current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 4h2w_A mol:protein length:346 Amino acid--[acyl-carrier-protein] ligase 1, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340
# Score Template Links and tools%idFirst MGSSSSGLVPRGSHMNIAVLPNSPDTAPQIADPLDHLADKLFHSMGSDGVYARTALYESIVERLAALITSHREAGTEALRFPPVMSRAQLEKSGYLKSFPNLLGCVCGLHGTEREINAAVSRFDAGGDWTTSLSPADLVLSPAACYPVYPIAASRGPLPKGGLRFDVAADCFRREPSKHLDRLQSFRMREYVCIGTPDDVSDFRERWMVRAQAIARDLGLTFRVDYASDPFFGRAGKMLANNQRDQQLKFELLIPLRSEEQPTACMSFNYHREHFGTTWGIQDANGEPAHTGCVAFGMDRLAVAMFHTHGTDLSAWPAKVRDILGLQPHVAAGAHGEGWRLast
1 -113.0004h2w_A mol:protein length:346 Amino acid--[acyl-carrier-protein] ligase 1  ali model  100  1MGSSSSGLVPRGSHMNIAVLPNSPDTAPQIADPLDHLADKLFHSMGSDGVYARTALYESIVERLAALITSHREAGTEALRFPPVMSRAQLEKSGYLKSFPNLLGCVCGLHGTEREINAAVSRFDAGGDWTTSLSPADLVLSPAACYPVYPIAASRGPLPKGGLRFDVAADCFRREPSKHLDRLQSFRMREYVCIGTPDDVSDFRERWMVRAQAIARDLGLTFRVDYASDPFFGRAGKMLANNQRDQQLKFELLIPLRSEEQPTACMSFNYHREHFGTTWGIQDANGEPAHTGCVAFGMDRLAVAMFHTHGTDLSAWPAKVRDILGLQPHVAAGAHGEGWR 340
2 -110.0003mey_A mol:protein length:346 Bll0957 protein  ali model follow..  97  1MGSSSSGLVPRGSHMNIAVLPNSPDTAPQIADPLDHLADKLFHSMGSDGVYARTALYESIVERLAALITSHREAGTEALRFPPVMSRAQLEKSGYLKSFPNLLGCVCGLHGTEREINAAVSRFDAGGDWTTSLSPADLVLSPAACYPVYPIAASRGPLPKGGLRFDVAADCFRREPSKHLDRLQSFRMREYVCIGTPDDVSDFRERWMVRAQAIARDLGLTFRVDYASDPFFGRVGQMKAVSQKQQQLKFELLIPLRSEEQPTACMSFNYHREHFGTTWGIQDANGEPAHTGCVAFGMDRLAVAMFHTHGTDLSAWPAKVRDILGLQPHVAAGAHGEGWR 340
3 -76.7003w3s_A mol:protein length:527 Type-2 serine--tRNA ligase  ali model follow..  20  155VIRLVAWAVEERSELVERV-ESGPRRIRFRGDVTEEARRRGWVEFPGRGQWIYTPPMAALFEVLRDFLLETRKLGFEPALFPKLIPLETMFRMRYLHGLPDGMYYVCPPKRDPELFDDFKRELYTLGSLKEKLRDPGYVLAPAQCEPFYELLRDEVVDPER-KLYDCSGWTYRWEGGKGLERVNEFQRIEHVWIAEPEEAYRIRRELLEATKRVAEELELEWKVVVSDDPFYLEGRLLDRDIELPDVPSYEFEVYLPFKGERISVGSFNVHGEHFVDGFNVKEKSGRTLFTGCAGLGVTRWVVGLLAQHGFYPYEWPEPILERID............... 510
4 -75.6002cim_A mol:protein length:522 SERYL-TRNA SYNTHETASE  ali model follow..  16  166LEEKIEAAQYGAKAEHWNLLQREPMEHPFKEDPTQAMMKEGWLRGSSRGQWIHGPQSARIFRTFEKIVLELEPLGYREMIFPKLVTWEVWMKSGHAKGVPEIYYVCPPQTRDPDYWEEVADYYKVTHEIKEKIAEPIGGMCYAQCPPFWMYVAGETLPNEE-KVFDRSGTSHRYESGHGIERVDEFHRIEIVWIGTKEEVLKCAEELHDRYMHIFNDILDIEWRKARVTPWFMAQEGLLGLAEENTVGTTDYEACLPPDGEWLEFQNVSINGDKYPKGFNVKLQSGDELWSGCSGVGLERWAAVFLAQKGLDPANWPEEFRNRVGEMPK........... 511
5 -46.9002dq3_A mol:protein length:425 Seryl-tRNA synthetase  ali model follow..  16  105IPNLPHPSVPVGEDEKDNVEDFEPKPHWEIGERLGILDFKRGAKLSGSRFTVIAGWGARLERALINFLDLHTKKGYKEICPPHLVKPEILIGTGQLPKFEEDLYKC---------------------------ERDNLYLIPTAEVPLTNLYREEILKEENPIYLTAYTPCYRREDIRGIIRQHQFDKVELVKIVHPDTSYDELEKLVKDAEEVLQLLGLPYRVVELC----------TGDLGFSAAKTYDIEVWFPSQNKYREISSCSNCEDFQARRMNTRFKDSRFVHTNGSGLAVGRTLAAILENYQDGSVVVPEVLRDYVGTDVIRPE........ 425
6 -45.9003qne_A mol:protein length:485 Seryl-tRNA synthetase, cytoplasmic  ali model follow..  13  108VGNIVHESVVDSQDEENNELVRAKLSHHEVLLRLDGYDPERGVRIVGHRGYFLRNYGVFLNQALINYGLSLSSKGYVPLQAPVMMNKEVMAKTAQLSQFDEELYKVID-------------------------GEDEKYLIATSEQPISAYHAGEWFEEQLPVRYAGYSSCFRREAGWGIFRVHAFEKIEQFVLTEPEKSWEEFDRMIGCSEEFYQSLGLPYRVVGIV----------SGELNNAAAKKYDLEAWFPFQQEYKELVSCSNCTDYQSRNLEIRCQEKKYVHCNSTLSATERTICCILENYKEDGLVIPEVLRKYIPGEPEFIP........ 443
7 -45.6003vbb_A mol:protein length:522 Seryl-tRNA synthetase, cytoplasmic  ali model follow..  12  135IGNLLHPSVPISNDEDVDNKVEKKYSHVDLVVMVDGFEGEKGAVVAGSRGYFLKGVLVFLEQALIQYLRTLGSRGYIPIYTPFFMRKEVMQEVAQLSQFDEELYKV----------------IGKGSEKSDDNSYDEKYLIATSEQPIAALHRDEWLRPEDPIKYAGLSTCFRQEDTRGIFRVHQFEKIEQFVYSSPNKSWEMFEEMITTAEEFYQSLGIPYHIVNIV----------SGSLNHAASKKLDLEAWFPGSGAFRELVSCSNCTDYQARRLRIRYGQTEFVHMNATMCATTRTICAILENYQTKGITVPEKLKEFMPPGLQE.......... 466
8 -45.6001ser_A mol:protein length:421 PROTEIN (SERYL-TRNA SYNTHETASE (E.C.6.1.1.11))  ali model follow..  12  101VPLPPWPGAPVGGEEANREIKRFPPLDHVALMEKNGWWEPRISQVSGSRSYALKGDLALYELALLRFMDFMARRGFLPMTLPSYAREKAFLGTGHFPAYRDQVWAI---------------------------AETDLYLTGTAEVVLNALHSGEILPYEAPLRYAGYAPAFRSEDVRGLMRVHQFHKVEQYVLTEAEASDRAFQELLENAEEILRLLELPYRLVEVA----------TGDMGPGKWRQVDIEVYLPSEGRYRETHSCSALLDWQARRANLRYRDPRYAYTNNTALATPRILAMLLENHQDGRVRVPQALIPYMGKEVLEPCG....... 421
