current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 4gnx_B mol:protein length:136 Putative uncharacterized protein, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .
# Score Template Links and tools%idFirst GKKAGNNTLRPVTIRQILNAEQPHPDAEFILDGAELGQLTFVAVVRNISRNATNVAYSVEDGTGQIEVRQWLDSSSDDSSKASEIRNNVYVRVLGTLKSFQNRRSISSGHMRPVIDYNEVMFHRLEAVHAHLQVTRLast
1 -76.3004gnx_B mol:protein length:136 Putative uncharacterized protein  ali model  100  1GKKAGNNTLRPVTIRQILNAEQPHPDAEFILDGAELGQLTFVAVVRNISRNATNVAYSVEDGTGQIEVRQWLDSSSDDSSKASEIRNNVYVRVLGTLKSFQNRRSISSGHMRPVIDYNEVMFHRLEAVHAHLQVTR 136
2 -61.7002pi2_A mol:protein length:270 Replication protein A 32 kDa subunit  ali model follow..  30  39.SRARAQHIVPCTISQLLSATL--VDEVFRIGNVEISQVTIVGIIRHAEKAPTNIVYKIDDMTAAPMDVRQWVDTDDTSSENTVVPPETYVKVAGHLRSFQNKKSLVAFKIMPLEDMNEFTTHILEVINAHMVLSK 171
3 -53.6004joi_A mol:protein length:166 CST complex subunit STN1  ali model follow..  21  2..DPVFLAFAKLYIRDILDMKESQVPGVFLYNGHPIKQVDVLGTVIGVRERDAFYSYGVDDSTGVINCICWKKLNTESVSAATKIEIGDTIRVRGSIRTYREEREIHATTYYKVDDPNIQIARMLELPTIYRKVYD 161
4 -52.3003kf6_A mol:protein length:159 Protein stn1  ali model follow..  13  10HQFPTLSRWNPMFISDVHKISFHPHRYIGFWMGFPIRWIQIVGYIAAIDIYEGKHVLTVDDCSGMVLRVVFIIQDDFSSKRAISMSPGNVVCVFGKINSFRSEVELIAQSFEELRDPNDEWKAWQKRMRYKKNLTK 148
5 -44.5003mxn_B mol:protein length:150 RecQ-mediated genome instability protein 2  ali model follow..  15  17GVRLPRSPPLKVLAEQLRRDAEGGPGAAAGRGPLDLAAVWMQGRVVMADRGE----ARLRDPSGDFSVRGL----ERVPRGRPCLVPGKYVMVMGVVQACSPEPCLQAVKMTDLSDPIHESMWELEVEDLHRNIP. 150
6 -44.4003nbh_B mol:protein length:147 RecQ-mediated genome instability protein 2  ali model follow..  15  14GVRLPRSPPLKVLAEQLRRDAEGGPGAAAGRGPLDLAAVWMQGRVVMADRGE----ARLRDPSGDFSVRGL----ERVPRGRPCLVPGKYVMVMGVVQACSPEPCLQAVKMTDLSDPIHESMWELEVEDLHRNIP. 147
7 -40.7003kf8_A mol:protein length:220 Protein stn1  ali model follow..  41HQAPTFDKTIPLFISDINNSPNLYGRHVVLVNNYPVNQINIFGKIVYEQVEESYVILVISDFIGIDSKIRVRLSQEQFKETLDKKNYGKIVELEGEIYNWYDSINVSKKPDRELDGLHFEFEQWKKRMEFRKNN.. 206
8 -18.2001nnx_A mol:protein length:109 Protein ygiW  ali model follow..  14  19....QGPNGSVTTVESAKSLRDD-------------TWVTLRGNIVERISDDL---YVFKDASGTINV-----DIDHKRWNGVTVTPKDTVEIQGEVDKDWNSVEIDVKQIRKVN..................... 108
9 -14.4002k5v_A mol:protein length:104 Replication protein A  ali model follow..  16  12....................................LSGTINAEVVAAYTKGQLKSLFLKDDTGSIRGTLWNELADFE------VKKGDIAEVSGYVKQGYSGLEISVDNIGIIEKSLE................. 98
10 -14.1004jbj_A mol:protein length:198 Interferon-activable protein 202  ali model follow..  12  102.KNIIRSAKETLKISKIKELDSG-------------TLIYGVFAVEKKKVNDKSITFKIKDNEDNIKVVWDKEQHNIN------YEKGDKLQLFSHLRKGNGKPILHSGNHSFIKG.................... 198
11 -13.9004jbm_A mol:protein length:193 Interferon-inducible protein AIM2  ali model follow..  17  112......................................VNGLFKVQKITEEKDRVLYGIHDKTGTMEVLVLGNPSKTK------CEEGDKIRLTFEVSKNGVKIQLKSGPCSFFKVIKA................. 187
12 -13.9003e0e_A mol:protein length:97 Replication protein A  ali model follow..  16  12....................................LSGTINAEVVTAYTKGQLKSLFLKDDTGSIRGTLWNELADFE------VKKGDIAEVSGYVKQGYSGLEISVDNIGIIE..................... 94
