current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 4gn3_B mol:protein length:113 OBody AM1L10, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110
# Score Template Links and tools%idFirst AMGSVYPKKTHWTAEITPNLHGTEVVVAGWVASLGDYGRVKIVKVSDREGGAAVSVYLEYGKTPDHLFKVFAELSREDVVVIKGIVEASKAAADMHNGVEIFPSEIWILNKAKLast
1 -72.6004gn3_B mol:protein length:113 OBody AM1L10  ali model  100  1AMGSVYPKKTHWTAEITPNLHGTEVVVAGWVASLGDYGRVKIVKVSDREGGAAVSVYLEYGKTPDHLFKVFAELSREDVVVIKGIVEASKAAADMHNGVEIFPSEIWILNKAK 113
2 -64.9004gn4_B mol:protein length:108 OBody AM2EP06  ali model follow..  88  1...AVYPKKTHWTAEITPNLHGSEVVVAGWVAHLGDYGRVKIVKVSDREGGAAVPVYLERGKTPDHLFKVFAELSREDVVVIKGIVEASE-QYGSATGVEIFPSEIWILNKA. 108
3 -63.8004glv_B mol:protein length:107 OBody AM3L09  ali model follow..  87  1....VSPKKTHWTAEITPNLHGSEVVVAGWVAHLGDYGRVKIVKVSDREGGAAVPVYLERGKTPDHLFKVFAELSREDVVVIKGIVEATT-VTRWDTGVEIFPSEIWILNKA. 107
4 -63.0004gn5_A mol:protein length:113 OBody AM3L15  ali model follow..  87  1....VSPKKTHWTAEITPNLHGSEVVVAGWVAHLGDYGRVKIVKVSDREGGAAVPVYLERGKTPDHLFKVFAELSREDVVVIKGIVEAGW-PVALDTGVEIFPSEIWILNKAK 108
5 -62.5004gla_C mol:protein length:109 OBody NL8  ali model follow..  94  1..GSVYPKKTHWTAEITPNLHGTEVVVAGWVASLGDYGRVKIVKVSDREGGAAVPVYLEAGKTPDHLFKVFAELSREDVVVIKGIVEASKGV---GRGVEIFPSEIWILNKAK 108
6 -56.8005gro_A mol:protein length:115 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  27  2...AVGTMRSHFCTEISEKDVGKIVKVAGWCNTYRDHGGVVFIDLRDKSGLVQLVCDPS-----SKAYEKALEVRSEFVLVAKGKVRLRGANPKLKTGIEIVLEELIIENKS. 109
7 -39.6001efw_A mol:protein length:580 ASPARTYL-TRNA SYNTHETASE  ali model follow..  27  2.......RRTHYAGSLRETHVGEEVVLEGWVNRRRDLGGLIFLDLRDREGLVQLVAHPA-----SPAYATAERVRPEWVVRAKGLVRLRPPNPRLATGVEVELSALEVLAEAK 104
8 -39.4001b8a_A mol:protein length:438 PROTEIN (ASPARTYL-TRNA SYNTHETASE)  ali model follow..  38  2.......YRTHYSSEITEELNGQKVKVAGWVWEVKDLGGIKFLWIRDRDGIVQITAPKK--KVDPELFKLIPKLRSEDVVAVEGVVNFTPKAK---LGFEILPEKIVVLNRAE 102
9 -39.1004wj3_M mol:protein length:599 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  29  1....MGMMRSHYCGQLNESLDGQEVTLCGWVHRRRDHGGVIFLDVRDREGLAQVVFDPDR----AETFAKADRVRSEFVVKITGKVRLRPENPNMASGIEVLGYELEVLNQAE 109
10 -38.9001eqr_A mol:protein length:590 ASPARTYL-TRNA SYNTHETASE  ali model follow..  26  2........RTEYCGQLRLSHVGQQVTLCGWVNRRRDLGSLIFIDMRDREGIVQVFFDPDR----ADALKLASELRNEFCIQVTGTVRARDENRDMATGIEVLASSLTIINRAD 106
11 -38.6005w25_A mol:protein length:616 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  22  13..SHVFVLRSHAAGLLREGDAGQQVTLAGWVARRRDHGGVIFIDLRDASGIAQVVFRDPQ---DTEVLAQAHRLRAEFCVSVAGVVEIRPENPEIATGIEVNATSLTVLGECA 124
