current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 4hvc_A mol:protein length:519 Bifunctional glutamate/proline--tRNA ligase, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510
# Score Template Links and tools%idFirst MGSGEGQGPKKQTRLGLEAKKEENLADWYSQVITKSEMIEYHDISGCYILRPWAYAIWEAIKDFFDAEIKKLGVENCYFPMFVSQSALEKEKTHVADFAPEVAWVTRSGKTELAEPIAIRPTSETVMYPAYAKWVQSHRDLPIKLNQWCNVVRWEFKHPQPFLRTREFLWQEGHSAFATMEEAAEEVLQILDLYAQVYEELLAIPVVKGRKTEKEKFAGGDYTTTIEAFISASGRAIQGGTSHHLGQNFSKMFEIVFEDPKIPGEKQFAYQNSWGLTTRTIGVMTMVHGDNMGLVLPPRVACVQVVIIPCGITNALSEEDKEALIAKCNDYRRRLLSVNIRVRADLRDNYSPGWKFNHWELKGVPIRLEVGPRDMKSCQFVAVRRDTGEKLTVAENEAETKLQAILEDIQVTLFTRASEDLKTHMVVANTMEDFQKILDSGKIVQIPFCGEIDCEDWIKKTTARDQDLEPGAPSMGAKSLCIPFKPLCELQPGAKCVCGKNPAKYYTLFGRSYLast
1 -167.0004hvc_A mol:protein length:519 Bifunctional glutamate/proline--tRNA ligase  ali model  100  1MGSGEGQGPKKQTRLGLEAKKEENLADWYSQVITKSEMIEYHDISGCYILRPWAYAIWEAIKDFFDAEIKKLGVENCYFPMFVSQSALEKEKTHVADFAPEVAWVTRSGKTELAEPIAIRPTSETVMYPAYAKWVQSHRDLPIKLNQWCNVVRWEFKHPQPFLRTREFLWQEGHSAFATMEEAAEEVLQILDLYAQVYEELLAIPVVKGRKTEKEKFAGGDYTTTIEAFISASGRAIQGGTSHHLGQNFSKMFEIVFEDPKIPGEKQFAYQNSWGLTTRTIGVMTMVHGDNMGLVLPPRVACVQVVIIPCGITNALSEEDKEALIAKCNDYRRRLLSVNIRVRADLRDNYSPGWKFNHWELKGVPIRLEVGPRDMKSCQFVAVRRDTGEKLTVAENEAETKLQAILEDIQVTLFTRASEDLKTHMVVANTMEDFQKILDSGKIVQIPFCGEIDCEDWIKKTTARDQDLEPGAPSMGAKSLCIPFKPLCELQPGAKCVCGKNPAKYYTLFGRSY 513
2 -163.0004k86_A mol:protein length:535 Proline--tRNA ligase  ali model follow..  99  18.GAGEGQGPKKQTRLGLEAKKEENLADWYSQVITKSEMIEYHDISGCYILRPWAYAIWEAIKDFFDAEIKKLGVENCYFPMFVSQSALEKEKTHVADFAPEVAWVTRSGKTELAEPIAIRPTSETVMYPAYAKWVQSHRDLPIKLNQWCNVVRWEFKHPQPFLRTREFLWQEGHSAFATMEEAAEEVLQILDLYAQVYEELLAIPVVKGRKTEKEKFAGGDYTTTIEAFISASGRAIQGGTSHHLGQNFSKMFEIVFEDPKIPGEKQFAYQNSWGLTTRTIGVMTMVHGDNMGLVLPPRVACVQVVIIPCGITNALSEEDKEALIAKCNDYRRRLLSVNIRVRADLRDNYSPGWKFNHWELKGVPIRLEVGPRDMKSCQFVAVRRDTGEKLTVAENEAETKLQAILEDIQVTLFTRASEDLKTHMVVANTMEDFQKILDSGKIVQIPFCGEIDCEDWIKKTTARDQDLEPGAPSMGAKSLCIPFKPLCELQPGAKCVCGKNPAKYYTLFGRSY 529
3 -149.0005f9y_A mol:protein length:511 Aminoacyl-tRNA synthetase  ali model follow..  53  2......ASKENESLLGITADKITSFADWYSQVIVKSEMIEYYDISGCYILRPWSYFIWETIQSVFDQKIKQHDVQNAYFPIFVTQKKLETEKDHVEGFSPEVAWVTKSGKSDLAEPIAIRPTSETIMYPYFAKWIRSHRDLPLKINQWTSIVRWEFKHPTPFIRTREFLWQEGHTAHSTRKEALEMVDIILNEYASIYEDLLATPVVKGTKSENEKFPGGDITKSIEGFIPEIGRAVQAATSHLLGQNFSKMFGVEFEDEKGNKE--YAHQTSWGLTTRAIGVMIMTHGDNKGLVLPPKVAPVQVIIIPIIFKT----VITEEQKKICNEVECILKKAGVRVKIDDRSNYTPGWKYNHWEVKGVCLRFEVGPRDIEKRSVRVVVRDNMEKMDIPISELESKIPKLLEEFQNRLLFKAKQRQNESIIRVDTFDKVMDTLNQKKMVIAPWCEDVSCEEEIKKETARLSLDNNQSMTGAMKSLCIPNDQIFKEEGKTKCFFCDKLAKKFTLFGRSY 505
4 -149.0004ncx_A mol:protein length:506 Proline--tRNA ligase  ali model follow..  51  1.........MASNILGITSKKIENFSDWYTQVIVKSELIEYYDISGCYILRPAAYYIWECVQAFFNKEIKKLNVENSYFPLFVTKNKLEKEKNHIEGFSPEVAWVTKYGDSNLPEEIAIRPTSETIMYSVFPKWIRSYRDLPLKLNQWNTVVRWEFKQPTPFIRTREFLWQEGHTAHKNEEEAVKLVFDILDLYRRWYEEYLAVPIIKGIKSEGEKFGGANFTSTAEAFISENGRAIQAATSHYLGTNFAKMFKIEFEDENEVKQ--YVHQTSWGCTTRSIGIMIMTHGDDKGLVLPPNVSKYKVVIVPIFYKT----TDENAIHSYCKDIEKILKNAQINCVYDDRASYSPGYKFNHWELRGIPIRIEVGPKDLQNNSCVIVRRDNNEKCNVKKESVLLETQQMLVDIHKNLFLKAKKKLDDSIVQVTSFSEVMNALNKKKMVLAPWCEDIATEEEIKKETQRLSLNSETTLSGAMKPLCIPLDQP-PMPPNMKCFWSGKPAKRWCLFGRSY 500
5 -147.0005xif_A mol:protein length:500 Prolyl-tRNA synthetase (ProRS)  ali model follow..  54  2..............AMVTAKKDENFSEWYTQAIVRSEMIEYYDISGCYIMRPWAFHIWEKVQRFFDDEIKKMGVENSYFPMFVSRHKLEKEKDHVEGFSPEVAWVTHYGDSPLPEKIAIRPTSETIMYPAYAKWIRSHRDLPLKLNQWCSVVRWEFKQPTPFLRTREFLWQEGHTAHATEEEAWELVLDILELYRRWYEECLAVPVIKGEKSEGEKFAGGKKTTTVEAFIPENGRGIQAATSHLLGTNFAKMFEIEFEDEEGHKRLVHQTS--WGCTTRSLGVMIMTHGDDKGLVIPPRVASVQVVIIPILFKD----ENTGEILGKCRELKTMLEKADIRVRIDDRSNYTPGWKYNHWEVKGVPLRLELGPKDLAKGTARVVRRDTGEAYQISWADLAPKLLELMEGIQRSLFEKAKARLHEGIEKISTFDEVMPALNRKHLVLAPWCEDPESEEQIKKETQKEAGDSEQVMTGAMKTLCIPFDQP-PMPEGTKCFYTGKPAKRWTLWGRSY 500
6 -146.0005xip_A mol:protein length:498 Prolyl-tRNA synthetase, putative  ali model follow..  56  1............GAMGVTAKKSTNFADWYTQVIVRGELVEYYDISGCYIIRPWAYRIWEAVQKFFDDGIKRLGVENCYFPMFVSQAKLEKEKDHVEGFKPEVAWVTHYGDSELPEKVAIRPTSETIMYPAYAKWIRSHRDLPLKLNQWNNVVRWEFKQPTPFLRTREFLWQEGHTAHATEEEAYTLVLEILELYRQWYEDYLAVPVIKGEKSENEKFAGGKKTTTIEGIIPDTGRGIQAATSHLLGQNFSRMFSIEFEDEKGAKQ--LVHQTSWGCTTRSLGVMIMTHGDDKGLVLPPRVVAVQAVIIPIIFKE----TGGMEIVAKCRELERLLNAAGVRVKVDDRTNYTPGWKFNDWELKGVPLRLEIGPRDVESCQTRVVRRDTSEARNVPWAEAASTIPAMLETMQKDLFNKAKAKFEASIEQITTFDEVMPALNRRHVVLAPWCEDPETETQIKRETQRLSRENADGMTGAMKPLCIPFDQP-PMPEGTRCFFTGRPAKRWCLFGRSY 498
7 -141.0005xil_A mol:protein length:512 Putative prolyl-tRNA synthetase  ali model follow..  56  1............GAMGIAAKREENFSAWYIDVITKAEMIEYYDVSGCYIIRPWAYYVWKCVQRFLGGKIEKLGVEDCYFPMFVSRSCLEREKDHIEGFAPEVAWVTRAGDTELEQPVAVRPTSETVMYPYYAKWIRSHRDLPVRLNMWNNVIRWEFSHPTPFIRTREFLWQEGHCAWAKAEECAKEVLEILECYASVYEQLLAVPVVRGRKTEKEKFAGGDYTTTVETFIEAVGRGCQGATSHNLGQNFGKMFDIRFQDPENNEQTLIPWQNSWGLSTRVIGVMIMVHGDNRGMVMPPRVASTQVIIIPVGITKDTTEEARQELLASCWRLESELCEGGVRARCDLRDNYSPGWRFNHWEVKGVPLRVELGPRELAERSLAVAVRHSGARHSVAWDAQTPAAAALLEDVHAQMYARAKETMETHRVRVTEWTEFVPTLNRKCLILAPWCGAMECENQVKKDSAEESREDARAPSMGAKTLCIPFEQPEEPAEGHECKGCTKPATTWVLFGRSY 512
8 -135.0003ial_A mol:protein length:518 Prolyl-tRNA synthetase  ali model follow..  27  2........AMGGDVTFSLTKTRDTFADWFDAIMDAAELVDRYPVKGCVVFRPYGFFMENAIMRLCEEEYAKVGISQILFPTVIPESFLKKESDHIKGFEAECFWVEKGGLQPLEERLALRPTSETAIYSMFSKWVRSYKDLPLKIHQTCTIFRHETKNTKPLIRVREIHWNEAHCCHATAEDAVSQLSDYWKVIDTIFSDELCFKGQKLRRVCWDRFPGADYSEVSDVVM-PCGRVLQTAGIHNLGQRFSSTFDILYANKANESVHPYL--TCAGISTRVLACALSIHGDSGGLVLPPLIAPIHVVIIPIGCGKKNNQESDQQVLGKVNEIADTLSKLGLRVSIDDDFSKSMGDKLYYYELKGVPLRIEVGQRDLANGQCIVVPRDVGKDQVIPITEVMKVSSDELDAYKARLKEKAFAFHNSMVTNCKSFDEIVACIENKGLARFPFYTTEADGEVWDKKLKDA---------CSAEIRGHNPDENV--LPGEVCALSGKPAVCYMYCAKSY 512
