current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 4joi_D mol:protein length:122 CST complex subunit TEN1, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120
# Score Template Links and tools%idFirst MLPKPGTYYLPWEVSAGQVPDGSTLRTFGRLCLYDMIQSRVTLMAQHGSDQHQVLVCTKLVEPFHAQVGSLYIVLGELQHQQDRGSVVKARVLTCVEGMNLPLLEQAIREQRLYKQERGGSQLast
1 -69.4004joi_D mol:protein length:122 CST complex subunit TEN1  ali model  100  1MLPKPGTYYLPWEVSAGQVPDGSTLRTFGRLCLYDMIQSRVTLMAQHGSDQHQVLVCTKLVEPFHAQVGSLYIVLGELQHQQDRGSVVKARVLTCVEGMNLPLLEQAIREQRLYKQERGGSQ 122
2 -42.4003kf6_B mol:protein length:105 Protein ten1  ali model follow..  17  4..SDSAKLIFINQINDCK--DGQKLRFLGCVQSYK--NGILRLIDGSSS----VTCDVTVLPDVSIQKHEWLNIVGRKR----QDGIVDVLLIRSAVGINLPRYRQMVSERQKCD....... 105
3 -20.9002pi2_E mol:protein length:142 Replication protein A 14 kDa subunit  ali model follow..  15  33.....................DKPVCFVGRLEKIHPTGKMFILSDGEGKN-----GTIELMEPLDEEISGIVEVVGRVTAKATILCTSYVQFKEDSHPFDLGLYNEAVKIIHDFPQ...... 122
4 -19.8003kf8_B mol:protein length:123 Protein ten1  ali model follow..  4IILIPSNIPQEFPEASIS--NPERLRILAQVKDFIPHESTIVIDKQSTYINICIFNLLEACSSRVLVPGTLVNIDAFYDGESINPVDIYEVNGANFTMENIQLIDEMNNSIGKF........ 122
5 -18.7004gnx_A mol:protein length:114 Putative uncharacterized protein  ali model follow..  14  18.....................GQTVRIVGKVHKVTGNTLLMQTSDLGN-------VEIAMTPDSDVSSSTFVEVTGKVSDAGSSFQANQIREFTTVHDVDLTLVENVVQISAAFPN...... 108
6 -16.1006d6v_F mol:protein length:121 Telomerase holoenzyme TEB heterotrimer Teb3 subunit  ali model follow..  13  23.....................GKKVTVVGNVCNEDQNDSLVIEFGPTG---LNQHVVINYRRVDLNNTTKFVEIRGVVL-NQNIVSCEELTEFEQKDPFDFDTYSKLIHLSQS......... 111
7 -12.0003kf6_A mol:protein length:159 Protein stn1  ali model follow..  11  21........MFISDVHKISFHPHRWIQIVGYIAAIDIYEGKHVLTVDDCSGMVLRVVFSMSKRAISMSPGNVVCVFGKINSFRSEV-ELIAQSFEELRDPNWKAWQKRMRYKKNLTK...... 148
8 -11.5002pi2_A mol:protein length:270 Replication protein A 32 kDa subunit  ali model follow..  11  46IVP-----CTISQLLSATLVDESQVTIVGIIRHAEKAPTNIVYKIDDMTAAPMDVRDDTSSENTVVPPETYVKVAGHLRSFQNKK-SLVAFKIMPLEDMNEFTTHEVINAHMVLSKANSQPS 177
9 -11.3004joi_A mol:protein length:166 CST complex subunit STN1  ali model follow..  1LDPVFLAFLYIRDILDMKESRQKQVDVLGTVIGVRERDAFYSYGVDDSTGVINCICQETIEQKTKIEIGDTIRVRGSIRTYREER-EIHATTYYKVDDPVWNIMLELPTIYRKVYDQ..... 162
10 -11.1003nbh_B mol:protein length:147 RecQ-mediated genome instability protein 2  ali model follow..  14  20...SPPLKVLAEQLRRDAEGGPAAVWMQGRVVMAD--RGEARLRDPSGDFSVRGLERVPRGRP-CLVPGKYVMVMGVVQACSPEP-CLQAVKMTDLSDNPIHESMWELEVEDLHRN...... 145
11 -10.7003mxn_B mol:protein length:150 RecQ-mediated genome instability protein 2  ali model follow..  12  23...SPPLKVLAEQLRRDAEGGPAAVWMQGRVVMAD--RGEARLRDPSGDFSVRGLERVPRGRP-CLVPGKYVMVMGVVQACSPEPCLQAVKMTDLSDNPIHESMWEVEDLHRNI........ 149
12 -10.4004gnx_B mol:protein length:136 Putative uncharacterized protein  ali model follow..  13  12........VTIRQILNAEQPHPGQLTFVAVVRNISRNATNVAYSVEDGTGQIEVRQSDDSSKASEIRNNVYVRVLGTLKSFQNRR-SISSGHMRPVIDYNEVMFHEAVHAHLQVTR...... 136
13 -10.4001sr3_A mol:protein length:136 APO-CCME  ali model follow..  15  10...TPGEILYGKRETQQMPEVGQRLRVGGMVMSVQRDPNSLKVTFTIYDAEGSVDVSYEGILPDLFREGQGVVVQGELE--KGNHILAKEVLAKHDENYTPPEVEKAMEANHRRPASVYKDP 128
14 -10.0003kf8_A mol:protein length:220 Protein stn1  ali model follow..  10  86......................NQINIFGKIVYEQYKEKILVISDFIGIDSKIRQFKEVGLTLDKKNYGKIVELEGEIYNWYDSINVDRELKVSKITVLEFEQWKKRMEFRKNNLVE..... 209
15 -9.5001nnx_A mol:protein length:109 Protein ygiW  ali model follow..  10  21...PNGSVTTVESAKS--LRDDTWVTLRGNIVE-RISDDLYVFKDASGT--INVDIDHKRWNGVTVTPKDTVEIQGEVDK-DWNSVEIDVKQIRKVN......................... 108

FFAS is supported by the NIH grant R01-GM087218-01
1 3 3 6 5 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Sasin JM, Godzik A, Bujnicki JM. SURF'S UP! - protein classification by surface comparisons. J Biosci. 2007 Jan;32(1):97-100.