13 -13.7003rn2_A mol:protein length:208 Interferon-inducible protein AIM2  ali model follow..  18  123....................................TIVNGLFVVQKVTEKKKNILFDLSDNTGKMEVLGVRNEDTMK------CKEGDKVRLTFTLSKNGEKLQLTSGVHSTIK..................... 196
14 -13.6003dm3_A mol:protein length:105 Replication factor A  ali model follow..  18  2.............IKDTYNIGELSPGMTATFEGEVISALPIKEFKRADGSIGKLKSFIVRDETGSIRVTLWDNLTDID------VGRGDYVRVRGIREGYYGGLECTANYVEILKKGEKI................ 103
15 -13.6002kbn_A mol:protein length:109 Conserved protein  ali model follow..  12  16....................................QWANLKAKVIQLWENTHEQVGLLGDETGIIKFTIWKNAELPL------LEQGESYLLRSVVGEYNDRFQVQVNKNSSIEKLSE................. 96
16 -13.5004l5t_A mol:protein length:203 Interferon-activable protein 202  ali model follow..  14  124....................................RLVDGEFKVYRKSSGNNCICYGIWDDTGAMKVVVSGQLTSVN------CEIGNTIRLVCELTSNADEWFLRATRYSYME..................... 197
17 -13.2004gla_C mol:protein length:109 OBody NL8  ali model follow..  12  21....................................TEVVVAGWVASLGDYGRVKIVKVSDREGGAAVPVYLEAPDHLFKVFAELSREDVVVIKGIVEASKRGVEIFPSEIWILNKAK.................. 108
18 -13.0005xix_A mol:protein length:472 Asparagine--tRNA ligase, cytoplasmic  ali model follow..  16  9.VPRGSHMAKKITIKNDPSLPEPKCVKIGALEGYRGQRVKVFGWVHRLRRQGKNLMFVLRDGTGYLQCV--LADELCQCYNGVLLSTESSVAVYGMLNLTPKGKELSCDFWELIGLAPA................. 131
19 -12.8004lnq_A mol:protein length:197 Interferon-activable protein 202  ali model follow..  12  98.KNIIRSAKETLKISKIKELDSG-------------TLIYGVFAVEKKKVNDKSITFKIKDNEDNIKVVWDKEQHNIN------YEKGDKLQLFSHLRKGNGKPILHSGNHSFIK..................... 193
20 -12.7004gn5_A mol:protein length:113 OBody AM3L15  ali model follow..  11  19....................................SEVVVAGWVAHLGDYGRVKIVKVSDREGGAAVPVYLERPDHLFKVFAELSREDVVVIKGIVEAGWPVAEIFPSEIWILNKAKPLPID............. 113
21 -12.7004l5q_A mol:protein length:199 Interferon-activable protein 202  ali model follow..  12  102.KNIIRSAKETLKISKIKELDSG-------------TLIYGVFAVEKKKVNDKSITFKIKDNEDNIKVVWDKEQHNIN------YEKGDKLQLFSHLRKGNGKPILHSGNHSFIK..................... 197
22 -12.7004glv_B mol:protein length:107 OBody AM3L09  ali model follow..  13  19....................................SEVVVAGWVAHLGDYGRVKIVKVSDREGGAAVPVYLERPDHLFKVFAELSREDVVVIKGIVEATTVTREIFPSEIWILNK.................... 106
23 -12.5005d8e_A mol:protein length:115 SOSS complex subunit B1  ali model follow..  15  15....................................KNLNLIFIVLETKDGHEVRTCKVADKTGSINISVW-------DDVGNLIQPGDIIRMTGYASVFKGCLTLYTGRGGDLQKIGEFCMVYSEVPNFS..... 109
24 -12.4004gn4_B mol:protein length:108 OBody AM2EP06  ali model follow..  12  20....................................SEVVVAGWVAHLGDYGRVKIVKVSDREGGAAVPVYLERPDHLFKVFAELSREDVVVIKGIVEASEQYGEIFPSEIWILNK.................... 107
25 -12.3001o7i_A mol:protein length:119 SINGLE STRANDED DNA BINDING PROTEIN  ali model follow..  16  13....................................ESVNVTVRVLEASEVRTISEAIVGDETGRVKLTLW-------GKHAGSIKEGQVVKIEAWTTAFKGQVQLNAGSKTKIAEASE................. 98