9 -128.0001h4q_A mol:protein length:477 PROLYL-TRNA SYNTHETASE  ali model follow..  43  1..........MAKEKGLTP-QSQDFSEWYLEVIQKAELADYGPVRGTIVVRPYGYAIWENIQQVLDRMFKETGHQNAYFPLFIPMSFLRKEAEHVEGFSPELAVVTHAGGEELEEPLAVRPTSETVIGYMWSKWIRSWRDLPQLLNQWGNVVRWEMRTR-PFLRTSEFLWQEGHTAHATREEAEEEVRRMLSIYARLAREYAAIPVIEGLKTEKEKFAGAVYTTTIEALMKDG-KALQAGTSHYLGENFARAFDIKFQDRDLQVK--YVHTTSWGLSWRFIGAIIMTHGDDRGLVLPPRLAPIQVVIVPIYKDES-----RERVLEAAQGLRQALLAQGLRVHLDDRDQHTPGYKFHEWELKGVPFRVELGPKDLEGGQAVLASRLGGKE-TLPLAALPEALPGKLDAFHEELYRRALAFREDHTRKVDTYEAFKEAVQEG-FALAFHCGDKACERLIQEET-------------TATTRCVPFEAE---PEEGFCVRCGRPSAKRVVFAKAY 477
10 -128.0001nj1_A mol:protein length:501 Proline-tRNA Synthetase  ali model follow..  33  11..RGSHMQKPIKKDPNRYHEKMTEFSEWFHNILEEAEIIDQYPVKGMHVWMPHGFMIRKNTLKILRRILDR-DHEEVLFPLLVPEDELAKEAIHVKGFEDEVYWVTHGGLSKLQRKLALRPTSETVMYPMFALWVRSHTDLPMRFYQVVNTFRYETKHTRPLIVREITTFKEAHTIHATASEAEEQVERAVEIYKEFFNSLGI-PYLITRRPPWDKFPGSEYTVAFDTLM-PDGKTLQIGTVHNLGQTFARTFEIKFETPEGDHEYVHQ--TCYGLSDRVIASVIAIHGDESGLCLPPDVAAHQVVIVPIIFKKA-----AEEVMEACRELRSRLEAAGFRVHLDDR-DIRAGRKYYEWEMRGVPLRVEIGPRDLEKGAAVISRRDTGEKVTADLQGIEETLRELMKDILENLRTRAWERMESEIREAETLEEASRIVDEKRIISFMWCGEEECGMDVEEKV-------------RVDILGIQEEGS------GTCINCGREAPYRAYLARTY 495
11 -119.0001nj8_A mol:protein length:459 Proline-tRNA Synthetase  ali model follow..  33  1..................GSHMLEFSEWYSDILEKAEIYDVYPIKGCGVYLPYGFKIRRYTFEIIRNLLDESGHDEALFPMLIPEDLLAKEAEHIKGFEDEVYWVTHGGKTQLDVKLALRPTSETPIYYMMKLWVKVHTDLPIKIYQIVNTFRYETKHTRPLIRLREIMFKEAHTAHSTKEEAENQVKEAISIYKKFFDTLGIPYLISKRPEWDKF--PGAEYTMAFDTIFPDGRTMQIATVHNLGQNFSKTFEIIFETPTGDKDYAYQ--TCYGISDRVIASIIAIHGDEKGLILPPIVAPIQVVIVPLIFKGK-----EDIVMEKAKEIYEKL-KGKFRVHIDDR-DIRPGRKFNDWEIKGVPLRIEVGPKDIENKKITLFRRDTMEKFQVDETQLMEVVEKTLNNIMENIKNRAWEKFENFITILEDIDEIKNILEKRGVILVPFKEEIYNEELEEKV--------------EATILGETEYK------GNKYIAIA----------KTY 459
12 -95.5002j3l_A mol:protein length:572 PROLYL-TRNA SYNTHETASE  ali model follow..  17  1.........MKQSKMLIPTLRENDAEVLSHQILLRAGYIR-QVAAGIYSYLPLANRVLEKLKTIMREEFEKIDAVEMLMPALLPAELWKESGRYETYGPNLYRLKDRND-----RDYILGPTHEETFTELIRDEINSYKRLPLNLYQIQTKYRDEKRSRSGLLRGREFIMKDGYSFHADEASLDQSYRDYEKAYSRIFERCGLEFRAIIGDGGAMGGKDSKEFMAISEIGEDTIKGIEIGHIFKLGTRYSDAMGATVLDENGREKSVIMGCYGIGVS-RLLSAIVEQNADERGINWPTGIAPFDLHVVQMNVKD-------EYQTKLSQEVEAMMTEAGYEVLVDDR-NERAGVKFADADLIGCPIRITVGKKAVD-GVVEVKIKRTGEMLEVRKEELESTLSILMNTTSEV..................................................................................................... 571
13 -86.2002i4l_A mol:protein length:458 Proline-tRNA ligase  ali model follow..  17  11.....RGSHMRLSRFFLPILKEKEAEIVSHRLMLRAGMLR-QEAAGIYAWLPLGHRVLKKIEQIVREEQNRAGAIELLMPTLQLADLWRESGRYDAYGPEMLRIADRHK-----RELLYGPTNEEMITEIFRAYIKSYKSLPLNLYHIQWKFRDEQRPRFGVMRGREFLMKDAYSFDVDEAGARKSYNKMFVAYLRTFARMGLKAIPMRAETGPIGGDLSHEFIVLAETGESGVRGIEVGQIFYFGTKYSDSMKANVTGPDGTDAPIHGGSYGVGVS-RLLGAIIEACHDDNGIIWPEAVAPFRVTILNLKQGD-------AATDAACDQLYRELSAKGVDVLYDDT-DQRAGAKFATADLIGIPWQIHVGPRGLAEGKVELKRRSDGARENLALADVVARLT.............................................................................................................. 452
14 -85.5005ucm_A mol:protein length:579 Proline--tRNA ligase  ali model follow..  17  3.........MRTSQYLLSTLKEADAVVISHQLLLRAGMIR-RLASGLYTWLPMGLRVLRKVETIVREEMNAAGALEVLMPAVQPAELWQESGRWEQYGPELLRLKDRHE-----REFCVGPTHEEVITDLARNELNSYKQLPINFYQIQTKFRDEIRPRFGLMRGREFIMKDAYSFHLSQDSLQQTYDGMYQAYSKIFSRLGLDFRPVQADNGSIGGSGSHEFHVLANSGEDDIRGIEVGHIFQLGTKYSEAMKLSVLSEQGKPVNLIMGCYGIGVS-RVVAAAIEQNHDERGILWPSALAPFQIALVPLKYET-------ESVKQATDKLYAELTAAGFEVLLDDRDKKSPGVKFADMELIGIPHRIVISDRGLSEGVLEYKGRRDSESQNLPIGELMSFITEKLSR......................................................................................................... 573
15 -68.5004p3n_A mol:protein length:415 Threonine--tRNA ligase, cytoplasmic  ali model follow..  16  2.....................GSSSSGDHRKIGRDQELYFFHESPGSCFFLPKGAYIYNALIEFIRSEYRKRGFQEVVTPNIFNSRLWMTSG-HWQHYSENMFSFE-----VEKELFALKPMNCPGHCLMFDHRPRSWRELPLRLADFGVLHRNELSGATGLTRVRRFQQDDAHIFC-AMEQIEDEIKGCLDFLRTVYSVFGFSFKLNGEKWELNSGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLTYVSHDGDDRPVIVHRAILGSVERMIAILTENYGGK----WPFWLSPRQVMVVPVG----------PTCDEYAQKVRQQFHDAKFMADIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKISGTVNIRTRDNKVHGERTISETIERLQQLKEFRSKQAEEE................................................................................................. 408
16 -67.2004hwt_A mol:protein length:413 Threonine--tRNA ligase, cytoplasmic  ali model follow..  17  1........................MARDHRKIGRDQELYFFHESPGSCFFLPKGAYIYNALIEFIRSEYRKRGFQEVVTPNIFNSRLWMTSG-HWQHYSENMFSFE-----VEKELFALKPMNCPGHCLMFDHRPRSWRELPLRLADFGVLHRNELSGATGLTRVRRFQQDDAHIFC-AMEQIEDEIKGCLDFLRTVYSVFGFSFKLFGEKWELNSGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLTYVSHDGDDRPVIVHRAILGSVERMIAILTENYGGK----WPFWLSPRQVMVVPVG----------PTCDEYAQKVRQQFHDAKFMADIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKISGTVNIRTRDNKVHGERTISETIERLQQLKEFRSKQAEEE................................................................................................. 404
17 -63.9003a31_A mol:protein length:471 Probable threonyl-tRNA synthetase 1  ali model follow..  13  17.....................DITVKPDSRVPVFNREFATFT-GAGVPLFSLGGGPIRYALAEVLAKFHARRGYYVVETPIIASTELFKVSG-HIEFYRNNMYLFD-----IEGHEFAVKPMNCPYHILLFLNEVASKLPLPFKVFEFGRVHRYEPSGSYGLLRVRGFTQDDAHIIV-PGGRVIDVVYDVFEEMKLVLERLFKL-EKYGIDIVELEGEAAFYGPKLDFIEESGVSKEWQMGTIQFDFNLPRRFRLYDVVREEIEEVYIIHRALLGSIERFLGVYLEHRRGR----MPFTLAPIQFAVIAVKTGGEVDREIED----LASSIAKGLLDKGFRVAVKGSSKTGLSSDVRHIESTAKPAVVFIGAKEVREKVLDVRVFDLESMKRRRLAIAYGDAADAVENLAAVAEELESPVRSLSGQAPRIPADFSFML........................................................................... 471