12 -37.5001wyd_A mol:protein length:429 hypothetical aspartyl-tRNA synthetase  ali model follow..  38  2.......YRSHFIADVTPEYDGKEVIWAGWVHLLRDLGGKKFIILRDKTGLGQVVVDKN-----SSAFGISQELTQESVIQVRGIVKADKRAPR---GIELHAEEITLLSKAK 99
13 -37.3001x54_A mol:protein length:434 Asparaginyl-tRNA synthetase  ali model follow..  24  2.......IEKVYCQEVKPELDGKKVRLAGWVYTNMRVGKKIFLWIRDSTGIVQAVVAKN--VVGEETFEKAKKLGRESSVIVEGIVKADERAP---GGAEVHVEKLEVIQAVS 102
14 -36.2004rmf_A mol:protein length:609 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  25  2.......LRTHAAGSLRPADAGQTVTLAGWVARRRDHGGVIFIDLRDASGVSQVVFREG------DVLAAAHRLRAEFCVAVTGVVEVRPENPEIPTGIEVNATELTVLGESA 105
15 -35.7004o2d_A mol:protein length:620 Aspartate--tRNA ligase  ali model follow..  24  14...GSMVLRTHAAGSLRPADAGQTVTLAGWVARRRDHGGVIFIDLRDASGVSQVVFREG------DVLAAAHRLRAEFCVAVTGVVEVRPENPEIPTGIEVNATELTVLGESA 121
16 -35.7004ah6_A mol:protein length:617 ASPARTATE--TRNA LIGASE, MITOCHONDRIAL  ali model follow..  23  6...SSFVVRTNTCGELRSSHLGQEVTLCGWIQYRRQNT---FLVLRDFDGLVQVIIPQD--ESAASVKKILCEAPVESVVQVSGTVISRPANPKMPTGIEIKVKTAELLNACK 114
17 -34.8004j15_A mol:protein length:521 Aspartate--tRNA ligase, cytoplasmic  ali model follow..  15  62............VRDLTIQKADEVVWVRARVHTSRAKGKQCFLVLRQQQFNVQALVAVGD-HASKQMVKFAANINKESIVDVEGVVRKVNQKIGTQQDVELHVQKIYVISLAE 163
18 -32.2005xix_A mol:protein length:472 Asparagine--tRNA ligase, cytoplasmic  ali model follow..  20  39.................EGYRGQRVKVFGWVHRLRRQGKLMFLVLRDGTGYLQCVLADELCQC-----YNGVLLSTESSVAVYGMLNLTPKGKQAPGGHELSCDFWELIGLAP 130
19 -31.6001asy_A mol:protein length:490 ASPARTYL-tRNA SYNTHETASE  ali model follow..  15  20..DRTGQKRVKFVDLDEAKDSDKEVLFRARVHNTRQQGALAFLTLRQQASLIQGLVKANKGTISKNMVKWAGSLNLESIVLVRGIVKKVDEPIKSATNLEIHITKIYTISET. 133
20 -30.9002xti_A mol:protein length:437 ASPARAGINYL-TRNA SYNTHETASE, CYTOPLASMIC, PUTATIVE  ali model follow..  18  9.................VKHRNERVCIKGWIHRMRRQGKLMFFILRDGTGFLQVLLMDKLCQT-----YDALTVNTECTVEIYGAIKEVPEGKEAPNGHELIADFWKIIGNAP 100
21 -29.9003m4p_A mol:protein length:456 Asparaginyl-tRNA synthetase, putative  ali model follow..  17  9..ATTTPVETPIVCNIRDGLEGKLVTFKGWAYHIRKARKLIFVELRDGSGYCQCVIFGKELCE----PEKVKLLTRECSLEITGRLNAYAGKNHDILNLEMQVTEWKVIGESP 123
22 -29.9003i7f_A mol:protein length:548 Aspartyl-tRNA synthetase  ali model follow..  17  48.......LKYTEIEELVPAMAEKTVTIRARVQAVRGKGNMVFLFLRKGIYTCQALVMKSE-TISKEFVQFCQKISAESICDITGIVKAVEKEKATQQDVEIHVTSIAVVSLAE 154
23 -28.9001n9w_A mol:protein length:422 aspartyl-tRNA synthetase 2  ali model follow..  24  9.................KAHVGQEVELLGFLHWRRDLGRIQFLLLRDRSGVVQVVTGGL------------KLPLPESALRVRGLVVENAKAP---GGLEVQAKEVEVLSPAL 89