26 -12.2005gro_A mol:protein length:115 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  15  21....................................KIVKVAGWCNTYRDHGGVVFIDLRDKSGLVQLV--CDPSSKAYEKALEVRSEFVLVAKGKVRL-TGKIEIVLEELIIENK.................... 108
27 -12.1002mna_A mol:protein length:117 Single-stranded DNA binding protein (SSB)  ali model follow..  16  13....................................ESVNVTVRVLEASEVRTISEAIVGDETGRVKLTLW-------GKHAGSIKEGQVVKIEAWTTAFKGQVQLNAGSKTKIAEASE................. 98
28 -12.1001wjj_A mol:protein length:145 hypothetical protein F20O9.120  ali model follow..  10  6SGSTVKRKPVFVKVEQLKPGT---------------TGHTLTVKVIEANQPSRIVECLIGDETGCILFTAR-------NDQVDLMKPGATVILRSRIDMFKGTMRLGVDKWGRIEATGAASFTVKEDNNLS..... 134
29 -12.0002oq0_A mol:protein length:206 Gamma-interferon-inducible protein Ifi-16  ali model follow..  11  129......................................VYGVFMLHKKTVNQKTTIYEIQDDRGKMDVVGTGQCHNIP------CEEGDKLQLFCRLRKKNQMSKLISSFIQIKKKTN.................. 206
30 -11.9002k75_A mol:protein length:106 uncharacterized protein Ta0387  ali model follow..  14  14....................................PYVSVIGKITGIHKKEYEYQGYIEDDTARIRISSFGKQ----------LQDSDVVRIDARVAQFNGYLSLSVGDSSRIESVNV................. 95
31 -11.8004owt_B mol:protein length:211 SOSS complex subunit B1  ali model follow..  18  5...........TFVKDIKPG---------------LKNLNLIFIVLETGRVTKTRTCKVADKTGSINISVW-------DDVGNLIQPGDIIRLTGYASVFKGCLTLYTGRGGDLQKIGE................. 97
32 -11.8004gn3_B mol:protein length:113 OBody AM1L10  ali model follow..  10  23....................................TEVVVAGWVASLGDYGRVKIVKVSDREGGAAVSV--KTPDHLFKVFAELSREDVVVIKGIVEASKAAAEIFPSEIWILNKAK.................. 113
33 -11.7003stb_C mol:protein length:148 RNA-editing complex protein MP42  ali model follow..  14  11..HGQETILPQAPQYHLDVAPNAPEEGEVAAHWRCVNHCVMLGVVQNIQEGDKVLQFTLDPDKDFHTVRVF--DSDYSSRVKEQLRDGEWFLVTGRLR------------MVPQYDGSMRKYYHYPVIQV...... 138
34 -11.4002k50_A mol:protein length:115 Replication factor A related protein  ali model follow..  15  17....................................AETPVTGRVMKISREGKLANVIIADDTGELRAVFW----TENIKLLKKFREGDVIRIKD--GGFGGRKEAHLMPRSTVEVLDPL................ 108
35 -11.3001x54_A mol:protein length:434 Asparaginyl-tRNA synthetase  ali model follow..  11  2........IEKVYCQEVKPELDG-------------KKVRLAGWVYTNMRVGKKIFLWIRDSTGIVQAVVAKNVGEETFEKAKKLGRESSVIVEGIVERAPGGAEVHVEKLEVIQAVSE................. 103
36 -11.2003m4p_A mol:protein length:456 Asparaginyl-tRNA synthetase, putative  ali model follow..  10  7.TEATTTPVETPIVCNIRDAAGLEGKL-----------VTFKGWAYHIRKARKTLIFELRDGSGYCQCVI-FGKELCEPEKVKLLTRECSLEITGRLNAYAGKNEMQVTEWKVIGE.................... 121
37 -10.9001wyd_A mol:protein length:429 hypothetical aspartyl-tRNA synthetase  ali model follow..  13  17....................................KEVIWAGWVHLLRDLGGKKFIILRDKTGLGQVV--VDKNSSAFGISQELTQESVIQVRGIVKADKRAPELHAEEITLLSKAKA................. 100
38 -10.7002xti_A mol:protein length:437 ASPARAGINYL-TRNA SYNTHETASE, CYTOPLASMIC, PUTATIVE  ali model follow..  14  3...........VKIRDLVKHRN--------------ERVCIKGWIHRMRRQGKSLMFILRDGTGFLQVL--LMDKLCQTYDALTVNTECTVEIYGAIKEVPEGKELIADFWKIIGNAPP................. 101
39 -10.7001b8a_A mol:protein length:438 PROTEIN (ASPARTYL-TRNA SYNTHETASE)  ali model follow..  17....................................QKVKVAGWVWEVKDLGGIKFLWIRDRDGIVQITAPKKKDPELFKLIPKLRSEDVVAVEGVVNFTPKAKEILPEKIVVLNRAET................. 103