18 -62.0004hwo_A mol:protein length:411 Threonine--tRNA ligase  ali model follow..  18  1........................MARDHRKIGKQLDLYHMQEAPGMVFWHNDGWTIFRELEVFVRSKLKEYQYQEVKGPFMMDRVLWEKTG-HWDNYKDAMFTT-----SSENREYCIKPMNCPGHVQIFNQGLKSYRDLPLRMAEFGSCHRNEPSGSHGLMRVRGFTQDDAHIFC-TEEQIRDEVNGCIRLVYDMYSTFGFEKIVVKLSTRPEKGEGAFYGPKIEFTLYDCLDRAWQCGTVQLDFSLPSRLSASYVGEDNEKVPVMIHRAILGSMERFIGILTEEFAGF----FPTWLAPVQVVIMNIT----------DSQSEYVNELTQKLSNAGIRVKADLRNE-KIGFKIREHTLRRVPYMLVCGDKEVESGKVAVRTRRGKDLGSMDVNEVIEKLQQEIRSRSLKQLEE................................................................................................. 403
19 -61.6003ugq_A mol:protein length:460 Threonyl-tRNA synthetase, mitochondrial  ali model follow..  16  2...GSSSSGLVPRGSHMASATKNASSTMTSMVSQRQDLFMTDPSPGSMFFLPNGAKIFNKLIEFMKLQQKKFGFNEVVTPLIYKKTLWEKSG-HWENYADDMFKVE--TTDEEKEEYGLKPMNCPGHCLIFGKKDRSYNELPLRFSDFSPLHRNEASGASGLTRLRKFHQDDGHIFC-TPSQVKSEIFNSLKLIDIVYNKIFPFVKGGGKPWKLNPGDGAFYGPKLDIMVTDHLRKTHQVATIQLDFQLPERFDLKFKDQDNSKRPIMIHRATFGSIERFMALLIDSNEGR----WPFWLNPYQAVIIPVNTKNVQQLDMCTALQKADDMEPVPLNDWHFNVDLDIRNE-PVGYRIKSAILKNYSYLIIVGDEEVQLQKYNIRERDNRKSEKLTMSQIWEKFIELEKNYK....................................................................................................... 454
20 -61.6001nyq_A mol:protein length:645 threonyl-tRNA synthetase 1  ali model follow..  15  206..RGDSNNKMLQRIYGTAFFDKKELERDHRKIGKELELFTNSQGAGLPLWLPNGATIRREIERYIVDKEVSMGYDHVYTPVLANVDLYKTSG-HWDHYQEDMFPPM---QLDETESMVLRPMNCPHHMMIYANKPHSYRELPIRIAELGTMHRYEASGASGLQRVRGMTLNDSHIFV-RPDQIKEEFKRVVNMIIDVYKDFGFEDYSFGLSYEEAIGEAAFYGPKLDVQVKTAMGKEETLSTAQLDFLLPERFDLTYIGQDGEHRPVVIHRGVVSTMERFVAFLTEETKGA----FPTWLAPKQVQIIPVN---------VDLHYDYARQLQDELKSQGVRVSIDDRNE-KMGYKIREAQMQKIPYQIVVGDKEVENNQVNVRQYGSQDQETVEKDEFIWNLVDEIRLKKHR..................................................................................................... 645
21 -57.6001qf6_A mol:protein length:642 THREONYL-TRNA SYNTHETASE  ali model follow..  18  207..RGDSNNKMLQRIYGTAWADKKALKRDHRKIGKQLDLYHMQEAPGMVFWHNDGWTIFRELEVFVRSKLKEYQYQEVKGPFMMDRVLWEKTG-HWDNYKDAMFTT-----SSENREYCIKPMNCPGHVQIFNQGLKSYRDLPLRMAEFGSCHRNEPSGSHGLMRVRGFTQDDAHIFC-TEEQIRDEVNGCIRLVYDMYSTFGFEKIVVKLSTRPEKGEGAFYGPKIEFTLYDCLDRAWQCGTVQLDFSLPSRLSASYVGEDNRKVPVMIHRAILGSMERFIGILTEEFAGF----FPTWLAPVQVVIMNIT----------DSQSEYVNELTQKLSNAGIRVKADLRNE-KIGFKIREHTLRRVPYMLVCGDKEVESGKVAVRTRRGKDLGSMDVNEVIEKLQQEIRSRSLKQLEE................................................................................................. 642
22 -47.9001b76_A mol:protein length:442 Glycine--tRNA ligase  ali model follow..  14  1.................AASSLDELVALCKRRGFIFQSSEIYGLQGVYDYGPLGVELKNNLKQAWWRRNERDDMEGLDASVLTHRLVLHYSG-HEATFADPMVDNAKARYGGRGLLAYLRPETAQGIFVNFKNVLDATSKLGFGIAQIGKAFRNEITPRNFIFRVREFEQMEIEYF-VRPGEDEYWHRYWVEERLKWWQEMGLSRENLVPYQQPPESSAHYAKATVDILYRLELEGIAQRTDFDLGSHTKDQEAAYRDPETGKWFVPYVIEPSAGVDRGVLALLAEAFTREE-LKLKPQLAPIKVAVIPL-------VKNRPEITEYAKRLKARLLALGLGRVLYEDTG-NIGKAYRRHDEVGTPFAVTVDYDTIGQSTVTVRDRDTMEQIRLHVDELEGFLRERLR.......................................................................................................... 441
23 -39.8002pme_A mol:protein length:693 Glycyl-tRNA synthetase  ali model follow..  13  46....ARKRVLEAKELALQPKDDIVDRAKMEDTLKRRFFY-YGGVSGLYDFGPVGCALKNNIIQTWRQHFQEEQILEIDCTMLTPEPVLKTSG-HVDKFADNLMFKTFIGPGGNMPGYLRPETAQGIFLNFKRLLEFNQGKLPFAAAQIGNSFRNEISPRSGLIRVREFTMAEIEHFVDPSEKDHPKFQNVADLHLYLYSAKAYKKDAKLVMEYLAICDECYITEMEMLLNEKGEFTIETEGKTFQLTKDMINVKRFQKTLYVEEVVPNVIEPSFGLGRIMYTVFEHTFHVREGFSFPAVVAPFKCSVLPLSQN--------QEFMPFVKELSEALTRHGVSHKVDDSSG-SIGRRYARTDEIGVAFGVTIDFDTVNKTTATLRDRDSMRQIRAEISELPSIVQDLANG--ADVEARYPLFEGQETGKKETIEELE.............................................................................. 687
24 -39.8002cim_A mol:protein length:522 SERYL-TRNA SYNTHETASE  ali model follow..  15  176.....GAKAEHWNLLWQREPMEHPFKEDPTQAMMKEGWLKRGSSRGQWIHGPQSARIFRTFEKIVLEELEPLGYREMIFPKLVTWEVWMKSGHAKGVYPEIYYVCPPQTRDPDEPIGGMCYAQCPPFWMYVAGETLPNEEIPVKVFDRGTSHRYESGGIHGIERVDEFHRIEIVWI-GTKEEVLKCAEELHDRYMHIFNDILDIEWRKARVTPWFMAQEGLLGLAEENTVGPDGEWLEFQNVSINGDKYPKGFNVKLQSGD----ELWSGCSGVGL-ERWAAVFLAQKGLDPA-NWP---EEFRNRVGEM........................................................................................................................................................................................................... 509
25 -38.4001ati_A mol:protein length:505 GLYCYL-TRNA SYNTHETASE  ali model follow..  13  1.....................AASSLDELVALCKRRGFI-YGGLQGVYDYGPLGVELKNNLKQAWWRRNERDDMEGLDASVLTHRLVLHYSG-HEATFADPMVDNRITKKGGRGLLAYLRPETAQGIFVNFKNVLDATSRLGFGIAQIGKAFRNEITPRNFIFRVREFEQMEIEYF-VRPGEDEYWHRYWVEERLKWWQEMGLSRENLVPYQQPPESSAHYAKATVDILYRFPHGSLELEGIFDLGSHTKDQEAAYRDPETGKWFVPYVIEPSAGVDRGVLALLAEAFTREE-LKLKPQLAPIKVAVIPL-------VKNRPEITEYAKRLKARLLALGLGRVLYEDTG-NIGKAYRRHDEVGTPFAVTVDYDTIGQSTVTVRDRDTMEQIRLHVDELEGFLRERLR.......................................................................................................... 504
26 -34.5003qne_A mol:protein length:485 Seryl-tRNA synthetase, cytoplasmic  ali model follow..  13  119..SQDEENNELVRTWTPENYKKPEQKLSHHEVLLRLDGYDPEVGHRGYFLRNYGVFLNQALINYGLSFLSSKGYVPLQAPVMMNKEVMAKTAQLSQFDEELYKVIDG------EDEKYLIATSEQPISAYHAGEWSPAEQLPVRYAGYSSCFRREAKDAWGIFRVHAFEKIEQFVL-TEPEKSWEEFDRMIGCSEEFYQSLGLPYRVVGIVSG-ELNNAAAKKYDLEAWFPFQQEYKELVSCSNCTDYQSRNLEIRCGQNQQEKKYVHCLNSTLSATERTICCILENYQKEDGLVIPEVLRKY---------------PGEPEFIPYIKELPKNTTSVKKAKGKNPK-NTTSVKKAKGKNGS....................................................................................................................................................... 478