9 -45.3003err_A mol:protein length:536 fusion protein of microtubule binding domain from mouse cytoplasmic dynein and seryl-tRNA synthetase from Thermus thermophilus  ali model follow..  13  210VPLPPWPGAPVGGEEANREIKRVGGPPEFSFPPLDHWWEPRISQVSGSRSYALKGDLALYELALLRFAMDMARRGFLPMTLPSYAREKAFLGTGHFPAYRDQVWAI---------------------------AETDLYLTGTAEVVLNALHSGEILPYEAPLRYAGYAPAFRSEDVRGLMRVHQFHKVEQYVLTEASLSDRAFQELLENAEEILRLLELPYRLVEVA----------TGDMGPGKWRQVDIEVYLPSEGRYRETHSCSALLDWQARRANLRYRDPRYAYTNNTALATPRILAMLLENHQDGRVRVPQALIPYMGKEVLEPGA....... 530
10 -45.1002dq0_A mol:protein length:455 Seryl-tRNA synthetase  ali model follow..  15  106LPNITHPSVPVGKDENDNVPEWKPKLHVDLLEILGGADFARAAKVSGSRFYYLLNEIVILDLALIRFLDRLIEKGFTPVIPPYMVRRFVEEGSTSFEDFEDVIYKV---------------------------EDEDLYLIPTAEHPLAGMHANEILDGKDPLLYVGVSPCFRKEDTKGIFRVHQFHKVEQFVYSRPEESWEWHEKIIRNAEELFQELEIPYRVVNIC----------TGDLGYVAAKKYDIEAWMPGQGKFREVVSASNCTDWQARRLNIRFRDRRYVHTNSTAIATSRAIVAILENHQDGTVRIPKVLWKYTGFKEIVPVEKKER... 451
11 -44.3001wle_A mol:protein length:501 Seryl-tRNA synthetase  ali model follow..  15  147LPNQTHPDVPVGDESQARVLHVQPRGHLEIAEKLDIIRQKRLSHVSGHRSYYLRGAGALLQHGLVNFLNKLIHRGFTPMTVPDLLRGVVFEGCGMTPNAKPSQIYNI-----------------------DPSRFEDLNLAGTAEVGLAGYFMDHSVAFRDPIRMVCSSTCYRAEEPWGLYRVHHFTKVEMFGVTGPEQSSELLEEFLSLQMEILTELGLHFRVLDMP----------TQELGLPAYRKFDIEAWMPGRGRFGEVTSASNCTDFQSRRLHIMFQTEQFAHTNATGCAVPRLLIALLESYQDGSVLVPPALQPYLGTDRITTPTHVP.... 474
12 -43.3003lsq_A mol:protein length:484 Seryl-tRNA synthetase  ali model follow..  12  141VGNILHESVPIAQDEETGNTRAKLNHVSIMERLGMMDTSKAVTSMAGGRSYVLKGGLVQLQVALVSYLDFLVKRGYTPFYPPFFLNRDVMGEVAQLSQFDEELYQVSG-------------------------DGDKKYLIATSEMPIAAYHRGRWFTELKPLKYAGMSTCFRKEDTLGIFRVHQFDKIEQFVVCSQEESWRHLEDMITTSEEFNKSLGLPYRVVNIC----------SGALNNAAAKKYDLEAWFPASGAFRELVSCSNCTDYQSQSVNCRYGPNEYCHMNGTLCAITRTMCCICENYQTEGVVIPDVLRPYMMGIEMIRFENNA.... 473
13 -42.3006blj_A mol:protein length:485 Serine-tRNA ligase  ali model follow..  14  144IGNIVHETVVVSDNEDNNGIGYKCLKHIDIMRKLGGLATEEGTQVGGGRGYFLLGDLVRMNLALQNYIDFLAKKGYMPIYTPFFMTKEQMKKVAQLSQFDEELYTVTG-------------------------EGEDKYLIATSEQPIAAFHLEKRFDESEPIKYCGMSTCFRKEDTLGIFRVHQFEKIEQFVVTSPKDSWEMFDEMIGNSEAFYQSLGIPYRVVNIV----------SGALNNAAAKKFDLEAWFPGGNEYRELVSCSNCTDYQTRRLEVKYGEVEFCHMNSTLTATSRTLCCIVENYQTEGVNVPEVLQPYMGGTKFIKFKN...... 479
14 -32.7002i4l_A mol:protein length:458 Proline-tRNA ligase  ali model follow..  14  2GSSSSGLVPRGSHMRLSRFFLPILKENPKEAEIVSLMLRAGMLRQEAAGIYAWLPLGHRVLKKIEQIVREQNRAGAIELLMPTLQLADLWRESGRYDAYGPEMLRIADRHKR------------------------ELLYGPTNEEMITEIFRAYIKSKSLPLNLYHIQWKFRDEPRFGVMRGREFLMKDAYSFDVDEAARKSYNKMFVAYLRTFARMGLKAIPMRASHEFIVLAETGESGVYIDRDVLNLPVPDENVNTRGIEVGQIFYFGTKYSDSMKANVTGPDPIHGGSYGVGVSRLLGAIIEACHDDNGIWPEAVAPF................. 360
15 -30.4005xil_A mol:protein length:512 Putative prolyl-tRNA synthetase  ali model follow..  14  1................GAMGIAAKREENFSAWYIDVITKAEMIYYDVSGCYIIRPWAYYVWKCVQRFLGGIEKLGVEDCYFPMFVSRSCLREKDHIEGFAPEVAWVTRAGDTELE--------------------QPVAVRPTSETVMYPYYAKWIRSRDLPVRLNMWNNVIRWEHPTPFIRTREFLWQEHCAWAKAEECAKEVLEILECYASVYEQLLAVPVVR---------GRKTEKEKFAGGDYTTTVETFIEAVGRGCQGATSHNLGQNFGKMFDIRFQDPETLIPWQNSWGLTRVIGVMIMVHGDNRGVMPPRVAST................. 291
16 -30.2004ncx_A mol:protein length:506 Proline--tRNA ligase  ali model follow..  12  3................SNILGITSKKIENFSDWYTQVIVKSELYYDISGCYILRPAAYYIWECVQAFFNEIKKLNVENSYFPLFVTKNKLKEKNHIEGFSPEVAWVTKYGDSNLP--------------------EEIAIRPTSETIMYSVFPKWIRSRDLPLKLNQWNTVVRWEQPTPFIRTREFLWQEHTAHKNEEEAVKLVFDILDLYRRWYEEYLAVPIIKGI---------KSEGEKFGGANFTSTAEAFISENGRAIQAATSHYLGTNFAKMFKIEFEDENYVHQTSWGCT-TRSIGIMIMTHGDDKGVLPPNVSKY................. 292
17 -29.9004hvc_A mol:protein length:519 Bifunctional glutamate/proline--tRNA ligase  ali model follow..  13  6.........GQGPKKQTRLGLEAKKEENLADWYSQVITKSEMIEHDISGCYILRPWAYAIWEAIKDFFDEIKKLGVENCYFPMFVSQSALEKEKHVADFAPEVAWVTRSGKTELA--------------------EPIAIRPTSETVMYPAYAKWVQSRDLPIKLNQWCNVVRWEHPQPFLRTREFLWQEHSAFATMEEAAEEVLQILDLYAQVYEELLAIPVVKGR---------KTEKEKFAGGDYTTTIEAFISASGRAIQGGTSHHLGQNFSKMFEIVFEDGEKQFAYQNSWGLTRTIGVMTMVHGDNMGVLPPRVACV................. 303
18 -29.7004k86_A mol:protein length:535 Proline--tRNA ligase  ali model follow..  15  1MGSSSSGLVPRGPKKQTRLGLEAKKEENLADWYSQVITKSEMIEHDISGCYILRPWAYAIWEAIKDFFDEIKKLGVENCYFPMFVSQSALEKEKTHVADFAPEVAWVTRSGKTEL-------------------AEPIAIRPTSETVMYPAYAKWVQSRDLPIKLNQWCNVVRWEHPQPFLRTREFLWQEHSAFATMEEAAEEVLQILDLYAQVYEELLAIPVVKGR---------KTEKEKFAGGDYTTTIEAFISASGRAIQGGTSHHLGQNFSKMFEIVFEDGEKQFAYQNSWGLTRTIGVMTMVHGDNMGVLPPRVACV................. 319