40 -10.4004joi_D mol:protein length:122 CST complex subunit TEN1  ali model follow..  13  9...........YLPWEVSAGQVPDG-----------STLRTFGRLCLYDMIQSRVTLMAQHGSDQHQVLV-----CTKLVEPFHAQVGSLYIVLGELQHQQDRGVVKARVLTCVEGMNLPLLE--QAIREQRLYKQ 116
41 -10.3004j15_A mol:protein length:521 Aspartate--tRNA ligase, cytoplasmic  ali model follow..  72....................................EVVWVRARVHTSRAKGKQCFLVLRQQQFNVQALVAVGDHASKQKFAANINKESIVDVEGVVRKVNQDVELHVQKIYVISLAEP................. 164
42 -9.9903f1z_A mol:protein length:133 putative nucleic acid-binding lipoprotein  ali model follow..  11  17.GDDAVASMQTYSVAQFLQLNPAKASSDYL------KWVKVRGVIVDIRRKSGYFIVTMRDEQNKTDKRLTFNFGSHNSADVEALSNGSVATIVGQVHQVQDSTIPTLQNPKVVK..................... 133
43 -9.9501asy_A mol:protein length:490 ASPARTYL-tRNA SYNTHETASE  ali model follow..  16  40....................................KEVLFRARVHNTRQQGATLAFTLRQQASLIQGLVKANKEGTISKNAGSLNLESIVLVRGIVKKVDQNLEIHITKIYTISETPE................. 135
44 -9.8301n9w_A mol:protein length:422 aspartyl-tRNA synthetase 2  ali model follow..  14....................................QEVELLGFLHWRRDLGRIQFLLLRDRSGVVQVVT---------GGLKLPLPESALRVRGLVAKAPGGLEVQAKEVEVLSPALE................. 90
45 -9.5105w25_A mol:protein length:616 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  14  33....................................QQVTLAGWVARRRDHGGVIFIDLRDASGIAQVVFRDPQDTEVLAQAHRLRAEFCVSVAGVVEIATGEIEVNATSLTVLGECAPLPFQLDEPAGEELRLKY 142
46 -9.4803f2b_A mol:protein length:1041 DNA-directed DNA polymerase III alpha chain  ali model follow..  13  18....................................RRVVVQGYVFDAEVSELKLTMKITDYTNSILVKMFSRD-KEDAELMSGVKKGMWVKVRGSVQTFVRDLVIIANDLNEIAANERQDTAPEGEKRVELHL.. 121
47 -9.2906d6v_F mol:protein length:121 Telomerase holoenzyme TEB heterotrimer Teb3 subunit  ali model follow..  13  24....................................KKVTVVGNVCNEDQNDSLVIEFGPTGL--------QHVVIDNYRRVDLNNTTKFVEIRGVVLNQNIVSCEELTEFEQKDPFDFDTYSKL........... 105
48 -9.2602pi2_E mol:protein length:142 Replication protein A 14 kDa subunit  ali model follow..  12  34....................................KPVCFVGRLEKIHPTGKMFILSDGEG-KNGTIEL---------MEPLDEEISGIVEVVGRVTAKATILCTSYVQFKEDSH.................... 103
49 -9.2504dk3_C mol:protein length:105 RNA-editing complex protein MP81  ali model follow..  14  3...................................GSNALMIGRIADVQHAMTVTQYVLASGEKEFIVIRCMGDNFPASLLKDQVKLGSRVLVQGTLR------------MNRHVDDVSKRLHAYPFIQV...... 94
50 -9.1403k81_C mol:protein length:164 MP18 RNA editing complex protein  ali model follow..  11  4.................LTSRRLLLQQTFMRCCKSVNSVTLVGVVHDIQSGDAVTQFTLVVEKDHHTIRCF--GELFSAEVKQKVKEGNVVCVNGRLR------------LSPQLEPSCNKHFYFPYIQV...... 120

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 8 0 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Zhao Y, Hong DH, Pawlyk B, Yue G, Adamian M, Grynberg M, Godzik A., Li T. The retinitis pigmentosa GTPase regulator (RPGR)- interacting protein: subserving RPGR function and participating in disk morphogenesis. Proc Natl Acad Sci U S A. 2003 Apr 1;100(7):3965-70. Epub 2003 Mar 21.