27 -31.6005c51_B mol:protein length:485 DNA polymerase subunit gamma-2, mitochondrial  ali model follow..  45....KSHAELEGNGEHPEAPGSGEGSEALLEICQRRHFLSGSKQGCHPGFGPLGVELRKNLAAEWWTSVFREQVFPVDALHHKPGPLLPGDSAFRLVSAETLREILQDKENVLKTSGKLRENLLHGALEHYVNCLDLVNRLPYGLAQIGVCFHPVFDTKQIVKSIGEKTEASLVWF-TPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNKLYYNF--KELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQLTENLKLHPCLAPIKVALDVGRGPT-------LELRQVCQGLFNELLENGISVGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKN...................................................................................................... 484
28 -30.9002g4c_A mol:protein length:474 DNA polymerase gamma subunit 2  ali model follow..  28....KSHAELEGNGEHPEAPGSGEGSEALLEICQRRHFLSGSKSGCHPGFGPLGVELRKNLAAEWWTSVFREQVFPVDALHHKPGPLLPGDSAFRLVSAETLREILQDKENVLKTSGKLRENLLHGALEHYVNCLDLVNRLPYGLAQIGVCFHPVFDTKNGVKSIGEKTEASLVWF-TPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNKLYYNF--KELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQLTENLKLHPCLAPIKVALDVGRGPT-------LELRQVCQGLFNELLENGISVWPGETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKN...................................................................................................... 467
29 -30.5004ztu_B mol:protein length:472 DNA polymerase subunit gamma-2, mitochondrial  ali model follow..  21....KSHAELEGNGEHPEAPGSGEGSEALLEICQRRHFLSGSKSGCHPGFGPLGVELRKNLAAEWWTSVFREQVFPVDALHHKPGPLLPGDSAFRLVSAETLREILQDKENVLKTSGKLRENLLHGALEHYVNCLDVNKRLPYGLAQIGVCFHPVFDTKNGVKSIGEKTEASLVWF-TPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNKLYYNF--KELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQLTENLKLHPCLAPIKVALDVGRGPT-------LELRQVCQGLFNELLENGISVGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKN...................................................................................................... 460
30 -29.9004h2w_A mol:protein length:346 Amino acid--[acyl-carrier-protein] ligase 1  ali model follow..  13  10.....PRGSHMNIAVLPNSPDTAPQIADPLDHLADKLFHS-MGSDGVYARTALYESIVERLAALIT-SHREAGTEALRFPPVMSRAQLEKSG-YLKSFPNLLGCVCGLHGTEREADLVLSPAACYPVYPIAASRGPL-PKGGLRFDVAADCFRRE--PSKHLDRLQSFRMRE-YVCIGTPDDVSDFRERWMVRAQAIARDLGLTFRVDYAKMLANNQRDQQLKFELLIPLRSEEQPTACMSFNYHREHFGTTWGIQDAN----GEPAHTGCVAFGM-DRLAVAMFHTHGTDLS-AWPAKVRDI.................................................................................................................................................................................................................. 323
31 -29.2003mey_A mol:protein length:346 Bll0957 protein  ali model follow..  14  10....PRGSHMNIAVLPNSPDTAPQIADPLDHLADKLFH--SMGSDGVYARTALYESIVERLAALI-TSHREAGTEALRFPPVMSRAQLEKSG-YLKSFPNLLGCVCGLHGTEREADLVLSPAACYPVYPIAASRGPL-PKGGLRFDVAADCFRRE--PSKHLDRLQSFRMRE-YVCIGTPDDVSDFRERWMVRAQAIARDLGLTFRVDYAQMKAVSQKQQQLKFELLIPLRSEEQPTACMSFNYHREHFGTTWGIQDAN----GEPAHTGCVAFGM-DRLAVAMFHTHGTDLS-AWPAKVRDI.................................................................................................................................................................................................................. 323
32 -28.7001g5h_A mol:protein length:454 MITOCHONDRIAL DNA POLYMERASE ACCESSORY SUBUNIT  ali model follow..  10  3....SGYAGPADGTQQPDAPEHAVAREALVDLCRRRHFLSAALLSGCHAFGPLGVELRKNLASQWWSSMVVFREQVFAVDSLHQEPGSSQPRDSAFRLVSPESIREILQDNLLKTSGKLRATLLHGALEHYVNCLDLVNKLPFGLAQIGVCFHNSNQTPSSVTRVGEKTEASLVWF-TPTRTSSQWLDFWLRHRLLWWRKFAMSPSNFSSADCQDELGRKGSKLYYSFWGKEPIETLWNLGDQELLHTYPGNVSTIQGRDGRKNVVPCVLSVSGDVDLGTLAYLYDSFQLAENLKLHPCLAPIKVALDVGKGPT-------VELRQVCQGLLNELLENGISVWYSETVHSSLEQLHSKYDEMSVLFSVLVTETTLENGLIQLRSRDTTMKEMMHISKLRDFLVKYLASASN...................................................................................................... 442
33 -26.6003ikl_A mol:protein length:459 DNA polymerase subunit gamma-2, mitochondrial  ali model follow..  10  59....APGSGEGSEALLEICQRRHFLSGSKQQLSRDSLLSGCHPGFG-----PLGVELRKNLAAEWWTSVVVFREQVFPVDALHHKP-------------------GPLLPGDSAFRGGLRENLLHGALEHYVNCLDLVNRLPYGLAQIGVCFHPVFDTKQIVKSIGEKTEASLVWF-TPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNKLYYNF--KELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQLTENLKLHPCLAPIKVALDVGRGPT-------LELRQVCQGLFNELLENGISVWPGETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKN...................................................................................................... 452
34 -24.2001wu7_A mol:protein length:434 Histidyl-tRNA synthetase  ali model follow..  13  4......................................LQIEKIRGFRDFYPEDMDVEKFIFKTAEEAAEAFGFRRIDFPSLEYLDLYRIKSG-EELLQQTYSFVDKGG-----REVTLIPEATPSTVRMVTS--RKDLQRPLRWYSFPKVWRYE-EPQAG--RYREHYQFNADIFGSDSPEADAE---VIALASSILDRLGLGIDEMARITGKSSEEIARMAAVEDLLASYGVKNVRYDFSIVRGLSYYTGIVFEAYDRSGQFRAILGGGRYDNLASLMSGESVPAVGFGMGDAVISLLLKRENVQIPREKKSVYICRVGKINSSIMNEYSRKLRERGMNVTVE--MERGLSAQLKYASAIGADFAVIFGERDLERGVVTIRNMYTGSQENVGLDSVVEHLISQATL......................................................................................................... 427
35 -24.2003w3s_A mol:protein length:527 Type-2 serine--tRNA ligase  ali model follow..  19  185.................SGPRRIRFRGDVTEEARRRGWVKEFPGRGQWIYTPPMAALFEVLRDFLLERVRKLGFEPALFPKLIPLETMFRMR-YLHGLPDGMYYVCPPKRDPEDPGYVLAPAQCEPFYELLRDEVVDPERLPIKLYDCGWTYRWEGGAAKGLERVNEFQRIE-HVWIAEPEEAYRIRRELLEATKRVAEELELEWKVVVSDEDRDIELPDVPSYEFEVYLPSEEAWISVGSFNVHGEHFVDGFNV----KEKSGRTLFTGCAGLGV-TRWVVGLLAQHGFYPY-EWPEPI..................................................................................................................................................................................................................... 505
