol:protein length:150 hypothetical protein  ali model follow..  11  46.........APVVKALDGIEAKLPGYIVPLEISEATEFLLVPYYGACIHVPPPPSNQIVYVKTAKGVQMDELYQPFWVEGTFKVENASSELAAAGYRMQASKV.... 142

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 7 6 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Awobuluyi M, Yang J, Ye Y, Chatterton JE, Godzik A, Lipton SA, Zhang D. Subunit-specific roles of glycine-binding domains in activation of NR1/NR3N-methyl-D-aspartate receptors. Mol Pharmacol. 2007 Jan;71(1):112-22. Epub 2006 Oct 17.