current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 4gn5_A mol:protein length:113 OBody AM3L15, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110
# Score Template Links and tools%idFirst VSPKKTHWTAEITPNLHGSEVVVAGWVAHLGDYGRVKIVKVSDREGGAAVPVYLERGKTPDHLFKVFAELSREDVVVIKGIVEAGWPVALDTGVEIFPSEIWILNKAKPLPIDLast
1 -72.2004gn5_A mol:protein length:113 OBody AM3L15  ali model  100  1VSPKKTHWTAEITPNLHGSEVVVAGWVAHLGDYGRVKIVKVSDREGGAAVPVYLERGKTPDHLFKVFAELSREDVVVIKGIVEAGWPVALDTGVEIFPSEIWILNKAKPLPID 113
2 -66.2004glv_B mol:protein length:107 OBody AM3L09  ali model follow..  94  1VSPKKTHWTAEITPNLHGSEVVVAGWVAHLGDYGRVKIVKVSDREGGAAVPVYLERGKTPDHLFKVFAELSREDVVVIKGIVEATTVTRWDTGVEIFPSEIWILNKA...... 107
3 -65.7004gn4_B mol:protein length:108 OBody AM2EP06  ali model follow..  92  2VYPKKTHWTAEITPNLHGSEVVVAGWVAHLGDYGRVKIVKVSDREGGAAVPVYLERGKTPDHLFKVFAELSREDVVVIKGIVEASEQYGSATGVEIFPSEIWILNKA...... 108
4 -63.0004gn3_B mol:protein length:113 OBody AM1L10  ali model follow..  87  5VYPKKTHWTAEITPNLHGTEVVVAGWVASLGDYGRVKIVKVSDREGGAAVSVYLEYGKTPDHLFKVFAELSREDVVVIKGIVEASKAADMHNGVEIFPSEIWILNKAK..... 113
5 -61.3004gla_C mol:protein length:109 OBody NL8  ali model follow..  90  3VYPKKTHWTAEITPNLHGTEVVVAGWVASLGDYGRVKIVKVSDREGGAAVPVYLEAGKTPDHLFKVFAELSREDVVVIKGIVEASKGV--GRGVEIFPSEIWILNKAKA.... 109
6 -55.7005gro_A mol:protein length:115 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  26  3VGTMRSHFCTEISEKDVGKIVKVAGWCNTYRDHGGVVFIDLRDKSGLVQLVCDPSS-----KAYEKALEVRSEFVLVAKGKVRLRGAGLETGKIEIVLEELIIENKS...... 109
7 -42.1004wj3_M mol:protein length:599 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  29  1MGMMRSHYCGQLNESLDGQEVTLCGWVHRRRDHGGVIFLDVRDREGLAQVVFDPDR----AETFAKADRVRSEFVVKITGKVRLRPEGARSGSIEVLGYELEVLNQAETPPFP 114
8 -41.5001eqr_A mol:protein length:590 ASPARTYL-TRNA SYNTHETASE  ali model follow..  26  2....RTEYCGQLRLSHVGQQVTLCGWVNRRRDLGSLIFIDMRDREGIVQVFFDPDR----ADALKLASELRNEFCIQVTGTVRARDEKNITGEIEVLASSLTIINRADVLPLD 111
9 -40.6005w25_A mol:protein length:616 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  23  16.FVLRSHAAGLLREGDAGQQVTLAGWVARRRDHGGVIFIDLRDASGIAQVVFRDPQ---DTEVLAQAHRLRAEFCVSVAGVVEIRPEGNATGEIEVNATSLTVLGECAPLPFQ 129
10 -40.6001efw_A mol:protein length:580 ASPARTYL-TRNA SYNTHETASE  ali model follow..  25  2...RRTHYAGSLRETHVGEEVVLEGWVNRRRDLGGLIFLDLRDREGLVQLVAHPAS-----PAYATAERVRPEWVVRAKGLVRLRPEPNATGRVEVELSALEVLAEAKTPPFP 109