24 -18.6004up7_A mol:protein length:777 LYSINE--TRNA LIGASE  ali model follow..  14  31.......NVSITVPEFIAQVSDDIVSVAGRVLSKRSSSALMFIDLHDSQTKLQIMLNKSAYENKEDFVSLTKMIYRGDICGFTGHPTRTKTGE-----LSLIPISGMILSPC. 139
25 -17.3003a74_A mol:protein length:493 Lysyl-tRNA synthetase  ali model follow..  20  32.......ERTHKAEELFELEQQIEVAVAGRIMTKRGMGKAGFAHIQDVTGQIQIYV--RQDDVGEQQYELFKISDLGDIVGVRGTMFKTKVGE-----LSIKVSSYEFLTKA. 139
26 -17.2004ex5_A mol:protein length:529 Lysine--tRNA ligase  ali model follow..  18  56.......QPTHHAADLQTAYKSLEVAIAGRMMLKRVMGKASFATVQDGSGQIQFFV--TPADVGAETYDAFKKWDLGDIVAARGVLFRTNKGE-----LSVKCTQLRLLAKA. 163
27 -16.3003bju_A mol:protein length:521 Lysyl-tRNA synthetase  ali model follow..  18  48..............QPGDHLTDITLKVAGRIHAKRASGKLIFYDLRGEGVKLQVMANSRNYKSEEEFIHINNKLRRGDIIGVQGNPGKTKKGE-----LSIIPYEITLLSPC. 141
28 -16.2001bbu_A mol:protein length:504 PROTEIN (LYSYL-TRNA SYNTHETASE)  ali model follow..  22  59................ELEALNIEVAVAGRMMTRRIMGKASFVTLQDVGGRIQLYVARDDLP-EGVYNEQFKKWDLGDILGAKGKLFKTKTGE-----LSIHCTELRLLTKA. 148
29 -16.2001e1o_A mol:protein length:504 LYSYL-TRNA SYNTHETASE, HEAT INDUCIBLE  ali model follow..  18  40.......RRDHTSDQLHEESLNIEVSVAGRMMTRRIMGKASFVTLQDVGGRIQLYVARDSLP-EGVYNDQFKKWDLGDIIGARGTLFKTQTGE-----LSIHCTELRLLTKA. 148
30 -15.9005hgq_A mol:protein length:524 Lysine--tRNA ligase  ali model follow..  19  52................DVILNDIVQSVAGRVFSKRESGKLIFYDLHGEGTRLQVLANARFHSGDEAFDNLHDRIKRGDIIGVNGYPARSKSGE-----LSIIPYEIIQLTPC. 143
31 -15.7006chd_A mol:protein length:597 Lysine--tRNA ligase  ali model follow..  15  100.......HVDISLTDFIQKYTDITLKVAGRIHAKRASGKLIFYDLRGEGVKLQVMANSRNYKSEEEFIHINNKLRRGDIIGVQGNPGKTKKGE-----LSIIPYEITLLSPC. 209
32 -14.7005eln_A mol:protein length:535 Lysine--tRNA ligase  ali model follow..  16  41.......KISMSLPAYALKYKDTTLSLSGRVTSIRSSSKLIFYDIFCEEQKVQIIANIMEHDISTGEFSVSHSIRRGDVVGFTGFPGKSKRGE-----LSLFSKSVVLLSPC. 151
33 -14.4005vl1_A mol:protein length:506 Lysine--tRNA ligase  ali model follow..  21  37.......ERTHTLAEIRASATEDIVGVAGRVVFARNTGKLCFATLQDGDGTQLQAMISLDEVGRESLDRWKADVDIGDVVYVHGTVISSRRGE-----LSVLADSWRMAAKA. 144
34 -14.3004ycv_A mol:protein length:516 Lysine--tRNA ligase  ali model follow..  18  50................GEHLEDTILNITGRIMRVSASGKLRFFDLVGDGEKIQVLANYSFNHEKGNFAECYDKIRRGDIVGIVGFPGKSKKGE-----LSIFPKETILLSAC. 142
35 -14.1006aqh_A mol:protein length:508 Lysine--tRNA ligase  ali model follow..  19  40.......PRTHTLLEIRQARTGEIVGVTGRVVFARNSGKLCFATLQEGDGTQLQAMISLAEVGQEALDNWKTYVDIGDIVFVHGEVITSKRGE-----LSVLADSWQMAAKA. 147
36 -13.9001nnx_A mol:protein length:109 Protein ygiW  ali model follow..  20  27...........TVESAKSLRDDTWVTLRGNIVERISDDLYVF---KDASGTINVDIDHKRWN---------VTVTPKDTVEIQGEV------DKDWNSVEIDVKQIRKVNP.. 109