19 -29.4005xip_A mol:protein length:498 Prolyl-tRNA synthetase, putative  ali model follow..  13  1................GAMGVTAKKSTNFADWYTQVIVRGELVEYYISGCYIIRPWAYRIWEAVQKFFDDIKRLGVENCYFPMFVSQAKLKEKDHVEGFKPEVAWVTHYGDSELP--------------------EKVAIRPTSETIMYPAYAKWIRSRDLPLKLNQWNNVVRWEQPTPFLRTREFLWQEHTAHATEEEAYTLVLEILELYRQWYEDYLAVPVIKGE---------KSENEKFAGGKKTTTIEGIIPDTGRGIQAATSHLLGQNFSRMFSIEFEDEKLVHQTSWGCTT-RSLGVMIMTHGDDKGVLPPRVVAV................. 289
20 -29.2005f9y_A mol:protein length:511 Aminoacyl-tRNA synthetase  ali model follow..  15  2...........ASKENESLLGITADKITSFADWYSQVIVKSEMYYDISGCYILRPWSYFIWETIQSVFDQIKQHDVQNAYFPIFVTQKKLTEKDHVEGFSPEVAWVTKSGKSDLA--------------------EPIAIRPTSETIMYPYFAKWIRSRDLPLKINQWTSIVRWEHPTPFIRTREFLWQEHTAHSTRKEALEMVDIILNEYASIYEDLLATPVVKGT---------KSENEKFPGGDITKSIEGFIPEIGRAVQAATSHLLGQNFSKMFGVEFEDEKYAHQTSWGLT-TRAIGVMIMTHGDNKGVLPPKVAPV................. 296
21 -29.1005xif_A mol:protein length:500 Prolyl-tRNA synthetase (ProRS)  ali model follow..  12  2..................AMVTAKKDENFSEWYTQAIVRSEMIYYDISGCYIMRPWAFHIWEKVQRFFDEIKKMGVENSYFPMFVSRHKLKEKDHVEGFSPEVAWVTHYGDSPLP--------------------EKIAIRPTSETIMYPAYAKWIRSRDLPLKLNQWCSVVRWEQPTPFLRTREFLWQEHTAHATEEEAWELVLDILELYRRWYEECLAVPVIKGE---------KSEGEKFAGGKKTTTVEAFIPENGRGIQAATSHLLGTNFAKMFEIEFEDEELVHQTSWGCTT-RSLGVMIMTHGDDKGVIPPRVASV................. 288
22 -29.0002j3l_A mol:protein length:572 PROLYL-TRNA SYNTHETASE  ali model follow..  13  2..........KQSKMLIPTLREVPNDAEVLSHQI--LLRAGYIRQVAAGIYSYLPLANRVLEKLKTIMEEFEKIDAVEMLMPALLPAELWKESGRYETYGPNLYRLKD-------------------------NDRDYILGPTHEETFTELIRDEINSKRLPLNLYQIQTKYRDESRSGLLRGREFIMKDGYSFADEASLDQSYRDYEKAYSRIFERCGLEFRAIIGSKEFMAISEIGEDTICYSTESDYAANLEMATSTKGIEIGHIFKLGTRYSDAMGATVLDENSVIMGCYGIGVSRLLSAIVEQNADERGNWPTGIAPF................. 471
23 -28.9001nj1_A mol:protein length:501 Proline-tRNA Synthetase  ali model follow..  13  13.....SHMQKPIKKDPNRYHGEKMTEFSEWFHNILEEAEIIDQRYPVKGMHVWMPHGFMIRKNTLKILRRILDRDHEEVLFPLLVPEDELKEAIHVKGFEDEVYWVTHGGLSKLQ--------------------RKLALRPTSETVMYPMFALWVRSTDLPMRFYQVVNTFRYETKPLIRVREITTFKEHTIHATASEAEEQVERAVEIYKEFFNSLGIPYLITRRPPW------------KFPGSEYTVAFDTLMPDGKTLQIGTVHNLGQTFARTFEIKFETPEYVHQTCYGL-SDRVIASVIAIHGDESGCLPPDVAAH................. 309
24 -28.7001h4q_A mol:protein length:477 PROLYL-TRNA SYNTHETASE  ali model follow..  15  2................AKEKGLTPQSQDFSEWYLEVIQKAELAYGPVRGTIVVRPYGYAIWENIQQVLDRFKETGHQNAYFPLFIPMSFLKEAEHVEGFSPELAVVTHAGGEELE--------------------EPLAVRPTSETVIGYMWSKWIRSRDLPQLLNQWGNVVRWEMRRPFLRTSEFLWQEHTAHATREEAEEEVRRMLSIYARLAREYAAIPVIE-------GLKTEKEKFAGAVYTTTIEALMK---DGKALQAGTSHYLGENFARAFDIKFQDRDYVHTTSWGL-SWRFIGAIIMTHGDDRGVLPPRLAPI................. 288
25 -28.5003ial_A mol:protein length:518 Prolyl-tRNA synthetase  ali model follow..  15  2..........AMGGDVTFSLTKTRDTFADWFDAIMDAAELVDRRYPVKGCVVFRPYGFFMENAIMRLCEEYAKVGISQILFPTVIPESFLKESDHIKGFEAECFWVEKGGLQPLE--------------------ERLALRPTSETAIYSMFSKWVRSKDLPLKIHQTCTIFRHENTKPLIRVREIHWNEHCCHATAEDAVSQLSDYWKVIDTIFSDELCFKGQK----------LRRVCWDRFPGADYSEVSDVVMPCGRVLQTAGIHNLGQRFSSTFDILYANKAHPYLTCAGIS-TRVLACALSIHGDSGGVLPPLIAPI................. 294
26 -27.8005ucm_A mol:protein length:579 Proline--tRNA ligase  ali model follow..  14  1.......MAMRTSQYLLSTLKETPADAVVISHQL--LLRAGMIRRLASGLYTWLPMGLRVLRKVETIVREMNAAGALEVLMPAVQPAELWQESGRWEQYGPELLRLKD-------------------------HEREFCVGPTHEEVITDLARNELNSKQLPINFYQIQTKFRDEPRFGLMRGREFIMKDAYSFLSQDSLQQTYDGMYQAYSKIFSRLGLDFRPVQASHEFHVLANSGEDDIVFSDSSDYAANIEKAEAKRGIEVGHIFQLGTKYSEAMKLSVLSEQNLIMGCYGIGVSRVVAAAIEQNHDERGLWPSALAPF................. 474
27 -26.8001nj8_A mol:protein length:459 Proline-tRNA Synthetase  ali model follow..  13  2.....................SHMLEFSEWYSDILEKAEIYDVRYPIKGCGVYLPYGFKIRRYTFEIINLLDESGHDEALFPMLIPEDLLAKEAHIKGFEDEVYWVTHGGKTQLD--------------------VKLALRPTSETPIYYMMKLWVKVTDLPIKIYQIVNTFRYEHTRPLIRLREIMTFKHTAHSTKEEAENQVKEAISIYKKFFDTLGIPYLISKRPEWDKFPGAEYTMAFDTIFP-----------DGRTMQIATVHNLGQNFSKTFEIIFETPTYAYQTCYGISD-RVIASIIAIHGDEKGILPPIVAPI................. 283
28 -25.2004q6g_A mol:protein length:267 Pyrrolysine--tRNA ligase  ali model follow..  13  3LTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEER---ENYLGKLEREITRFFVDR---GFLEIKSPILIPLEYIERMG--------------------------IDNDTELSKQIFRVDKNFCLRPMVAPNIFNYARKLDRALPDPIKIFEIGPCYRKESD-GKEHLEEFTMLNFFQMGSGCTR----ENLESIITDFLNHLGIDFKIVGDSCSVYGDTLDVM--------------------HGDLELSSAVVGPIPLDREWGIDKP--------GAGFGLERLLKVKHD----------KNIKRAARSE............. 257
