current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 4jbj_A mol:protein length:198 Interferon-activable protein 202, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .
# Score Template Links and tools%idFirst MTPKKNISKGAVLHEKPMTVMVLTATEPFNYKEGKENMFHATVATESQYYRVKVFNMDLKEKFTENKFITISKYFNSSGILEINETATVSEAAPNQMFEVPKNIIRSAKETLKISKIKELDSGTLIYGVFAVEKKKVNDKSITFKIKDNEDNIKVVWDKEQHNINYEKGDKLQLFSFHLRKGNGKPILHSGNHSFIKGLast
1 -101.0004jbj_A mol:protein length:198 Interferon-activable protein 202  ali model  100  1MTPKKNISKGAVLHEKPMTVMVLTATEPFNYKEGKENMFHATVATESQYYRVKVFNMDLKEKFTENKFITISKYFNSSGILEINETATVSEAAPNQMFEVPKNIIRSAKETLKISKIKELDSGTLIYGVFAVEKKKVNDKSITFKIKDNEDNIKVVWDKEQHNINYEKGDKLQLFSFHLRKGNGKPILHSGNHSFIKG 198
2 -95.8004l5q_A mol:protein length:199 Interferon-activable protein 202  ali model follow..  98  2.TPKKNISKGAVLHEKPMTVMVLTATEPFNYKEGKENMFHATVATESKYYRVKVFNMDLKEKFTENQFITISKYFNSSGILEINETATVSEAAPNQMFEVPKNIIRSAKETLKISKIKELDSGTLIYGVFAVEKKKVNDKSITFKIKDNEDNIKVVWDKEQHNINYEKGDKLQLFSFHLRKGNGKPILHSGNHSFIK. 197
3 -93.2004lnq_A mol:protein length:197 Interferon-activable protein 202  ali model follow..  98  3......HMKGAVLHEKPMTVMVLTATEPFNYKEGKENMFHATVATESKYYRVKVFNMDLKEKFTENKFITISKYFNSSGILEINETATVSEAAPNQMFEVPKNIIRSAKETLKISKIKELDSGTLIYGVFAVEKKKVNDKSITFKIKDNEDNIKVVWDKEQHNINYEKGDKLQLFSFHLRKGNGKPILHSGNHSFIK. 193
4 -78.5004l5t_A mol:protein length:203 Interferon-activable protein 202  ali model follow..  31  2.KLLKESFEGDGYHKGPKQVVALKATKLFTYDSIKSKMFHATVATDTEFFRVMVFEENLEKKFIPGNTIALSDYFGMYGSLAIHEYSSVSEVKSQN-KEDSSSSDERPIEHLKICDLHLQTEERLVDGEFKVYRKSSGNNCICYGIWDDTGAMKVVVSGQLTSVNCEIGNTIRLVCFELTSNADEWFLRATRYSYME. 197
5 -77.6003rlo_A mol:protein length:204 Gamma-interferon-inducible protein 16  ali model follow..  41  1......GSVDDSAQSDLKEVMVLNATESFVYEPKEKKMFHATVATENEVFRVKVFNIDLKEKFTPKKIIAIANYVCRNGFLEVYPFTLVADVNADRNMEIPKGLIRSASVTPKINQLCSQTKGSFVNGVFEVHKKNVRGEFTYYEIQDNTGKMEVVVHGRLTTINCEEGDKLKLTCFELAPKSNTGELRSVIHSHIK. 193
6 -77.6003rln_A mol:protein length:200 Gamma-interferon-inducible protein 16  ali model follow..  39  1......GSVDDSAQSDLKEVMVLNATESFVYEPKEKKMFHATVATENEVFRVKVFNIDLKEKFTPKKIIAIANYVCRNGFLEVYPFTLVADVNADRNMEIPAGLIASASVTPKINQLCSQTKGSFVNGVFEVHKKNVRGEFTYYEIQDATGKMEVVVHGRLTTINCEEGDKLKLTCFELAPKSNTGELRSVIHSHIK. 193
7 -75.6003rn2_A mol:protein length:208 Interferon-inducible protein AIM2  ali model follow..  40  1...GSVDSIREGFQKRCLPVMVLKAKKPFTFEEGKQEMFHATVATEKEFFFVKVFNTLLKDKFIPKRIIIIARYYRHSGFLEVNSASRVLDAESDQKVNVPLNIIRKAGETPKINTLQTQPLGTIVNGLFVVQKVTEKKKNILFDLSDNTGKMEVLGVRNEDTMKCKEGDKVRLTFFTLSKNGEKLQLTSGVHSTIK. 196
8 -72.6002oq0_A mol:protein length:206 Gamma-interferon-inducible protein Ifi-16  ali model follow..  48  2.SHMQVTPRRNVLQKRPVIVKVLSTTKPFEYEMEKKIMFHATVATQTQFFHVKVLNTSLKEKFNGKKIIIISDYLEYDSLLEVNEESTVSEAGPNQTFEVPNKIINRAKETLKIDILHKQASGNIVYGVFMLHKKTVNQKTTIYEIQDDRGKMDVVGTGQCHNIPCEEGDKLQLFCFRLRKKNQMSKLISEMHSFIQ. 200
9 -68.1004jbm_A mol:protein length:193 Interferon-inducible protein AIM2  ali model follow..  35  1..............MDPLVVTVLKAINPFECETGRQEIFHATVATETDFFFVKVLNAQFKDKFIPKRTIKISNYLWHSNFMEVTSSSVVVDVESNH--EVPNNVVKRARETPRISKLKIQPCGTIVNGLFKVQKITEEKDRVLYGIHDKTGTMEVLVLGNPSKTKCEEGDKIRLTFFEVSKNGVKIQLKSGPCSFFK. 183