36 -24.1003vbb_A mol:protein length:522 Seryl-tRNA synthetase, cytoplasmic  ali model follow..  13  143VPISNDEDVDNKVERI-WGDCTVRKKYSHVDLVVMVDGFEGEVVAGGYFLKGVLVFLEQALIQYALRTLGSRGYIPIYTPFFMRKEVMQEVAQLSQFDEELYKVIGKGSEKSSYDEKYLIATSEQPIAALHRDEWLRPEDLPIKYAGLSTCFRQEVRDTRGIFRVHQFEKIEQFVYSSHDNKSWEMFEEMITTAEEFYQSLGIPYHIVNIVSG-SLNHAASKKLDLEAWFPGSGAFRELVSCSNCTDYQARRLRIRYGQTKKMMDKVEFVHMLNATTTRTICAILENYQTEKGITVPEKLKEFLQELIPSKKQKKQHEGSKKKAAARDVTLENRLQNMEVTDALE........................................................................................................................................................................ 516
37 -23.9005e3i_A mol:protein length:438 Histidine--tRNA ligase  ali model follow..  13  1...................................MAMSSIVAIKGFNDVLPTQTAAWRRLEQHLASLMDAYGYQQIRLPIVEQTGLFKRAGDATDIVEKEMYTFFDKGNP--PESLTLRPEGTAGCVRALVEH-NLLRGATPRVWYMGPMFRYE-KPQKG--RYRQFHQFGVETFGVATPDIDAE---LIMLTARLWKRMGVDHMVTDERTEYRNALVAFLNEHKDALDEDSQRRLTTNPLRILDSKIESTQKIDFLKEDSLSHFQQLQDYALGSQGTVCA-LVGQLKGKADQSVP---MGMERLLLLLEQVEQAEIVREPAYQSKALVLAEQLRDQLEAANSNIRSQGSMKSQMKKADQAGAVYAIILGEREWEAQQLAVKELATAEQSQVALAELVPFLIEKFTK......................................................................................................... 432
38 -23.9001qe0_A mol:protein length:420 Histidine--tRNA ligase  ali model follow..  12  3.........................................KIPRGTQDILPEDSKKWRYIENQLDELMTFYNYKEIRTPIFESTDLFARGGDSTDVVQKEMYTFKDKG----DRSITLRPEGTAAVVRSYEHKMQGNPNQPIKLYYNGPMFRYE-RKQKG--RYRQFNQFGVEAIGAENPSVDAE---VLAMVMHIYQSFGLKHLKLVINSDFLNEESKAYYEQVKAYLDDLGIPYTEDPNLVRGLDYYTHTAFELMMDNPNYDGAITTLCGGGRYNGLLELLDGPSETGIGFALLDIEENLDLFIVTMG----------DQADRYAVKLLNHLRHNGIKADKD--LQRKIKGQMKQADRLGAKFTIVIGDQELENNKIDVKNMTTGESETIELDALVEYFKK............................................................................................................. 420
39 -23.3005c53_B mol:protein length:903 Pol gamma B  ali model follow..  506GEHPEAPGSGEGSEALLEICQRRHFLSGSKQQLSRDSLLSGCHPG----FGPLGVELRKNLAAEWWTSVVVFREQVFPVDALHHKP---------------------GPLLPGDSAFRLRENLLHGALEHYVNCLDLVNRLPYGLAQIGVCFHPVFDTKQGVKSIGEKTEASLVWF-TPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNKLYYNFWGKELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQLTENLKLHPCLAPIKVALDVG-------RGPTLELRQVCQGLFNELLENGISVWPGETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKN...................................................................................................... 902
40 -23.2001ser_A mol:protein length:421 PROTEIN (SERYL-TRNA SYNTHETASE (E.C.6.1.1.11))  ali model follow..  14  109APVGGEEANREIKRVG---PPEFSFPPLDHVALMEKNGWWEPRISRSYALKGDLALYELALLRFAMDFMARRGFLPMTLPSYAREKAFLGTGHFPAYRDQVWAI--------AETDLYLTGTAEVVLNALHSGEILPYEALPLRYAGYAPAFRSEAKDVRGLMRVHQFHKVEQYVLTESLEASDRAFQELLENAEEILRLLELPYRLVEVATG-DMGPGKWRQVDIEVYLPSEGRYRETHSCSALLDWQARRANLRYRDPEGRVRYAYTLNNTALATPRILAMLLENHQLQDGVRVPQALIPY.................................................................................................................................................................................................................. 411
41 -23.1002dq3_A mol:protein length:425 Seryl-tRNA synthetase  ali model follow..  15  113VPVGEDEKDNVEVRRWGEPRKFDFEPKPHWEIGERLGILDFKRGSRFTVIAGWGARLERALINFMLDLHTKKGYKEICPPHLVKPEILIGTGQLPKFEEDLYKC--------ERDNLYLIPTAEVPLTNLYREEILKEENLPIYLTAYTPCYRREAKDIRGIIRQHQFDKVELVKI-VHPDTSYDELEKLVKDAEEVLQLLGLPYRVVELCTG-DLGFSAAKTYDIEVWFPSQNKYREISSCSNCEDFQARRMNTRFKDSKTGKNRFVHTLNGSGLAGRTLAAILENYQQEDGVVVPEVLRDY.................................................................................................................................................................................................................. 416
42 -23.1003hrk_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  13  1..................MAMGTLEAQTQGPGSMQKNMVETEPVQGCRDFPPEAMRCRRHLFDVFHATAKTFGFEEYDAPVLESEELYIRKAG-EEITEQMFNFITKGG-----HRVALRPEMTPSLARLLLGKGRSLL-LPAKWYSIPQCWRYE-AITRG--RRREHYQWNMDIVGVKSVSAEVE---LVCAACWAMRSLGLSLSLKSIDEIAQRVGEEHEAVKELRQFFEQVEAYGYGDWVLFDASVVRGLAYNLLTTYGSPTPIPCAGFGFGD-CVIVELL------QEKRLLPDIPHVVDDVVIPFD----------ESMRPHALAVLRRLRDAGRSADII--DKKKVVQAFNYADRVGAVRAVLVAPEEWERGEVQVKMLREGTGKEEGGAERGFAVPL............................................................................................................. 446
43 -22.9004g85_A mol:protein length:517 Histidine-tRNA ligase, cytoplasmic  ali model follow..  13  25..QGERVRGLKQQKASAELIEEEVAKLLKLKAQLGPD-FVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYG--EDSKLIYDLKDQGG-----ELLSLRY-----LTVPFARYLAMNKLTNIKRYHIAKVYRRD-NPAMTRGRYREFYQCDFDIAGNFDPMIPD--AECLKIMCEILSSLQIGDFLVKVNDRRILDGMFAICGVSDSKFRTICSSVDKLDKV-LDYYTGVIYEAVLLQTPAQAGEEPLGVGSVGRYDGLVGMFDPKGRKVPCVGLSIGVERIFSIVEQRLEALEEKIRTTKKLLEERLKLVSELWDAGIKAELLYKKNPKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRSVTSREEVDVRREDLVEEIKRRTGQ......................................................................................................... 515
44 -22.8004rdx_A mol:protein length:423 Histidine--tRNA ligase  ali model follow..  14  1....................................GPMTARAVRGTKDLFGKELRMHQRIVATARKVLEAAGALELVTPIFEETQVFEKGGAATDIVRKEMFTFQDRG----GRSLTLRPEGTAAMVRAYLEHGMKVWPQPVRLWMAGPMFRAE-RPQKG--RYRQFHQVNYEALGSENPILDAE---AVVLLYECLKELGLRRLKVKLSSVGDPEDRARYNAYLREVLSPHREALSEDSKERLELNPMRILDLDFLGEEARAHLKEVERHEIGAQSALGG-LSELLGGPRVPGVGFAFGVERVALALEAEGFGLPEEKGEEAVAEAFYLAEALRP-RLRAEYA--APRKPAKGLEEALKRGAAFAGFLGEDELRAGEVTLKRLATGEQVRLSREEVPGYLLQALG.......................................................................................................... 423