29 -23.6005k1p_A mol:protein length:274 Pyrrolysine--tRNA ligase  ali model follow..  15  1....MPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFVDRGFLEIKSPILIPLEYIERMG--------------------------IDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPDPIKIFEIGPCYRKE-SDGKEHLEEFTMLAFAQMGSGCTREN----LESIITDFLNHLGIDFKIVGDSCMVYGDTLDVM--------------------HGDLELSSAVVGPIPLDREWGIDKP--------GAGFGLERLLKVKHD----------KNIKRAARSE............. 258
30 -23.4004tqd_A mol:protein length:291 Pyrrolysine--tRNA ligase  ali model follow..  16  14HMASAPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFVDRGFLEIKSPILIPLEYIERMG--------------------------IDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPDPIKIFEIGPCYRKE-SDGKEHLEEFTMLSFIQMGSGCTR----ENLESIITDFLNHLGIDFKIVGDSCMVYGD--------------------TLDVMHGDLELSSAVVGPIPLDREWGIDKP--------GAGFGLERLLKV.................................... 261
31 -23.3004p3n_A mol:protein length:415 Threonine--tRNA ligase, cytoplasmic  ali model follow..  12  1..................MGSSSSGDHRKIGRDQELYF----FHELSPGSCFFLPKGAYIYNALIEFIRSERKRGFQEVVTPNIFNSRLWMTSGHWQHYSENMFSF-------------------------EVEKELFALKPMNCPGHCLMFDHRPRSRELPLRLADFGVLHRNELSTGLTRVRRFQQDDAHIFCAMEQIEDEIKGCLDFLRTVYSVFGFSFKLNLSTRPFLGDIEVWDQAEKQLENSKIDIQIK-DAIGRYHQCATIQL---QLPIRFNLTYVSHDIVHRAILG-SVERMIAILTENYGGKWPFWLSPRQVMV................ 309
32 -23.2004hwt_A mol:protein length:413 Threonine--tRNA ligase, cytoplasmic  ali model follow..  13  17..........................................FHELSPGSCFFLPKGAYIYNALIEFIRSYRKRGFQEVVTPNIFNSRLWMTSGHWQHYSENMFSF-------------------------EVEKELFALKPMNCPGHCLMFDHRPRSRELPLRLADFGVLHRNELSTGLTRVRRFQQDDAHIFCAMEQIEDEIKGCLDFLRTVYSVFGFSFKLNLSTRPFLGDIEVWDQAEKQLENSKIDIQIK-DAIGRYHQCATIQL---QLPIRFNLTYVSHDIVHRAILG-SVERMIAILTENYGGKWPFWPRQVMTCDEYAQKVRQQFHDAKFM 329
33 -23.1002e3c_A mol:protein length:291 Pyrrolysyl-tRNA synthetase  ali model follow..  16  14HMASAPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFVDRGFLEIKSPILIPLEYIERMG--------------------------IDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPDPIKIFEIGPCYRKE-SDGKEHLEEFTMLNFCQMGSGCTR----ENLESIITDFLNHLGIDFKIVGDSCMVYGDT--------------------LDVMHGDLELSSAVVGPIPLDREWGIDKP------WIGAGFGLERLLKVKHDFKNIKR........................... 270
34 -23.1003ugq_A mol:protein length:460 Threonyl-tRNA synthetase, mitochondrial  ali model follow..  17  1MGSSSSGLVPRGSHMASATKNASSATPATMTSMVSQRQDLFMTDPLSPGSMFFLPNGAKIFNKLIEFMKLQFKFGFNEVVTPLIYKKTLWEKSGHWENYADDMFKVETTDEE----------------------KEEYGLKPMNCPGHCLIFGKKDRSNELPLRFSDFSPLHRNEASSGLTRLRKFHQDDGHIFCTPSQVKSEIFNSLKLIDIVYNKIFPFINFSTRPDHFIGDLKVWNHAEQVLKEIKLDIMVT-DHLRKTHQVATIQL---QLPERFDLKFKDQDMIHRATFG-SIERFMALLIDSNEGRWPFWPYQAV................... 343
35 -22.4004cs2_A mol:protein length:274 PYRROLYSINE--TRNA LIGASE  ali model follow..  15  1....MPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFVDRGFLEIKSPILIPLEYIERMG--------------------------IDNDTELSKQIFRVDKNFCLRPMLAPNLANYLRKLDRALPDPIKIFEIGPCYRKE-SDGKEHLEEFTMLNFCQMGSGCTREN----LESIITDFLNHLGIDFKIVGDSCMVFGDTLDVM--------------------HGDLELSSAVVGPIPLDREWGIDKP---------AGFGLERLLKV.................................... 244
36 -22.3003a31_A mol:protein length:471 Probable threonyl-tRNA synthetase 1  ali model follow..  12  17.........................DITVKPDSRVPVFNREFATFTGAGVPLFSLGGGPIRYALAEVLAKFARRGYYVVETPIIASTELFKVSGHIEFYRNNMYLF-------------------------DIEGHEFAVKPMNCPYHILLFLNEVAKLPLPFKVFEFGRVHRYEPSYGLLRVRGFTQDDAHIIVPGGRVIDVVYDVFEEMKLVLERLFKTFKVRLSMKEFMGSKEEWEGAEEALREAKLDFIMMVEESSKEWQMGTIQF---NLPRRFRLYDVVREIIHRALLG-SIERFLGVYLEHRRGRMPFTLAPIQFAV................ 343
37 -22.3002zni_A mol:protein length:308 Pyrrolysyl-tRNA synthetase  ali model follow..  15  78...................................................LRTVKHRPALLELEEKLAKLHQQGFVQVVTPTIITKSALAKMTIGEDHPLFSQV--------------------------FWLDGKKCLRPMLAPNLYTLWRELERLWDKPIRIFEIGTCYRKESQ-GAQHLNEFTMLNLTELG--TPLEERHQRLEDMARWVLEAAGIR-------------------EFELVTESSVVYGDTVDVMKGDLELASGAMGPHFLDEKWEIFDP---------LGFGLERLLMIREGTQHVQSMARSLSYLDG................. 296