10 -24.5002kbn_A mol:protein length:109 Conserved protein  ali model follow..  17  3............................................................................................................PQLTKIVDIVENGQWANLKAK-QLWENTHESISQVGLLGDETGIIKFTIWKNAELPLLEQGESYLLRSVVVGEYNDRFQVQVNKNSSIE. 92
11 -24.2003dm3_A mol:protein length:105 Replication factor A  ali model follow..  18  1.............................................................................................................EIKDTYNIGELSPGMTATFEGEVISALSIGKLKSFIVRDETGSIRVTLWDNLTDIDVGRGDYVRVRGYIREGYYGGLECTANYVEILK. 98
12 -22.3005d8e_A mol:protein length:115 SOSS complex subunit B1  ali model follow..  16  2............................................................................................................TTETFVKDIKPGLKNLNLIFTGRVTKTKDGHEVRTCKVADKTGSINISVWDDVGNL-IQPGDIIRMTKGYASVFKGCLTLYTGRGGDLQ. 93
13 -20.8002k75_A mol:protein length:106 uncharacterized protein Ta0387  ali model follow..  15  1............................................................................................................SDLVKIRDVSLSTPYVSVIGK-EYESDGTTKSVYQGYIEDDTARIRISSFGK----QLQDSDVVRIDNARVAQFNGYLSLSVGDSSRIE. 91
14 -20.5001jmc_A mol:protein length:246 PROTEIN (REPLICATION PROTEIN A (RPA))  ali model follow..  12  23.................ICARVTNKSQIRTWSNSRGKLFSLELVDESGEIRATAFNEKFFPLIEVNKVYYFSKGTLKIA-MTFNNETSVMPCEDDHHLP------TVQFDFTGIDDLENKSKDSLVDIIGICKSYEREVAKRNIYLMDTSGVVTATLWGEDAKFDGSRQPVLAIKGARVSDFGGR-SLSVLSSSTI.. 223
15 -20.3001fgu_A mol:protein length:252 REPLICATION PROTEIN A 70 KDA DNA-BINDING SUBUNIT  ali model follow..  12  19.................ICARVTNKSQIRTWSNSRGKLFSLELVDESGEIRATAFNEKFFPLIEVNKVYYFSKGTLKIA-MTFNNETSVMPCEDDHHLP------TVQFDFTGIDDLENKSKDSLVDIIGICKSYEREVAKRNIYLMDTSGVVTATLWGEDAKFDGSRQPVLAIKGARVSDFGGR-SLSVLSSSTI.. 219
16 -20.3002mna_A mol:protein length:117 Single-stranded DNA binding protein (SSB)  ali model follow..  11  4................................................................................................................KVGNLKPNMESVNVTVR-QIQTKNGVRTISEAIVGDETGRVKLTLWGKHAGS-IKEGQVVKIENAWTTAFKGQVQLNAGSKTKIA. 94
17 -20.2001o7i_A mol:protein length:119 SINGLE STRANDED DNA BINDING PROTEIN  ali model follow..  11  4................................................................................................................KVGNLKPNMESVNVTVR-QIQTKNGVRTISEAIVGDETGRVKLTLWGKHAGS-IKEGQVVKIENAWTTAFKGQVQLNAGSKTKIA. 94
18 -19.9003e0e_A mol:protein length:97 Replication protein A  ali model follow..  21  2..............................................................................................................NYKISELMPNLSGTINAEVVTAYPKKEKGQLKSLFLKDDTGSIRGTLWNELADFEVKKGDIAEVSG-YVKQGYSGLEISVDNIGIIE. 94
19 -19.9001wjj_A mol:protein length:145 hypothetical protein F20O9.120  ali model follow..  12  4..................................................................................................GSSGSTVKRKPVFVKVEQLKPGTTGHTLTVK-SLSRPSQPSRIVECLIGDETGCILFTARNDQVDL-MKPGATVILRNSRIDMFKGTMRLGVDKWGRIE. 118
20 -19.6002k5v_A mol:protein length:104 Replication protein A  ali model follow..  22  2..............................................................................................................NYKISELMPNLSGTINAEVVAAYPKKEKGQLKSLFLKDDTGSIRGTLWNELADFEVKKGDIAEVSG-YVKQGYSGLEISVDNIGIIE. 94