37 -13.1004joi_A mol:protein length:166 CST complex subunit STN1  ali model follow..  12  37......................KQVDVLGTVIGVRERDAFYSYGVDDSTGVINCICWKKLNTESQETIEQKTKIEIGDTIRVRGSIRT------YREEREIHATTYYKVDDPV 141
38 -12.9003kf6_A mol:protein length:159 Protein stn1  ali model follow..  16  48......................RWIQIVGYIAAIDIYEGKHVLTVDDCSGMVLRVVFIIQDDFSMS--KRAISMSPGNVVCVFGKINSFRSEV------ELIAQSFEELRDPN 130
39 -12.8003kf8_A mol:protein length:220 Protein stn1  ali model follow..  13  86......................NQINIFGKIEFNGVEESYVILVISDFIGIDSKIRVRLSQEQFKEVGLTLDKKNYGKIVELEGEIYNWYDSINVSK--ELKVSKITVLSHRP 186
40 -11.8002pi2_E mol:protein length:142 Replication protein A 14 kDa subunit  ali model follow..  25.............AGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDGEG-KNGTIELMEPLDEEISGIVEVVGRVTAKATILCTSYVQFKEDSHPF--DLGLYNEAVKIIHDFP 121
41 -11.8004gnx_B mol:protein length:136 Putative uncharacterized protein  ali model follow..  10  37......................GQLTFVAVVRNISRNATNVAYSVEDGTGQIEVRQ-----DSSSDDSSKASEIRNNVYVRVLGTLKSFQNRR------SISSGHMRPVIDYN 118
42 -11.2002pi2_A mol:protein length:270 Replication protein A 32 kDa subunit  ali model follow..  72......................SQVTIVGIIRHAEKAPTNIVYKIDDMTAAPMDVRQWVDTDDTS---SENTVVPPETYVKVAGHLRSFQNKKSLVA--EFTTHILEVI.... 163
43 -10.3004jbj_A mol:protein length:198 Interferon-activable protein 202  ali model follow..  19  109.......KETLKISKIKELDSGTLIYGVFAVEKKKVNDKSITFKIKDNEDNIKVVWDKEQHNINYEKGDKLQILHSGNHSFIKG............................. 198
44 -9.8703nbh_B mol:protein length:147 RecQ-mediated genome instability protein 2  ali model follow..  16  56......................AAVWMQGRVVMADRGE----ARLRDPSGDFSVRGLERVPRGRP-------CLVPGKYVMVMGVVQACSPEP------CLQAVKMTDLSD.. 127
45 -9.5303mxn_B mol:protein length:150 RecQ-mediated genome instability protein 2  ali model follow..  16  59......................AAVWMQGRVVMADRGE----ARLRDPSGDFSVRGLERVP-------RGRPCLVPGKYVMVMGVVQACSPEP------CLQAVKMTDLSD.. 130
46 -9.1304hsp_A mol:protein length:150 hypothetical protein  ali model follow..  12  46.............APVVKALDGIEAKLPGYIEISEAGLVTEFLLVPYYGACIHVPPPPSNQIVYVKTAKGVQMDELYQPFWVEGTFKVENASSELAAGYRMQASKVTPYEYEG 149

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 7 6 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Awobuluyi M, Yang J, Ye Y, Chatterton JE, Godzik A, Lipton SA, Zhang D. Subunit-specific roles of glycine-binding domains in activation of NR1/NR3N-methyl-D-aspartate receptors. Mol Pharmacol. 2007 Jan;71(1):112-22. Epub 2006 Oct 17.