38 -22.0004hwo_A mol:protein length:411 Threonine--tRNA ligase  ali model follow..  13  17..........................................MQEEAPGMVFWHNDGWTIFRELEVFVRSLKEYQYQEVKGPFMMDRVLWEKTGHWDNYKDAMFTT-------------------------SSENREYCIKPMNCPGHVQIFNQGLKSRDLPLRMAEFGSCHRNEPSHGLMRVRGFTQDDAHIFCTEEQIRDEVNGCIRLVYDMYSTFGFVVKLSTRPEKRIGSDEMWDRAEADLAVAKIEFTLY-DCLDRAWQCGTVQL---SLPSRLSASYVGEDMIHRAILG-SMERFIGILTEEFAGFFPTWPVQVVSQSEYVNELTQKLSNAGIR 329
39 -21.5003qtc_A mol:protein length:290 Pyrrolysyl-tRNA synthetase  ali model follow..  17  14...SAPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFVDRGFLEIKSPILIPLEYIERMG--------------------------IDNDTELSKQIFRVDKNFCLRPMLTPNLYNYLRKLDRALPDPIKIFEIGPCYRKE-SDGKEHLEEFTMLVFWQMGSGCT----RENLESIITDFLNHLGIDFKIVGDSCMVFGDTLDVM--------------------HGDLELSSALVGPIPLDREWGIDKP---------AGFGLERLLKVK................................... 259
40 -21.4004bw9_A mol:protein length:291 PYRROLYSINE--TRNA LIGASE  ali model follow..  15  17....SAPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDL-IYAEERENYLGKLEREITRFVDRGFLEIKSPILIPLEYIERMG--------------------------IDNDTELSKQIFRVDKNFCLRPMLAPNLGNYLRKLDRALPDPIKIFEIGPCYRKE-SDGKEHLEEFTMLNFCQMGSGCTR----ENLESIITDFLNHLGIDFKIVGDSCMVFGDTLDVM--------------------HGDLELSSAVVGPRPLDREWGIDKP------WIGAGFGLERLLKVKHDFKNIK............................ 269
41 -21.2001nyq_A mol:protein length:645 threonyl-tRNA synthetase 1  ali model follow..  12  214LQRIYGTAFFDKKELKAHLQMLEERKERDHRKIGKELELFTNSQLVGAGLPLWLPNGATIRREIERYIVDKVSMGYDHVYTPVLANVDLYKTSGHWDHYQEDMFPPMQLDET-----------------------ESMVLRPMNCPHHMMIYANKPHSRELPIRIAELGTMHRYEASSGLQRVRGMTLNDSHIFVRPDQIKEEFKRVVNMIIDVYKDFGLSYRDPEDKEKYFDDDDMWNKAENMLKEAKLDVQVK-TAMGKEETLSTAQL---LLPERFDLTYIGQDVIHRGVVS-TMERFVAFLTEETKGAFPTWPKQVDLHYDYARQLQDELKSQGVR 575
42 -21.2001b76_A mol:protein length:442 Glycine--tRNA ligase  ali model follow..  13  2....................ASSLDELVALCKRRGFIFQSSEIYGGLQGVYDYGPLGVELKNNLKQAWWRYERDDMEGLDASVLTHRLVLHYSGHEATFADPM--VDNAKARYWTPPRYFNMMFQDLRGPRGGRGLLAYLRPETAQGIFVNFKNDATSRKLGFGIAQIGKAFRNEPRNFIFRVREFEQMEIEYFVRPGEDEYWHRYWVEERLKWWQEMGLS-------RENLVPYQQPPESSAHYAKATVDILYRFP---GSLELEGIAQRTDFDLGSHDPETGKWFVPYVIEPSAGVDRGVLALLAEAFTREELPNGEERIVLKLKPQLAPIKVA.... 339
43 -19.6001qf6_A mol:protein length:642 THREONYL-TRNA SYNTHETASE  ali model follow..  13  225...........DKKALNAYLQRLEEAAKRDHRKIGKQLDLYHMQEEAPGMVFWHNDGWTIFRELEVFVRSLKEYQYQEVKGPFMMDRVLWEKTGHWDNYKDAMFTTS-------------------------SENREYCIKPMNCPGHVQIFNQGLKSRDLPLRMAEFGSCHRNEPSHGLMRVRGFTQDDAHIFCTEEQIRDEVNGCIRLVYDMYSTFGFEVKLSTRPEKRIGSDEMWDRAEADLAVAKIEFTLY-DCLDRAWQCGTVQL---SLPSRLSASYVGEDMIHRAILG-SMERFIGILTEEFAGFFPTWPVQVVSQSEYVNELTQKLSNAGIR 568
44 -17.4001ati_A mol:protein length:505 GLYCYL-TRNA SYNTHETASE  ali model follow..  15  2....................ASSLDELVALCKRRGFIFQSSEIYGGLQGVYDYGPLGVELKNNLKQAWWRYERDDMEGLDASVLTHRLVLHYSGHEATFADPMVDNRITKKRYRLDHLLKEQPEEVLKRLYR-RGLLAYLRPETAQGIFVNFKNDATSRKLGFGIAQIGKAFRNEPRNFIFRVREFEQMEIEYFVRPGEDEYWHRYWVEERLKWWQEMGLSHYAKATVDILYRFPHGSLELEGIAQRTDFDLGSHTKDQEALGITARVLRNEHSTQRLAYRDPETGKWFVPYVISAGVDRGVLALLAEAFTREELPNGEERIVLKLKPQLAPIKVA.... 402
45 -13.8003l4g_A mol:protein length:508 Phenylalanyl-tRNA synthetase alpha chain  ali model follow..  156RSELRKRKLLAEVTLKTYWVSKGSAFSTSISKQETELSPEKPYNFLAHGVLPDSGHLHPLLKVRSQFRQIFLEMGFTEMPQPQQHPARDQHDTFFLRDPAEALQLPMDYVQRVKRTHSQGGYGSQGYKYNWKLDEARKNLTHTTSASARALYRLAQKKPFTPVKYFSIDRVFRNETL-DATHLAEFHQIEGVVADHGLTLGHLMGVLREFFTKLGIT---QLRFKPAYNPY--------------TEPSMEVFSYHQGLKKWVEVGNSGVFRPEMLLPMGLPENVSVIAW----GLSLERPTMIKYG----------NNIRELVGHKVNLQMVYDSPLCR 494
46 -13.8002rhq_A mol:protein length:294 Phenylalanyl-tRNA synthetase alpha chain  ali model follow..  14  1MGSSSSGLVPRGSHMGTELMEKLNQQLAEET-----------IDVTLPSRQISIGSKHPLTRTVEEIEDLFLGLGYEIVDGYEVEQD--------YYNFEALNLPKSHPARDMQD--------------SFYITDEILMRTHTSPVQARTMEKRN---GQGPVKIICPGKVYRRDS--DATHSHQFTQIEGLVVDKNIKMSDLKGTLELVAKKLFGA-DREIRLRPSYFPFTEPSVEVDVSCFKCKGKGCNV-----KHTGWIEILGAGMVHPNVLEMAGF---DSNEYSGFAFGMGPDRIAMLKYG................................. 262
47 -13.8005x6c_A mol:protein length:553 O-phosphoserine--tRNA(Cys) ligase  ali model follow..  12  4SMKLKHKRDDKMRFDIKKVLELAEKDFETAWRETRALIKDKHIDNKYPRLKPVYGKPHPVMETIERLRQAYLRMGFEEMINPVIVDEMEIYKQ--VGLGNEKVEIIKNLGIDIDEEKKERLREVLHLYKKGAIDSTTLTLRSHMTSGWFITLSSLIKKRKLPLKLFSIDRCFRREQREDRSHLMSYHSASCVVVGEDVSV----DDGKVVAEGLLAQFGFKFKPDEKKSKYYTP------------ETQTEVYAYHPKLGEWIEVATFGVYSPIALAKYNIDVP--------NLGLGVERLAMIIYG----------EDVRAMVYPQ............. 358
