current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 4hsp_A mol:protein length:150 hypothetical protein, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150
# Score Template Links and tools%idFirst GAPRELTWSQLIPAGAPPAPAPLPIHDLANALSEAGPAASQQSPNAPVVKALDGIEAKLPGYIVPLEISEAGLVTEFLLVPYYGACIHVPPPPSNQIVYVKTAKGVQMDELYQPFWVEGTFKVENASSELAAAGYRMQASKVTPYEYEGGLast
1 -76.9004hsp_A mol:protein length:150 hypothetical protein  ali model  100  1GAPRELTWSQLIPAGAPPAPAPLPIHDLANALSEAGPAASQQSPNAPVVKALDGIEAKLPGYIVPLEISEAGLVTEFLLVPYYGACIHVPPPPSNQIVYVKTAKGVQMDELYQPFWVEGTFKVENASSELAAAGYRMQASKVTPYEYEGG 150
2 -10.9003stb_C mol:protein length:148 RNA-editing complex protein MP42  ali model follow..  14  45......................................................NHCVMLGVVQNIQEGFEDKVLQFTLITDFE-----PGDPDKDFHTVRVFDSDYSSRVKEWFLVTGRLRMVPQYDGSMRKYYHYPVIQVHP...... 140
3 -9.2404dk3_C mol:protein length:105 RNA-editing complex protein MP81  ali model follow..  17  4......................................................SNALMIGRIVQHGFLGAMTVTQYVLEVDGGA------NFPASLLKDQVKLG-------SRVLVQGTLRMNRHVDDVSKRLHAYPFIQVVP...... 96
4 -9.1604gn5_A mol:protein length:113 OBody AM3L15  ali model follow..  11  10.............................................AEITPNLHGSEVVVAGWVAHLGDYGR---VKIVKVSDREGGAAVPVYLERGKTPDHLFKVFAELSREDVVVIKGIVEAGWPVALDTGVEIFPSEIWILNKAKP.. 109
5 -9.1404glv_B mol:protein length:107 OBody AM3L09  ali model follow..  11  10.............................................AEITPNLHGSEVVVAGWVAHLGDYGR---VKIVKVSDREGGAAVPVYLERGKTPDHLFKVFAELSREDVVVIKGIVEATTVTRWDTGVEIFPSEIWI........ 103
6 -9.1204gn3_B mol:protein length:113 OBody AM1L10  ali model follow..  12  14.............................................AEITPNLHGTEVVVAGWV---ASLGDYGRVKIVKVSDREGGAAVSVYLEYGKTPDHLFKVFAELSREDVVVIKGIVEASKAAADM-HNGVEIFPSEIWILNKAK. 113
7 -9.0504gn4_B mol:protein length:108 OBody AM2EP06  ali model follow..  11  11.............................................AEITPNLHGSEVVVAGWVAHLGDYGR---VKIVKVSDREGGAAVPVYLERGKTPDHLFKVFAELSREDVVVIKGIVEASEQYGSATGVEIFPSEIWI........ 104
8 -8.8103k81_C mol:protein length:164 MP18 RNA editing complex protein  ali model follow..  13  23......................................................NSVTLVGVVHDIQSGYEDAVTQFTLTTTSI----QEVVVEKDHHTIRCFGELFSAEVKQVVCVNGRLRLSPQLEPSCNKHFYFPYIQVQP...... 122
9 -8.7305gro_A mol:protein length:115 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  11  12.............................................TEISEKDVGKIVKVAGWC--IDLRDKSGLVQLVCDPSSKAYEKALEVRSEFVLVAKGKVRLRGAGLENPKLKTGKIEIVLEELIIEN.................. 107
10 -8.6004gla_C mol:protein length:109 OBody NL8  ali model follow..  12  12.............................................AEITPNLHGTEVVVAGWVASLGDYGR---VKIVKVSDREGGAAVPVYLEAGKTPDHLFKVFAELSREDVVVIKGIVEASKGVGR-----VEIFPSEIWILNKAKA 109

FFAS is supported by the NIH grant R01-GM087218-01
1 2 8 4 9 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Bossy-Wetzel E, Barsoum MJ, Godzik A., Schwarzenbacher R, Lipton SA. Mitochondrial fission in apoptosis, neurodegeneration and aging. Curr Opin Cell Biol. 2003 Dec;15(6):706-16. Review.