45 -22.8001wle_A mol:protein length:501 Seryl-tRNA synthetase  ali model follow..  16  155VPVGDESQARVLHVVG-DKPAFSFQPRGHLEIAEKLDIIRQKHVSGSYYLRGAGALLQHGLVNFTLNKLIHRGFTPMTVPDLLRGVVFEGCGMTPNAKPSQIYNID----PSRFEDLNLAGTAEVGLAGYFMDHSVAFRDLPIRMVCSSTCYRAETKEPWGLYRVHHFTKVEMFGVTGGLEQSSELLEEFLSLQMEILTELGLHFRVLDMPTQ-ELGLPAYRKFDIEAWMPGRGRFGEVTSASNCTDFQSRRLHIMFQTEAGELQFAHTVNATGCAVPRLLIALLESYQQKDGVLVPPALQPY.................................................................................................................................................................................................................. 461
46 -22.6004g84_A mol:protein length:464 Histidine--tRNA ligase, cytoplasmic  ali model follow..  12  12......................................FVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYG--EDSKLIYDLKDQGG-----ELLSLRY-----LTVPFARYLAMNKLTNIKRYHIAKVYRRD-NPAMTRGRYREFYQCDFDIAGNFDPMIPD--AECLKIMCEILSSLQIGDFLVKVNDRRILDGMFAICGVSDSKFRTICSSVDKLDKV-LDYYTGVIYEAVLLQTPAQAGEEPLGVGSVGRYDGLVGMFDPKGRKVPCVGLSIGVERIFSIVEQRLEALEEKIRTTKKLLEERLKLVSELWDAGIKAELLYKKNPKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRSVTSREEVDVRREDLVEEIKRRTGQ......................................................................................................... 462
47 -22.6003hri_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  14  1..................MAMGTLEAQTQGPGSMQMNMVETEPVQGCRDFPPETMRLRKYLFDVFHSTARKFGFEEYDSPVLESEELYIRKAG-EEITEQMFNFITKGG-----HRVALRPEMTPSLARQLLAKGRSLL-LPAKWYSIPQCWRYE-AITRG--RRREHYQWNMDIIGVKSVSSEVE---LVCAACTAMQSLGLSSKDVGVKINSRK-GEEHEAVRELRDFITQIEAYGFGDWVIFDASVVRGLAYNLLTTYGSPTAVPCVGFGFGD-CVIVELL------NEKKLLPELHHVVDDLVIPFD----------ETMRPHALSILRRLRDAGRSADIV--DKKKVVQAFNYADRIGALRAVLVAPDEWARGEVRVKMLREGAGREEGANERGIVLPV............................................................................................................. 446
48 -22.4003err_A mol:protein length:536 fusion protein of microtubule binding domain from mouse cytoplasmic dynein and seryl-tRNA synthetase from Thermus thermophilus  ali model follow..  14  218APVGGEEANREIKRVGGPPEFSFPPLD-HVALMEKNGWWEPRISSRSYALKGDLALYELALLRFAMDFMARRGFLPMTLPSYAREKAFLGTGHFPAYRDQVWAI--------AETDLYLTGTAEVVLNALHSGEILPYEALPLRYAGYAPAFRSEAKDVRGLMRVHQFHKVEQYVLTESLEASDRAFQELLENAEEILRLLELPYRLVEVATG-DMGPGKWRQVDIEVYLPSEGRYRETHSCSALLDWQARRANLRYRDPEGRVRYAYTLNNTALATPRILAMLLENHQLQDGVRVPQALIPY.................................................................................................................................................................................................................. 520
49 -22.3003lsq_A mol:protein length:484 Seryl-tRNA synthetase  ali model follow..  12  149VPIAQDEETGNTVVRTFGNTTKRAKLNHVSIMERLGMMDTSKSMAGSYVLKGGLVQLQVALVSYSLDFLVKRGYTPFYPPFFLNRDVMGEVAQLSQFDEELYQV------SGDGDKKYLIATSEMPIAAYHRGRWFTELKEPLKYAGMSTCFRKEARDTLGIFRVHQFDKIEQFVVCSRQEESWRHLEDMITTSEEFNKSLGLPYRVVNICSG-ALNNAAAKKYDLEAWFPASGAFRELVSCSNCTDYQSQSVNCRYGPNLRGNVKEYCHMLN--AITRTMCCICENYQTEEGVVIPDVLRPY.................................................................................................................................................................................................................. 460
50 -22.0003net_A mol:protein length:465 Histidyl-tRNA synthetase  ali model follow..  13  1.............................SNAMAKNDKINFSTPSGFPEFLPSEKRLELYLLDTIRRVYESYGFTPIETPAVERLEVLQAKGNQGDNLPPNRQAEKDKSGDTGSEARALKFDQTVPLAAYIARHLNDLT-FPFARYQMDVVFRGE-RAKDG--RFRQFRQCDIDVVGREKLSLLYDA-QMPAIITEIFEAVNIGDFVIRINNSEQFNLGVSELETVNLGVPDKRFCIDLAIARGLNYYTGTVYETTLIGHEALGSICSGGRYGVGISTRLISRL-----LKAGILNTLPPTPAQVVVVNMQ----------DELMPTYLKVSQQLRQAGLNVITN--EKRQLGKQFQAADKQGIRFCVIIGADEAAAQKSSLKDLQSGEQVEVALADLAEEIKRRLT.......................................................................................................... 465
51 -21.4002dq0_A mol:protein length:455 Seryl-tRNA synthetase  ali model follow..  16  160..........................KLHVDLLEILGGADFARASRFYYLLNEIVILDLALIRFALDRLIEKGFTPVIPPYMVRRFVEEGSTSFEDFEDVIYKV--------EDEDLYLIPTAEHPLAGMHANEILDGKDLPLLYVGVSPCFRKEAKDTKGIFRVHQFHKVEQFVY-SRPEESWEWHEKIIRNAEELFQELEIPYRVVNICTG-DLGYVAAKKYDIEAWMPGQGKFREVVSASNCTDWQARRLNIRFRDRTDEKPRYVHTLNSTAIASRAIVAILENHQEEDGVRIPKVLWKY.................................................................................................................................................................................................................. 437
52 -21.1004e51_A mol:protein length:467 Histidine--tRNA ligase  ali model follow..  12  5...................TLEAQTQGPGSMTEQKRKLEKLTGVKGMNDILPQDAGLWEFFEATVKSLLRAYGYQNIRTPIVEHTPLFTRGIGEVTD-KEMYSFVDALN----GENLTLRPENTAAVVRAAIEH-NMLYDGPKRLWYIGPMFRHE-RPQRG--RYRQFHQVGVEALGFAGPDADAE---IVMMCQRLWEDLGLTGIKLEINSLGLAEERAAHRVELIKYLEQHADKLDDDAQRRLYTNPLRVLDTKFLGDVSRAHFEGLQRL--PLIEQLGGKPTAACGWAMGIERILELLKEEHLVPEQEGVDVYVVHQGDAAREQAFIVAERLRDTGLDVILADGAGASFKSQMKRADASGAAFAVIFGEDEVTNGTASVKPGEKSVQQSVPVESLTEFLINAMVATAED..................................................................................................... 458
53 -20.8006blj_A mol:protein length:485 Serine-tRNA ligase  ali model follow..  13  154VSDNEDNNGIVRMVGNPRPKVDPETGLKHIDIMRKLGGLATEQVGGGYFLLGDLVRMNLALQNYAIDFLAKKGYMPIYTPFFMTKEQMKKVAQLSQFDEELYTVTGE------GEDKYLIATSEQPIAAFHLEKRFDESELPIKYCGMSTCFRKEVKDTLGIFRVHQFEKIEQFVVTSKDNKSWEMFDEMIGNSEAFYQSLGIPYRVVNIVSG-ALNNAAAKKFDLEAWFPGADEG-ELVSCSNCTDYQTRRLEVKYKKQGSEVEFCHMLNSTLTATSRTLCCIVENYQTPEGVNVPEVLQPY.................................................................................................................................................................................................................. 468
54 -20.6002el9_A mol:protein length:431 Histidyl-tRNA synthetase  ali model follow..  12  11.......................................NIQAIRGMNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAGEVTDVVEKEMYTFEDRN----GDSLTLRPEGTAGCVRAGIEH-GLLYNQEQRLWYIGPMFRHE-RPQKG--RYRQFHQLGCEVFGLQGPDIDAE---LIMLTARWWRALGISHVTLELNSIGSLEARANYRDALVAFLEQHKEKLDEDCKRRMYTNPLRVLDGDYLDEESREHFAGLCKLSLGSQGTVCA-LVEQLGGRAAVGFAMGLERLVLLVQAVNPEFKADPVVDADTQSAAMALAERLRDELPGVKLMNHGGGNFKKQFARADKWGARVAVVLGESEVANGTAVVKDLRSGEQTAVAQDSVAAHLRTLLG.......................................................................................................... 431