48 -13.3001b70_A mol:protein length:350 PHENYLALANYL-TRNA SYNTHETASE  ali model follow..  11  66......................EAREKALEEAALKEALERERVDVSLPGASLFSGGLHPITLMERELVEIFRALGYQAVEGPEVESE--------FFNFDALNIPEHHPARDMWDTFWLTGEGFRLEGPLGEEVEGRLLLRT----HTSPMQVRYMVAHTPPFRIVVPGRVFRFEQ--DATHEAVFHQLEGLVVGEGIAMAHLKGAIYELAQALFGP-DSKVRFQPVYFPF--------------VEPGAQFAVWWPEGGKWLELGGAGMVHPKVFQAVDAYREAYRGVTGFAFGLGVERLAML-IRYFFGGRLKFLEQFKGVL................ 350
49 -12.2002pme_A mol:protein length:693 Glycyl-tRNA synthetase  ali model follow..  11  37VDKAVAELKARKRVLEAKELALQPKDDIVDRAKMEDTLKRRFIYGGVSGLYDFGPVGCALKNNIIQTWRQIQEEQILEIDCTMLTPEPVLKTSGHVDKFADFMVHLQKLMSDKKCSVEKKSEMESVLAQLDNYGQQELYLRPETAQGIFLNFKREFNQGKLPFAAAQIGNSFRNEPRSGLIRVREFTMAEIHFVDPSEKDHPKFQNVADLHLYLYSA-TVLGYFIGRIYLYLTKVGISPDKLRFRQHMENEMAHYACDGEFTIETEGKTFQLTKVKRFQKTLYVEEVVPNVIEPSFGLGRIMYTVFEHTFHVREG--DEQRTFFSFPAVVAPFKCS.... 563
50 -11.9004e51_A mol:protein length:467 Histidine--tRNA ligase  ali model follow..  14  1..................MAMGTLEAQTQGPGSMTEQKRKLEKLTGVKGMNDILPQDAGLWEFFEATVKSLLRYGYQNIRTPIVEHTPLFTRGGEVTDIVEKEMY----------------------SFVDALNGENLTLRPENTAAVVRAAIEHNMLYDGPKRLWYIGPMFRHERPQR--RYRQFHQVGVEALGFAGPDADA--EIVMMCQRLWEDLGLTGIKLEINSKYLEQYTNPLRVLDTKNPALQEIVRNAPKLIDFLGDVSRAHFEDYYNLTFEWVTDKLGAQGTVAAGMGIERILELLKEEHLVPEQEGVDVYVVHQGDAAREQAFIVAERLR 372
51 -11.7003net_A mol:protein length:465 Histidyl-tRNA synthetase  ali model follow..  13  16...............................................SGFPEFLPSEKRLELYLLDTIRRYESYGFTPIETPAVERLEVLQAK--GNQGDNIIYGLEPILPPNRQAEKDKSGDTGSE---------ARALKFDQTVPLAAYIARHLNDLTFPFARYQMDVVFRGERAKD--RFRQFRQCDIDVVGREKLSLLYDAQMPAIITEIFEAVNIGDFVIRINN............................................................................................................... 186
52 -11.3002g4c_A mol:protein length:474 DNA polymerase gamma subunit 2  ali model follow..  24....GGHVKSHAELEGNGEHPEAPGSGEGSEALLEICQRRHFLSGSKQCHPGFGPLGVELRKNLAAEWWTVFREQVFPVDALHHKPGPLLPGDSAFRLVSAETL--------REILQDKELSKEQLVTFLENVLKTSGKLRENLLHGALEHYVNDLVNKRLPYGLAQIGVCFHPVIRNGVKSIGEKTEASLVWFTPPRTSNQWLDFWLRHRLQWWRKFA-------MSPSNFSSSDCQDEEGRKGNKLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVNGDLDRGMLAYLQLTENSFTRKKNLHRKVLKLHPCLAPIKVA.... 367
53 -11.3003p8t_A mol:protein length:294 AsnS-like asparaginyl-tRNA synthetase related protein  ali model follow..  13.......................................................KAIDIQTKILDYMTKFTDRGFKWLLPIMLSPITDPLWPD--------------------------PAGEGIRPAEVDVYGVRMRLTHS------MILHKQLAIAMGLEKIFVLSPNIRLESRRK-RHSYEFTQLDFIEGAKMKDVMRLIEELIYGLKDILEEFGSDEKASMMEEPFWIVNIPREFYDREENGVWKNYDLILPYGYGEVSSGGEREWEEKIVAKIRAAGLKEDSFRSAGAGIGVERLVRFIVGAKHIEVQPFPR...................... 286
54 -11.2002du3_A mol:protein length:534 O-phosphoseryl-tRNA synthetase  ali model follow..  12  2............KFDPQKYRELAEKDFEAAWKAGKEILAERSPNELYPRVGFSFGKEHPLFATIQRLREAYLSIGFSEVVNPLIVEDVVLDRCFYLATLPKQIEAITKREVDSKPLQEIFHRYKKGEIDGDDLSSSTLTLRSHMTTGWFITLSHIADKLPLPIKLFSIDRCFRREQGEDATRLYTYFSASCVLVDEELSVDDGKAVAEALLRQFGFE-NFRFRKDEKRSKYYIPDTQTEVFAFHPKLV-----SSTKYSDGWIEIATFGIYSPTALAEYDIPYP--------NLGLGVERLA---MILYGYD------DVRKMVYPQ............. 350
55 -11.1003hrk_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  12  4........................GTLEAQTQGPGSMQKNMVETEPVQGCRDFPPEAMRCRRHLFDVFHATAKFGFEEYDAPVLESEELYIR-KAGEEITEQMFNFITKGGH------------------------RVALRPEMTPSLARLLLGKGRSLLLPAKWYSIPQCWRYEAITR--RRREHYQWNMDIVGVKSVSAEV--ELVCAACWAMRSLGLS....................................................................................................................... 173
56 -11.0005e3i_A mol:protein length:438 Histidine--tRNA ligase  ali model follow..  12  10...............................................KGFNDVLPTQTAAWRRLEQHLASLMDYGYQQIRLPIVEQTGLFKR---------------AIGDATDIVEKEMYTFFDKGN-----PPESLTLRPEGTAGCVRALVEHNLLRGATPRVWYMGPMFRYEKPQK--RYRQFHQFGVETFGVATPDIDA--ELIMLTARLWKRMGVDHMVQLELNTL---TTNPLRILDSKIESTQKILENAPKLHDFLKEDSLSHFQDYYNKTFEWTTTALGSQGTVCAGMGMERLLL-LLEQVEQAEIVRDCEAFLVAEPAYQSKALVLAEQLR 356
57 -11.0003rac_A mol:protein length:373 Histidine-tRNA ligase  ali model follow..  11  1.....................SNAMNGTRSAWGARAWEAVRGFADRPPGMQDGYPDFAKRRRAVETRLLSVEDAGYEPVTSGLFEYVDTLLR-ARSPESSRDWIRLFDGGGDA------------------------VALRPEMTPSIARMAAPRVAAGRTPIRWCYCERVYRRTDDPASLKAAESTQVGIERIGEEASVDVDMD-VLRLLHEASAAAGVR....................................................................................................................... 180