21 -18.6002k50_A mol:protein length:115 Replication factor A related protein  ali model follow..  19  2............................................................................................................KPEHRMDTISKLEEGAETPVTGRVMKISREGKLANVIIADDTGELRAVFWTENIKLKFREGDVIRIKDVNIRGFGGRKEAHLMPRSTVE. 103
22 -18.1004owt_B mol:protein length:211 SOSS complex subunit B1  ali model follow..  17  2............................................................................................................TTETFVKDIKPGLKNLNLIFIGRVTKTKDGHEVRTCKVADKTGSINISVWDDVGNL-IQPGDIIRLTKGYASVFKGCLTLYTGRGGDLQ. 93
23 -17.5004gnx_C mol:protein length:444 Putative uncharacterized protein  ali model follow..  10  1MPIYPIEGLSPYQNRWTIKARVTSKSDIRHWSNQRGKLFSVNLLDDSGEIKATGFNDRFYPLLQENHVYLISKARVNIAEITFENSTEIEECTDATDVP------EVKYEFVRINELESVEANQQCDVIGILDSYQRPVQKRELTLVDQGNSVKLTLWGKTAEAGVDEKPVLAFKGVKVGDFGGR-SLSMFSSSTM.. 222
24 -15.1006d6v_D mol:protein length:701 Telomerase-associated protein 82  ali model follow..  11  230.................FEGRVVYKSSTFQNQ-QDSKYFFITAQDANNQEINLSFWQQSYQTLKVGQYYYFIGGEVKQFQIIPKETLSANYVQPLALIEKEESIAQKGYNGQKNNKYRQNNNNSISEVLKTSKQYLSDKNIRLKICDNSCNELKVVIFPDLCYEKFSINKWYYFNEFVRQIYNDEVQLKNNIHSSI.. 464
25 -14.3001nnx_A mol:protein length:109 Protein ygiW  ali model follow..  11  6...........................................................................................SGPSATQSQAGGFQGPNGSVTTVESAKSLRDDTWVTLRGNIVERISDDL---YVFKDASGTINVDIDHKRNGVTVTPKDTVEIQG-EVDKDWNSVEIDVKQIRKVN. 108
26 -14.1004gnx_B mol:protein length:136 Putative uncharacterized protein  ali model follow..  12  2.....................................................................................................KKAGNNTLRPVTIRQILNAEQPGQLTFVAVVRNISRNATNVAYSVEDGTGQIEVRQWLDSSSDDIRNNVYVRVLG-TLKSFQNRRSISSGHMRPVID 116
27 -13.1004joi_A mol:protein length:166 CST complex subunit STN1  ali model follow..  13  37...........................................................................................................................KQVDVLGTVIGVRERDAFYSYGVDDSTGVINCICWKKLNTESIEIGDTIRVRG-SIRTYREEREIHATTYYKVD. 138
28 -12.9002pi2_A mol:protein length:270 Replication protein A 32 kDa subunit  ali model follow..  15  49...............................................................................................................CTISQLLSATLVSQVTIVGIIRHAEKAPTNIVYKIDDMTAAPMDVRQWVDTDDTVPPETYVKVAG-HLRSFQNKKSLVAFKIMPLE. 150
29 -12.3003kf6_A mol:protein length:159 Protein stn1  ali model follow..  10  48...........................................................................................................................RWIQIVGYIAAIDIYEGKHVLTVDDCSGMVLRVVFIIQDDFSMSPGNVVCVFG-KINSFRSEVELIAQSFEELRD 128
30 -11.4003nbh_B mol:protein length:147 RecQ-mediated genome instability protein 2  ali model follow..  56...........................................................................................................................AAVWMQGRVVMADRGE----ARLRDPSGDFSVRGLERVPRGCLVPGKYVMVMG-VVQACSPEPCLQAVKMTDLS. 126
31 -11.3004gla_C mol:protein length:109 OBody NL8  ali model follow..  19  5...........................................................................................................PKKTHWTAEITPNLHGTEVVVAGWVASLGDYGRVKIVKVSDREGGAAVPVYLEAGKTPDHLFKVFA-------------ELSREDVVVIKG 82