55 -20.1001v95_A mol:protein length:130 Nuclear receptor coactivator 5  ali model follow..  8.............................................................................................................................................................................................................................................................................................................PVDCSVIVV----------NKQTKDYAESVGRKVRDLGMVVDLI-NTEVSLSQALEDVSRGGSPFAIVITQQHQIHRSCTVNIMFGTEHRNMPQADAMVLVARNYERYKNECREKERE.............................................................................................. 118
56 -19.1004cs2_A mol:protein length:274 PYRROLYSINE--TRNA LIGASE  ali model follow..  5......TKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEEREYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDT-------ELSKQIFRVDKNFCLRPMLAPNLANYLRKLDRALPD-PIKIFEIGPCYRKESDGKE---HLEEFTMLNFCQM-----GSGCTRENLESIITDFLNHLGIDFKIV................................................................................................................................................................................................................................................................................................................. 191
57 -19.0005k1p_A mol:protein length:274 Pyrrolysine--tRNA ligase  ali model follow..  10  5......TKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEEREYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDT-------ELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPD-PIKIFEIGPCYRKESDGKE---HLEEFTMLAFAQM-----GSGCTRENLESIITDFLNHLGIDFKIV................................................................................................................................................................................................................................................................................................................. 191
58 -18.1002lw7_A mol:protein length:170 Histidine--tRNA ligase, cytoplasmic  ali model follow..  13  43................................................................................................................................................................................................................................................................................QLGPDESKQKFVLKT---PKALEEKIRTTETQVLVASAQ----------KKLLEERLKLVSELQDAGIKAELLYKKNPKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRSVTSREEVDVRREDLVEEIKRRTGQ......................................................................................................... 165
59 -18.1004q6g_A mol:protein length:267 Pyrrolysine--tRNA ligase  ali model follow..  4......TKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEEREYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDT-------ELSKQIFRVDKNFCLRPMVAPNIFNYARKLDRALPD-PIKIFEIGPCYRKESDGKE---HLEEFTMLNFFQM-----GSGCTRENLESIITDFLNHLGIDFKIV................................................................................................................................................................................................................................................................................................................. 190
60 -17.8004bw9_A mol:protein length:291 PYRROLYSINE--TRNA LIGASE  ali model follow..  18..APALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEEREYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDT-------ELSKQIFRVDKNFCLRPMLAPNLGNYLRKLDRALPD-PIKIFEIGPCYRKESDGKE---HLEEFTMLNFCQM-----GSGCTRENLESIITDFLNHLGIDFKIV................................................................................................................................................................................................................................................................................................................. 208
61 -17.7002zni_A mol:protein length:308 Pyrrolysyl-tRNA synthetase  ali model follow..  12  37.....KELNASGEQLEMGFSDALSRDRAFQGIEHQLMSQGKRHLE--QLRTVKHRPALLELEEKLAKALHQQGFVQVVTPTIITKSALAKMTIGEDH---------FSQVFWLDGKKCLRPMLAPNLYTLWRELERLWDK-PIRIFEIGTCYRKESQGAQ---HLNEFTMLNLTELGTPLEERHQRLEDMAR---WVLEAAGIREFELVTES............................................................................................................................................................................................................................................................................................................. 227
62 -17.7003qtc_A mol:protein length:290 Pyrrolysyl-tRNA synthetase  ali model follow..  10  6VPRGSHTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEEREYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDT-------ELSKQIFRVDKNFCLRPMLTPNLYNYLRKLDRALPD-PIKIFEIGPCYRKESDGKE---HLEEFTMLVFWQM-----GSGCTRENLESIITDFLNHLGIDFKIV................................................................................................................................................................................................................................................................................................................. 205