58 -11.0005c51_B mol:protein length:485 DNA polymerase subunit gamma-2, mitochondrial  ali model follow..  33LTERSSPKGGHVKSHAELEGNGEHPEAPGSGEGSEALLE-SRDSLLSGCHPGFGPLGVELRKNLAAEWWTVFREQVFPVDALHHKPGPLLPGDSAFRLVSAETL--------REILQDKELSKEQLVAFLENVLKTSGKLRENLLHGALEHYVNDLVNKRLPYGLAQIGVCFHPVIRNGVKSIGEKTEASLVWFTPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSD-----------CQDEEGRKGNKLYYNFPWGKELIE--ELLHMYPGNVSKLHGRDGRKNVVCVLSVNGDLDRGMLAYLQLTENSFTRKKNLHRKVLKLHPCLAPIKVA.... 384
59 -11.0002el9_A mol:protein length:431 Histidyl-tRNA synthetase  ali model follow..  13  16...............................................RGMNDYLPGETAIWQRIEGTLKNVLGYGYSEIRLPIVEQTPLFKR----------------------AIGEVTDVVEKEMYTFEDRNGDSLTLRPEGTAGCVRAGIEHGLLYNQEQRLWYIGPMFRHERPQK--RYRQFHQLGCEVFGLQGPDIDA--ELIMLTARWWRALGISEHVTLELNSI---YTNPLRVLDSKNPEVQALLNDAPALGDYLDEESREHFADYYNRTFEWVTNSGRATPAVGFAMGLERLVLLV................................... 323
60 -10.9004lns_A mol:protein length:351 Asparagine synthetase a  ali model follow..  10  15.......................................................QILTVKRSFSEALEK--ELNLVEVRAPILFRVGDGTQDNLSGFEKAVQVPVKAIPNASFEV--------------------------VHSLAKWKRRTLANYKFAPGHGLYTHMTALRVDDVLDNIHSVVVDQWDWMVMKDDQRNLAFLKEVVCKVYAAIRKTEYKQKPILPETIQFVHAEHLLLAYPNLTGLNGDILLYNPTLDDSLEVSSMGIRVNAEA-EWHQQLLNGEFPQTVGGGIGQSRMVMFMLRKKHIGCSVWPEEIRK.................. 346
61 -10.7001nnh_A mol:protein length:294 asparaginyl-tRNA synthetase-related peptide  ali model follow..  13.......................................................PTLDIQTKILEYMTDFVKEGFKWLLPVIISPITDPLWPDPAGE--------------------------GMEPAEVEIYGVKMRLTHS------MILHKQLAIAMGLKKIFVLSPNIRLESRQK-RHAYEFTQLDFVERAKMEDIMRLIERLVYGLSEVLEEFGSDEKASQMEEPFWIINIPREFYDREVDGFWRNYDLILPYGYGEVASGGEREWEEKIVAKIRKAGLNEDSFRSAGAGIGVERLVRFIVGAKHIEVQPFPR...................... 286
62 -10.7003hri_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  13  4........................GTLEAQTQGPGSMQMNMVETEPVQGCRDFPPETMRLRKYLFDVFHSTARFGFEEYDSPVLESEELYIR-KAGEEITEQMFNFITKGGH------------------------RVALRPEMTPSLARQLLAKGRSLLLPAKWYSIPQCWRYEAITR--RRREHYQWNMDIIGVKSVSSEV--ELVCAACTAMQSLGLS....................................................................................................................... 173
63 -10.5004ztu_B mol:protein length:472 DNA polymerase subunit gamma-2, mitochondrial  ali model follow..  17....GGHVKSHAELEGNGEHPEAPGSGEGSEALLEICQRRHFLSGSKQCHPGFGPLGVELRKNLAAEWWTVFREQVFPVDALHHKPGPLLPGDSAFRLVSAETL--------REILQDKELSKEQLVAFLENVLKTSGKLRENLLHGALEHYVNDLVNKRLPYGLAQIGVCFHPVIRNGVKSIGEKTEASLVWFTPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSD-----------CQDEEGRKGNKLYYNFPWGKELIETLWLLHMYPGNVSKLHGRDGRKNVVCVLSVNGDLDRGMLAYLQLTENSFTRKKNLHRKVLKLHPCLAPIKVA.... 360
64 -10.4004p71_C mol:protein length:338 Phenylalanine--tRNA ligase alpha subunit  ali model follow..  12  54..PKVGALINVAKEKVQDVLNARKTELEGAALAARLAAERIDVTL--PGRGQLSGGLHPVTRTLERIEQCFSRIGYEVAEGPEVEDD--------YHNFEALNIPGHHPARAMHD--------------TFYFNANMLLRTHTS-----PVQVRTMESQQPPIRIVCPGRVYRCDSDL--THSPMFHQVEGLLVDEGVSFADLKGTIEEFLRAFFEK-QLEVRFRPSFFPF----TEPSAEVDIQCVICSGNGCRVCKQTGWLEVMGCGMVHPNVLRMSNI---DPEKFQGFAFGMGAERLAMLRYG----------NDLRLFFDND............. 330
65 -10.00011as_A mol:protein length:330 ASPARAGINE SYNTHETASE  ali model follow..  10  11.......................................................QISFVKSHFSRQLEE--RLGLIEVQAPILSRVG------------------------DGTQDNLSGAEKAVQVKVKALPDAQFEVVHSLAKWKRQTLGQHDFSAGEGL-YTHMKALRPDEDRLSPLHSVYVDQWDWRVMGDGERQFSTLKSTVEAIWAGIKA--FGLAPFLPDQIHFVHSQELLSRYPDLDAKGRERAIPVLEDAFELSSMGIRVDADTLKHQWHQALLRGEMPQTIGGGIGQSRLTMLLLQLPHIGQVQWPAAVRESV................ 326
66 -10.0001qe0_A mol:protein length:420 Histidine--tRNA ligase  ali model follow..  1..........................................MIKIPRGTQDILPEDSKKWRYIENQLDELMTYNYKEIRTPIFESTDLFAR----------------------GVGDSTDVVQKEMYTFKDKGDRSITLRPEGTAAVVRSYIEHKMQGNQPIKLYYNGPMFRYERKQK--RYRQFNQFGVEAIGAENPSVDA--EVLAMVMHIYQSFGLKHLKLVINS--YTEDPNLVRGLDYYTHTAFELMMDNPNYDGAITTLCGGGRYNGLLELLD-----GPSETGIGFALSIERLLLAL................................... 317