32 -11.2003mxn_B mol:protein length:150 RecQ-mediated genome instability protein 2  ali model follow..  59...........................................................................................................................AAVWMQGRVVMADRGE----ARLRDPSGDFSVRGLERVPRGCLVPGKYVMVMG-VVQACSPEPCLQAVKMTDLS. 129
33 -10.8003kjo_A mol:protein length:299 Protection of telomeres protein 1  ali model follow..  11  1.......................................................................................................MSLVPATNYIYTPLNQLKGGTIVNVYGVVKFFKPPYLSSVVTIVDQTNVLTCLLFSGNYEA-YKNGDIVRFHRLKIQVYKKETQGITSSGFAS.. 103
34 -10.7004gn4_B mol:protein length:108 OBody AM2EP06  ali model follow..  17  4...........................................................................................................PKKTHWTAEITPNLHGSEVVVAGWVAHLGDYGRVKIVKVSDREGGAAVPVYLERGKTPDHLFKVFA-------------ELSREDVVVIKG 81
35 -10.7004glv_B mol:protein length:107 OBody AM3L09  ali model follow..  18  4............................................................................................................KKTHWTAEITPNLHGSEVVVAGWVAHLGDYGRVKIVKVSDREGGAAVPVYLERGKTPDHLFKVFA-------------ELSREDVVVIKG 80
36 -10.4004hid_A mol:protein length:143 Protection of telomeres protein 1  ali model follow..  16  4................................................................................................................SFSLLSQITPHQRCSFYAQVIKTWYSDKNFTLYVTDYTENIRCILWDEHDFYYIKEGDYVVMKNVRTKIDHL.............. 101
37 -10.3004gn5_A mol:protein length:113 OBody AM3L15  ali model follow..  18  4............................................................................................................KKTHWTAEITPNLHGSEVVVAGWVAHLGDYGRVKIVKVSDREGGAAVPVYLERGKTPDHLFKVFA-------------ELSREDVVVIKG 80
38 -10.3004gn3_B mol:protein length:113 OBody AM1L10  ali model follow..  19  8............................................................................................................KKTHWTAEITPNLHGTEVVVAGWVASLGDYGRVKIVKVSDREGGAAVSVYLEYGKTPDHLFKVFA-------------ELSREDVVVIKG 84
39 -9.8901ynx_A mol:protein length:114 Replication factor-A protein 1  ali model follow..  17  19.................IKARVSYKGEIKTWHNQRGKLFNVNFLDTSGEIRATAFNDKFNEILQEGKVYYVSKAKLQPA-LNLDRDTVIEECFDESN..................................................................................................... 114
40 -9.4701jb7_A mol:protein length:495 telomere-binding protein alpha subunit  ali model follow..  15  9.................................................................................RSTSRVSKKKTAAPKEGAAKKSDKGHKYEYVELAKASLT-SAQPQHFYAVVIDATFPYKTCSLKIVDPTDYATLVLYAKRFED-HRAGDIIRVHRATLRLYNGQRQFNANVFY.... 142
41 -9.3901qzg_A mol:protein length:187 Protection of telomeres protein 1  ali model follow..  17  38......................................................................................................................LQKKNTIVNLFGIVKDFTPSRQSTTVYLWDPT-GLQIHLFSKQGND-KQVGQPLLLHQITLRSYRDRTQGLSKDQF.... 129

FFAS is supported by the NIH grant R01-GM087218-01
1 2 8 4 9 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Godzik A. Database searching by flexible protein structure alignment. Protein Sci. 2004 Jul;13(7):1841-50.