11 -38.8001b8a_A mol:protein length:438 PROTEIN (ASPARTYL-TRNA SYNTHETASE)  ali model follow..  39  2...YRTHYSSEITEELNGQKVKVAGWVWEVKDLGGIKFLWIRDRDGIVQITA--PKKKVDPELFKLIPKLRSEDVVAVEGVVNFTPKA--KLGFEILPEKIVVLNRATPLPLD 108
12 -38.5004rmf_A mol:protein length:609 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  25  2...LRTHAAGSLRPADAGQTVTLAGWVARRRDHGGVIFIDLRDASGVSQVVFREG------DVLAAAHRLRAEFCVAVTGVVEVRPEGNETGQIEVNATELTVLGESAPLPFQ 110
13 -38.0004ah6_A mol:protein length:617 ASPARTATE--TRNA LIGASE, MITOCHONDRIAL  ali model follow..  21  8.FVVRTNTCGELRSSHLGQEVTLCGWIQYRRQNT---FLVLRDFDGLVQVIIPQDE--SAASVKKILCEAPVESVVQVSGTVISRPAGQETGEIEIKVKTAELLNACKKLPFE 119
14 -37.9004o2d_A mol:protein length:620 Aspartate--tRNA ligase  ali model follow..  25  16.MVLRTHAAGSLRPADAGQTVTLAGWVARRRDHGGVIFIDLRDASGVSQVVFREG------DVLAAAHRLRAEFCVAVTGVVEVRPEGNETGQIEVNATELTVLGESAPLPFQ 126
15 -37.2001x54_A mol:protein length:434 Asparaginyl-tRNA synthetase  ali model follow..  24  3....EKVYCQEVKPELDGKKVRLAGWVYTNMRVGKKIFLWIRDSTGIVQAVV--AKNVVGEETFEKAKKLGRESSVIVEGIVKADERA--PGGAEVHVEKLEVIQAVSEFPIP 107
16 -37.0001wyd_A mol:protein length:429 hypothetical aspartyl-tRNA synthetase  ali model follow..  37  2...YRSHFIADVTPEYDGKEVIWAGWVHLLRDLGGKKFIILRDKTGLGQVVVDKNS-----SAFGISQELTQESVIQVRGIVKADKRA--PRGIELHAEEITLLSKAAPLPLD 105
17 -36.3004j15_A mol:protein length:521 Aspartate--tRNA ligase, cytoplasmic  ali model follow..  17  62........VRDLTIQKADEVVWVRARVHTSRAKGKQCFLVLRQQQFNVQALVAVGD-HASKQMVKFAANINKESIVDVEGVVRKVNQKITQQDVELHVQKIYVISLAPRLPLQ 169
18 -32.3001asy_A mol:protein length:490 ASPARTYL-tRNA SYNTHETASE  ali model follow..  18  25...KRVKFVDLDEAKDSDKEVLFRARVHNTRQQGALAFLTLRQQASLIQGLVKANKGTISKNMVKWAGSLNLESIVLVRGIVKKVDEPIKSQNLEIHITKIYTISETEALPIL 140
19 -29.5001n9w_A mol:protein length:422 aspartyl-tRNA synthetase 2  ali model follow..  24  9.............KAHVGQEVELLGFLHWRRDLGRIQFLLLRDRSGVVQVVTGGLK------------LPLPESALRVRGLVVENAKA--PGGLEVQAKEVEVLSPAEPTPVE 95
20 -29.3003i7f_A mol:protein length:548 Aspartyl-tRNA synthetase  ali model follow..  18  48...LKYTEIEELVPAMAEKTVTIRARVQAVRGKGNMVFLFLRKGIYTCQALVMKSE-TISKEFVQFCQKISAESICDITGIVKAVEKKATQQDVEIHVTSIAVVSLAEY.... 155
21 -29.2005xix_A mol:protein length:472 Asparagine--tRNA ligase, cytoplasmic  ali model follow..  20  39.............EGYRGQRVKVFGWVHRLRRQGKLMFLVLRDGTGYLQCVLADELCQC-----YNGVLLSTESSVAVYGMLNLTPKGKQAGGHELSCDFWELIGLAPA.... 131
