current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 4gnx_A mol:protein length:114 Putative uncharacterized protein, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110
# Score Template Links and tools%idFirst MEKPTPLINSSMLGQYVGQTVRIVGKVHKVTGNTLLMQTSDLGNVEIAMTPDSDVSSSTFVEVTGKVSDAGSSFQANQIREFTTVDCGHDVDLTLVENVVQISAAFPNLFSDSTLast
1 -69.2004gnx_A mol:protein length:114 Putative uncharacterized protein  ali model  100  1MEKPTPLINSSMLGQYVGQTVRIVGKVHKVTGNTLLMQTSDLGNVEIAMTPDSDVSSSTFVEVTGKVSDAGSSFQANQIREFTTVDCGHDVDLTLVENVVQISAAFPNLFSDST 114
2 -52.9002pi2_E mol:protein length:142 Replication protein A 14 kDa subunit  ali model follow..  24  16MDLPRSRINAGMLAQFIDKPVCFVGRLEKIHPTMFILSDGEGKNGTIELMEPLDEEISGIVEVVGRVTAKATILCTSYVQF----EDSHPFDLGLYNEAVKIIHDFPQFYPLGI 128
3 -50.1006d6v_F mol:protein length:121 Telomerase holoenzyme TEB heterotrimer Teb3 subunit  ali model follow..  17  7.QVMYPRILFEQMAQFRGKKVTVVGNVCNEDQNDSLVIEFGPTGLNQHVVRVDLNNTTKFVEIRGVVLNQNIVSCEELTEF----EQKDPFDFDTYSKLIHLSQKLSSLFTDQ. 121
4 -18.7004joi_D mol:protein length:122 CST complex subunit TEN1  ali model follow..  14  22.................GSTLRTFGRLCLYDMIQSRVTLMAQHGVCTKLVEPFHAQVGSLYIVLGELQHQQDRGSVVKARVLTCV---EGMNLPLLEQAIREQRLYKQ...... 116
5 -18.2003kf6_B mol:protein length:105 Protein ten1  ali model follow..  15  13.........NQINDCKDGQKLRFLGCVQSYKNGILRLI-DGSSSVTCDVTPDVSIQKHEWLNIVGRKRQDGIVDVLLIRSA-------VGINLPRYRQMVSERQKCD....... 105
6 -11.2003nbh_B mol:protein length:147 RecQ-mediated genome instability protein 2  ali model follow..  56..................AAVWMQGRVVMADRGEARLRDPSG-DFSVRGRGRPCLVPGKYVMVMGVVQACSP---EPCLQAVKMTDLSDNPIHESM--ELEVEDLHRNI..... 146
7 -11.2004gn5_A mol:protein length:113 OBody AM3L15  ali model follow..  13  1VSPKKTHWTAEITPNLHGSEVVVAGWVAHLGGRVKIVKVSDRGGAAVPVYLERGKTPDHLFKVFAELSREDVVVIKGIVEAGWPVALDTGVEIFPSE--IWILNKAKPL..... 110
8 -11.2004glv_B mol:protein length:107 OBody AM3L09  ali model follow..  13  1VSPKKTHWTAEITPNLHGSEVVVAGWVAHLGGRVKIVKVSDRGGAAVPVYLERGKTPDHLFKVFAELSREDVVVIKGIVEATTVTRWDTGVEIFPSEIWI.............. 103
9 -11.1003mxn_B mol:protein length:150 RecQ-mediated genome instability protein 2  ali model follow..  59..................AAVWMQGRVVMADRGEARLRDPSG-DFSVRGRGRPCLVPGKYVMVMGVVQ---ACSPEPCLQAVKMTDLSDNPIHESM--ELEVEDLHRNI..... 149
10 -10.2004gn4_B mol:protein length:108 OBody AM2EP06  ali model follow..  13  11.........AEITPNLHGSEVVVAGWVAHLGGRVKIVKVSDRGGAAVPVYLERGKTPDHLFKVFAELSREDVVVIKGIVEASEQYGSATGVEIFPSEIWI.............. 104
11 -9.1901n9w_A mol:protein length:422 aspartyl-tRNA synthetase 2  ali model follow..  16  2......RVLVRDLKAHVGQEVELLGFLHWRRGRIQFLLLRDRGVVQVVTGGLKLPLPESALRVRGLVVENAKAPGGLEVQAKEVEVLSP......................... 87

FFAS is supported by the NIH grant R01-GM087218-01
1 3 3 6 3 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Godzik A. Flexible structure alignment by chaining aligned fragment pairs allowing twists. Bioinformatics. 2003 Oct;19 Suppl 2:II246-II255.