63 -16.1002e3c_A mol:protein length:291 Pyrrolysyl-tRNA synthetase  ali model follow..  10  24.SQTDRLEVLLNPKDEISLNSGKPFRELESELLSRR------------IYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDT---------SKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPD-PIKIFEIGPCYRKESDGKE---HLEEFTMLNFCQM-----GSGCTRENLESIITDFLNHLGIDFKIVGDSC............................................................................................................................................................................................................................................................................................................. 212
64 -16.0003od1_A mol:protein length:400 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  10  8......................................FMFEKPFGMRDTLPEWYKTKKNICDQMTEEINLWGYDMIETPTLEYYETVGVVSAILD--QQLFKLLDQQG-----NTLVLRPDMTAPIARLVASSLKD-RAYPLRLAYQSNVYRAQQNEG----KPAEFEQLGVELIGDGTASADGE---VIALMIAALKRAGLSEFKVAIGHVGYVNALLMDVVGNEQRADRLRRFLYEKNYVGYREHVKSL--YEVLESYGASEYVKFDLTLVLHMSYYTGVVFEGYGNRSGGRYDELLSKFDLLVEALNGEIISNGHESNERRFEAIELARKKRANGEAVVLQDLAG-VTDVDAMSSNYQDVIYCIGTAGRGGEDA....................................................................................................................................... 400
65 -14.8004tqd_A mol:protein length:291 Pyrrolysine--tRNA ligase  ali model follow..  10  24.SQTDRLEVLLNPKDEISLNSGKPFRELESELLSRR------------IYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDT---------SKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPD-PIKIFEIGPCYRKESDGKE---HLEEFTMLSFIQMGSG-----CTRENLESIITDFLNHLGIDFKIVGDSC............................................................................................................................................................................................................................................................................................................. 212
66 -14.5003rac_A mol:protein length:373 Histidine-tRNA ligase  ali model follow..  10  1..................SNAMNGTRSAWGARAWEAVRGFADRPPGMQDGYPDFAKRRRAVETRLLSFVEDAGYEPVTSGLFEYVDTLLRARS-PESSRDWIRLFDGGG-----DAVALRPEMTPSIARMAAPRVAA-GRTPIRWCYCERVYRRTLSWASG--KAAESTQVGIERIGEEASVDVD--MDVLRLLHEASAAAGVRHHRIV--------------------VSHARLVPRLLDALGISASLSRAFLACLTSGNYVQFRELWQLHAAKDVDLLANLLTWSPAERDAAKRSREASDRELEALLRDAVDPRAAADVRDAWRYLCRLAEALHDSGLVVTFDLA-DYYTGLVF-EMFAPGVGAPIAQGGR-------ELLAQFGAGAPAVGFAFEVERVMAVLEAQEE...................................................................................................... 368
67 -12.0006FTT Entity 1(prereleased)  ali follow..  10  5............................................DGVADVLFEDAHKQEVLRHQLTQQLITHGYQLVSPPMIEFTESLLSGAS-EDLKRQTFKIIDQLT----GRLMGIRA---DITPQILRIDAHHGGDGIARYCYAGDVIHTLPSGLF---GSRTPLQLGAEIFGCESIAADIE---LIDVLFSMINSLDMS--------------------VLHVDLGHVTIFKRLAELAALSASDTEQLMQLYANKNLPELKQVCQVLPMGSDFYTLARFGHDIAN----------------LLGRLSENAQQDTKIVTAIDELQRLKAHLQVQWCAVSIDVTEHYHTGIVF-NGYINSETQPLVRGGR---DGMKSNQLATNQPRQATGFSMDVSRLLAHTQLDAPFIVLIDYDAFNNDSAQRQLLLQQVASLRQQGYRVTMPLTAEDMPVGLTHRLS.................................................. 377
68 -12.0005m8h_A mol:protein length:388 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  10  5............................................DGVADVLFEDAHKQEVLRHQLTQQLITHGYQLVSPPMIEFTESLLSGAS-EDLKRQTFKIIDQLT----GRLMGIRA---DITPQILRIDAHHGGDGIARYCYAGDVIHTLPSGLF---GSRTPLQLGAEIFGCESIAADIE---LIDVLFSMINSLDMS--------------------VLHVDLGHVTIFKRLAELAALSASDTEQLMQLYANKNLPELKQVCQVLPMGSDFYTLARFGHDIAN----------------LLGRLSENAQQDTKIVTAIDELQRLKAHLQVQWCAVSIDVTEHYHTGIVF-NGYINSETQPLVRGGR---DGMKSNQLATNQPRQATGFSMDVSRLLAHTQLDAPFIVLIDYDAFNNDSAQRQLLLQQVASLRQQGYRVTMPLTAEDMPVGLTHRLS.................................................. 377
69 -11.7001z7m_A mol:protein length:344 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  12  10..................................RMEKINYLLPEESAEMTLNQVKSLRQIEGRLRKLFSLKNYQEVMPPSFEYTQLYTALESNGKTFEKMFQFIKHEG-----QSITLRY---DFTLPLVRLYSQIKDSTSARYSYFGKIFRKEKRHK----RSTENYQIGIELFGESADKSELE---ILSLALQVIEQLGLNKTVFEIGS--------------------------FQRLCQLADGSTELLTELLLKKDLSGLNAFIEKNNFSKELRGLLKEIFITNE-------------------SRLENLVTNTKDDVLISSFDQLKEFSEKLSMIKPIIIDLGMVPKMDYYKAYSSAANQPILSGGR-------QLLSNFQEEAFAIGFCCHMDTILKALER......................................................................................................... 330
70 -9.4403g1z_A mol:protein length:326 Putative lysyl-tRNA synthetase  ali model follow..  12  17......................................................LLKRAAIMAEIRRFFADRGVLEVETPCMSQATV--------DIHLFPFETRFVGPGHSQGINLYLMTSPEYHMKRLLAAGCG-------PVFQLCRSFRNE---EMGRHHNPEFTMLEWYRPHYDMYRLMNEVDDLLQQVLDC-QPAESLSYQQAFQRHLEIDPLSADKTQLREAAAKLDLSNIADTEEDRDTLLQLLFTMGVEPHIGKEKPTFIYHF-----PASQASLAQISTED-----HRVAERFEVYYIELANGFHELTDAREQQQRFEQDNRKRAARGLPQQPIDQ--------NLLDALAAGLPVMLALGAESLAD........................................................................................................................................ 317
71 -9.2503a5y_A mol:protein length:345 Putative lysyl-tRNA synthetase  ali model follow..  10  2...GSSSSGLVPRGSHMSETASWQPSASIPNLLKRAAIMAE-----------------------IRRFFADRGVLEVETPCMSQATVTDIH-------LVPFETRFVGPGHSQGMNLWLMTSPEYHMKRLLVAGCG-------PVFQLCRSFRNE---EMGRYHNPEFTMLEWYRPHYDMYRLMNEVDDLLQQVLDCPAAESLSYQQAFLRYLEID---SADKTQLREVAAKLDLSNVADTEEDRDTLLQLLFTFGVEPNIGKEKPTFVYHF-----PASQASLAQISTED-----HRVAERFEVYYIELANGFHELTDAREQQQRFEQDNRKRAARGLPQHPIDQN--------LIEALKVGMPVMLALGAETLAE........................................................................................................................................ 330

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 7 6 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Awobuluyi M, Yang J, Ye Y, Chatterton JE, Godzik A, Lipton SA, Zhang D. Subunit-specific roles of glycine-binding domains in activation of NR1/NR3N-methyl-D-aspartate receptors. Mol Pharmacol. 2007 Jan;71(1):112-22. Epub 2006 Oct 17.