22 -28.6003m4p_A mol:protein length:456 Asparaginyl-tRNA synthetase, putative  ali model follow..  18  15....ETPIVCNIRDGLEGKLVTFKGWAYHIRKARKLIFVELRDGSGYCQCVIFGKE----LCEPEKVKLLTRECSLEITGRLNAYAGKNDILNLEMQVTEWKVIGESPI.... 124
23 -28.2002xti_A mol:protein length:437 ASPARAGINYL-TRNA SYNTHETASE, CYTOPLASMIC, PUTATIVE  ali model follow..  18  9.............VKHRNERVCIKGWIHRMRRQGKLMFFILRDGTGFLQVLLMDKLCQT-----YDALTVNTECTVEIYGAIKEVPEGKEANGHELIADFWKIIGNAPPGGI. 104
24 -20.4004up7_A mol:protein length:777 LYSINE--TRNA LIGASE  ali model follow..  11  30..FNVSITVPEFIAQVSDDIVSVAGRVLSKRSSSALMFIDLHDSQTKLQIMLNKSAYENKEDFVSLTKMIYRGDICGFTGHPTRTK----TGELSLIPISGMILSPCLHMLPS 145
25 -20.3003a74_A mol:protein length:493 Lysyl-tRNA synthetase  ali model follow..  22  31..FERTHKAEELFELYQQIEVAVAGRIMTKRGMGKAGFAHIQDVTGQIQIYV--RQDDVGEQQYELFKISDLGDIVGVRGTMFKTK----VGELSIKVSSYEFLTKARPLP.. 144
26 -20.2004ex5_A mol:protein length:529 Lysine--tRNA ligase  ali model follow..  20  55..FQPTHHAADLQTAYKSLEVAIAGRMMLKRVMGKASFATVQDGSGQIQFFV--TPADVGAETYDAFKKWDLGDIVAARGVLFRTN----KGELSVKCTQLRLLAKARPLP.. 168
27 -18.9003bju_A mol:protein length:521 Lysyl-tRNA synthetase  ali model follow..  15  31..FHVDISLTDFIQKYTDITLKVAGRIHAKRASGKLIFYDLRGEGVKLQVMANSRNYKSEEEFIHINNKLRRGDIIGVQGNPGKTK----KGELSIIPYEITLLSPCHMLP.. 146
28 -18.9001bbu_A mol:protein length:504 PROTEIN (LYSYL-TRNA SYNTHETASE)  ali model follow..  21  39..FRRDHTSDQLHAEFLNIEVAVAGRMMTRRIMGKASFVTLQDVGGRIQLYVARDDLP-EGVYNEQFKKWDLGDILGAKGKLFKTK----TGELSIHCTELRLLTKARPLP.. 153
29 -18.9001e1o_A mol:protein length:504 LYSYL-TRNA SYNTHETASE, HEAT INDUCIBLE  ali model follow..  20  39..FRRDHTSDQLHEEFLNIEVSVAGRMMTRRIMGKASFVTLQDVGGRIQLYVARDSLP-EGVYNDQFKKWDLGDIIGARGTLFKTQ----TGELSIHCTELRLLTKARPLP.. 153
30 -18.5005hgq_A mol:protein length:524 Lysine--tRNA ligase  ali model follow..  15  33..FHVSISLADFIAKYNDIVQSVAGRVFSKRESGKLIFYDLHGEGTRLQVLANARFHSGDEAFDNLHDRIKRGDIIGVNGYPARSK----SGELSIIPYEIIQLTPCHMLP.. 148
31 -18.3006chd_A mol:protein length:597 Lysine--tRNA ligase  ali model follow..  15  99..FHVDISLTDFIQKYTDITLKVAGRIHAKRASGKLIFYDLRGEGVKLQVMANSRNYKSEEEFIHINNKLRRGDIIGVQGNPGKTK----KGELSIIPYEITLLSPCHMLP.. 214
32 -17.5005eln_A mol:protein length:535 Lysine--tRNA ligase  ali model follow..  13  40..FKISMSLPAYALKYKDTTLSLSGRVTSIRSSSKLIFYDIFCEEQKVQIIANIMEHDISTGEFSVSHSIRRGDVVGFTGFPGKSK----RGELSLFSKSVVLLSPCHMLP.. 156