67 -9.9504g85_A mol:protein length:517 Histidine-tRNA ligase, cytoplasmic  ali model follow..  13  32........LKQQKASAELIEEEVAKLLKLKAQLGPDESKQKFVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKHGAEVIDTPVFELKETLMG---------------KYGEDSKLIYDLKDQ-----------GGELLSLRYDLTVPFARYLAMNKL---TNIKRYHIAKVYRRDPAMTRGRYREFYQCDFDIAGNFDPMIPDAE-CLKIMCEILSSLQIGDFLVKVND............................................................................................................... 224
68 -9.8105xix_A mol:protein length:472 Asparagine--tRNA ligase, cytoplasmic  ali model follow..  144.................................VDVQLNNRHMMIRGENMSKILKARSMVTRCFRDHFFD---RGYYEVTPPTLVQTQVEGGATLFK----------------------------------DYFGEEAFLTQSSQLYLETCLPA---------DVFCIAQSYRAEQSRTRRHLAEYTHVEACPFLTFDDLLNRLEDLVCDVVD-FKRMNYSDAIVWLKESFYMQRCPEDSRL----TESVDVLMPNVGEGGSMRIFDSEEILAGYKRE--TDQRKYGTCPHGGYGLGLERFLTWILNRYHIDVCLYPRFVQR.................. 463
69 -9.7904rdx_A mol:protein length:423 Histidine--tRNA ligase  ali model follow..  16  9...............................................RGTKDLFGKELRMHQRIVATARKVLEAGALELVTPIFEETQVFEK----------------------GVGAATDIVRKEMFTFQDRGGRSLTLRPEGTAAMVAYLEHGMKVWPQPVRLWMAGPMFRAERPQK--RYRQFHQVNYEALGSENPILDA--EAVVLLYECLKELGLRRLKVKLSSEVLSPHREALSEDSKERLELNPMRILDSKSERDQALLKELG--DYYVRTFEVHHEEGPRVPGVGFAFGVERVALAL................................... 318
70 -9.6903od1_A mol:protein length:400 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  15  1..................................SNAMSKPFMFEKPFGMRDTLPEWYKTKKNICDQMTEINLWGYDMIETPTLEYYETVGVVS--AILDQQLFKLLDQQGNT------------------------LVLRPDMTAPIARLVASSLKDRAYPLRLAYQSNVYRAQQNEG--KPAEFEQLGVELIGDGTASADG--EVIALMIAALKRAGLS....................................................................................................................... 159
71 -9.6505c53_B mol:protein length:903 Pol gamma B  ali model follow..  373LLENGISVWPGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLE---NGLIHLRSHISKLKDFLIKYISNVMRSRVAVRACHKVCRCLLSGFGGRVDAGQPELVKSHAELEGNGEHPEAPGSGEGSEALLEICQRRHFLLRENLLHGALEHYVNDLVNKRLPYGLAQIGVCFHPVIRNGVKSIGEKTEASLVWFTPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSD-----------CQDEEGRKGNKLYYNFPWGKELIE-GDHELLHMYPGNVSKLHGRDGRKNVVPCVNGDLDRGMLAYLQLTENSFTRKKNLHRKVLKLHPCLAPIKVA.... 802
72 -9.6403i7f_A mol:protein length:548 Aspartyl-tRNA synthetase  ali model follow..  224.................................QDTRLDNRMLDLRTVTNIAIFRIQSACCGLFREFLTS---QKFVEIHTPKLIGCSSEGGSNIFE----------------------------------KYFDRKAYLAQS------PQLYKQMAIMGDFRKVFEVGPVFRAENSNTRRHLTEFEGLDMEIVENYHECIDVMEKLFFIFDEIPKRFPDELKVIRKQYPFEDLIYRPFLRLTYKEAIEM-ILDKFPAAIRPF-YTMPDIDDPNYSNSYDVFVRGQEIT-HAGCGIGLERITMLYLGIPN-KVTLFPRDPIR.................. 545
73 -9.5102xti_A mol:protein length:437 ASPARAGINYL-TRNA SYNTHETASE, CYTOPLASMIC, PUTATIVE  ali model follow..  10  114.................................VDKMLDNRHLVIRGENAAALLRLRAAATRAMREHFYN---AGYVEVAPPTLVQTQVEGGSTLFN----------------------------------DYFGEQSFLTQSSQLYLETCIPT---------DVFCIAQSYRAEKSRTRRHLAEYAHVEACPFITLDDLMEKIEELVCDTVD-FLRMEYKDAIKWLQEAFYMQRDAKDNTL----TESVDLL--MPGVGEIVGGSMRIWKFDELSKAFKNVEIDPKPYYHGGYGLGLERFICWLTNTNHIDVCLYPRFVGR.................. 434
74 -9.4204j15_A mol:protein length:521 Aspartate--tRNA ligase, cytoplasmic  ali model follow..  11  190.................................QDTRLDNRVIDLRTSTSQAVFRLQSGICHLFRETLIN---KGFVEIQTPKIISAASEGGANVFT----------------------------------SYFKNNAYLAQS------PQLYKQMCICADFEKVFSIGPVFRAEDSNTHRHLTEFVGLDMAFNYHYHEVMEEIADTMCEALAMLREAGVEMKYPLAVRPFYTMPDPRNPKQ----SNSYDMFM----RGEEILSGAQRIHDQLLTERALHHGIDLEKIKHAGGGIGLERVTMLFLGLHNVQTSMFPRDPKR.................. 512
75 -9.3603m4p_A mol:protein length:456 Asparaginyl-tRNA synthetase, putative  ali model follow..  136.................................IPQKMQNRHIVIRSEHTQQVLQLRSEIQWYFRKYYHD---NHFTEIQPPTIVKTQCEGGSTLFK----------------------------------QYFNEPAYLTQSSQLYLESVIAS---------KSFCMLSSYRAEQSRTVRHLAEYLHLEALPFISFEDLLNHLEDLVCTVID-FKRMTYADAIKYCNDAFYMSKVPGHPDL----TESVDLL--MPGVGEIVGGSMRIWNYDELMGAYKANGLNPDPYYHGGYGLGVERLVMWLLGEDHIKVCLYPRYLER.................. 453

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 4 5 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Sasin JM, Godzik A, Bujnicki JM. SURF'S UP! - protein classification by surface comparisons. J Biosci. 2007 Jan;32(1):97-100.