33 -17.0005vl1_A mol:protein length:506 Lysine--tRNA ligase  ali model follow..  22  36..IERTHTLAEIRASATEDIVGVAGRVVFARNTGKLCFATLQDGDGTQLQAMISLDEVGRESLDRWKADVDIGDVVYVHGTVISSR----RGELSVLADSWRMAAKARPLP.. 149
34 -16.8004ycv_A mol:protein length:516 Lysine--tRNA ligase  ali model follow..  15  31..FERTISIPEFIEKYEDTILNITGRIMRVSASGKLRFFDLVGDGEKIQVLANYSFNHEKGNFAECYDKIRRGDIVGIVGFPGKSK----KGELSIFPKETILLSACHMLP.. 147
35 -16.6006aqh_A mol:protein length:508 Lysine--tRNA ligase  ali model follow..  19  39..VPRTHTLLEIRQAYTGEIVGVTGRVVFARNSGKLCFATLQEGDGTQLQAMISLAEVGQEALDNWKTYVDIGDIVFVHGEVITSK----RGELSVLADSWQMAAKARPLP.. 152
36 -14.8001nnx_A mol:protein length:109 Protein ygiW  ali model follow..  19  27.......TVESAKSLRDDTWVTLRGNIVERISDDLYVF---KDASGTINVDIDHKRWN---------VTVTPKDTVEIQGEVDKD------NSVEIDVKQIRKVNP....... 109
37 -14.0004joi_A mol:protein length:166 CST complex subunit STN1  ali model follow..  12  37..................KQVDVLGTVIGVRERDAFYSYGVDDSTGVINCICWKKLNTESQETIEQKTKIEIGDTIRVRGSIRT------REEREIHATTYYKVDDPV..... 141
38 -13.6003kf6_A mol:protein length:159 Protein stn1  ali model follow..  16  48..................RWIQIVGYIAAIDIYEGKHVLTVDDCSGMVLRVVFIIQDDFSMS--KRAISMSPGNVVCVFGKINSFRSEV-----ELIAQSFEELRDPND.... 131
39 -12.7004gnx_B mol:protein length:136 Putative uncharacterized protein  ali model follow..  11  37..................GQLTFVAVVRNISRNATNVAYSVEDGTGQIEVRQWLDS---SSDDSSKASEIRNNVYVRVLGTLKSFQNRR-----SISSGHMRPVIDYNEVMFH 123
40 -12.5003kf8_A mol:protein length:220 Protein stn1  ali model follow..  13  86..................NQINIFGKIVYEQYKESYVILVISDFIGIDSKIRVRLSQEQFKEVGLTLDKKNYGKIVELEGEIYNSINVSKKPDRELKVSKITVLSHRPD.... 187
41 -12.3002pi2_A mol:protein length:270 Replication protein A 32 kDa subunit  ali model follow..  12  72..................SQVTIVGIIRHAEKAPTNIVYKIDDMTAAPMDVRQWVDTDDTS---SENTVVPPETYVKVAGHLRSFQNKK-----SLVAFKIMPLEDMNEFTTH 158
42 -11.2004gnx_A mol:protein length:114 Putative uncharacterized protein  ali model follow..  13  1MEKPTPLINSSMLGQYVGQTVRIVGKVHKVT--GNTLLMQTSDL-GNVEIAMTPDSDVSSSTFVEVTGKVSDAGSSFQANQIREFTTVDCGHDVDLTLVEVQISAAFPNL... 109
43 -11.2002pi2_E mol:protein length:142 Replication protein A 14 kDa subunit  ali model follow..  25.........AGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDGEG-KNGTIELMEPLDEEISGIVEVVGRVTAKATILCTSYVQFKEDSH---DLGLYNEAVKIIHDFPQF... 123
44 -10.4003nbh_B mol:protein length:147 RecQ-mediated genome instability protein 2  ali model follow..  16  56..................AAVWMQGRVVMADRGE----ARLRDPSGDFSVRGLERVP-------RGRPCLVPGKYVMVMGVVQA-----CSPEPCLQAVKMTDLSDN...... 128
45 -10.3004jbj_A mol:protein length:198 Interferon-activable protein 202  ali model follow..  18  109...KETLKISKIKELDSGTLIYGVFAVEKKKVNDKSITFKIKDNEDNIKVVWDKEQHNINYEKGDKLQILHSGNHSFIKG................................. 198
46 -10.3003dm3_A mol:protein length:105 Replication factor A  ali model follow..  20  1....EIKDTYNIGELSPGMTATFEGEVISALPIGKLKSFIVRDETGSIRVTLWDNLTD---------IDVGRGDYVRVRGYIREGYY----GGLECTANYVEILKKGEKIE.. 104
47 -10.2003mxn_B mol:protein length:150 RecQ-mediated genome instability protein 2  ali model follow..  16  59..................AAVWMQGRVVMADRGE----ARLRDPSGDFSVRGLERVP-------RGRPCLVPGKYVMVMGVVQA-----CSPEPCLQAVKMTDLSD....... 130
48 -9.6301v1q_A mol:protein length:134 PRIMOSOMAL REPLICATION PROTEIN N  ali model follow..  20..................NRLVLSGTVCRAPLRSGIPHCQFEEAGFHRQAWCQMPVIVSGHENQAITHSITVGSRITVQGFISCHKAKNGLSKMVLHAEQIELIDSVDK.... 122
49 -9.3302pnh_A mol:protein length:107 Primosomal replication protein n  ali model follow..  6..................NRLVLSGTVCRAPLRSGIPHCQFEAAGFHRQAWCQMPVIVSGHENQAITHSITVGSRITVQGFISCHKAKNGLSKMVLHAEQIELIDSGD..... 107
50 -9.2904apv_A mol:protein length:112 PRIMOSOMAL REPLICATION PROTEIN N  ali model follow..  3..................NRLELSGIICRTPLRSGIPHCQFEEAGFHRQAWCQMPVIISGHENQAITHSITVGSAVTVRGFISCHKAKNGLSKMVLHAEQIELIDSGDL.... 105
51 -9.1704hsp_A mol:protein length:150 hypothetical protein  ali model follow..  11  46.........APVVKALDGIEAKLPGYIVPLEISEATEFLLVPYYGACIHVPPPPSNQIVYVKTAKGVQMDELYQPFWVEGTFKVENASSELAAAGYRMQASKVTPYEYE.... 148
52 -9.1403e0e_A mol:protein length:97 Replication protein A  ali model follow..  18  4..........KISELMPNLSGTINAEVVTAYPKGQLKSLFLKDDTGSIRGTLWNELAD---------FEVKKGDIAEVSGYVKQ------YSGLEISVDNIGIIEKS...... 96
53 -9.0905wqv_A mol:protein length:104 Primosomal replication protein N  ali model follow..  3..................NRLVLSGTVCRAPLRSGIPHCQFEEAGFHRQAWCQMPVIVAGHENQAITHSITVGSRITVQGFISCHKAKNGLSKMVLHAEQIELIDSGD..... 104

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 7 6 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Awobuluyi M, Yang J, Ye Y, Chatterton JE, Godzik A, Lipton SA, Zhang D. Subunit-specific roles of glycine-binding domains in activation of NR1/NR3N-methyl-D-aspartate receptors. Mol Pharmacol. 2007 Jan;71(1):112-22. Epub 2006 Oct 17.