current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 4o2d_A mol:protein length:620 Aspartate--tRNA ligase, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .  540    .  550    .  560    .  570    .  580    .  590    .  600    .  610
# Score Template Links and tools%idFirst MAMGTLEAQTQGPGSMVLRTHAAGSLRPADAGQTVTLAGWVARRRDHGGVIFIDLRDASGVSQVVFREGDVLAAAHRLRAEFCVAVTGVVEVRPEGNENPEIPTGQIEVNATELTVLGESAPLPFQLDEQAGEEARLKYRYLDLRREGPGNALRLRSKVNAAARSVLAEHDFVEIETPTLTRSTPEGARDFLVPARLQPGSFYALPQSPQLFKQLLMVAGMERYYQIARCYRDEDFRADRQPEFTQLDMEMSFVEADDVIAISEQVLKAVWATIGYDLPLPLPRISYEEAMRRFGSDKPDLRFGIELVECTEYFKDTTFRVFQAPYVGAVVMPGGASQPRRTLDGWQEFAKQRGHKGLAYVLVGEDGTLGGPVAKNLSDAERDGLVAHVGANPGDCIFFAAGPAKGARALLGATRIEIAKRLDLIDPNAWAFTWVVDFPMFEAADEATAAGDVAVGSGAWTAMHHAFTAPKPDSVDTFDSDPGNALSDAYDIVCNGNEIGGGSIRIHRRDIQERVFAMMGIDHDEAQEKFGFLLDAFSYGAPPHGGIAFGWDRITALLAGVDSIREVIAFPKSGGGVDPLTDAPAPITPQQRKESGIDAKPREDKPKEDAKSKALast
1 -204.0004o2d_A mol:protein length:620 Aspartate--tRNA ligase  ali model  100  1MAMGTLEAQTQGPGSMVLRTHAAGSLRPADAGQTVTLAGWVARRRDHGGVIFIDLRDASGVSQVVFREGDVLAAAHRLRAEFCVAVTGVVEVRPEGNENPEIPTGQIEVNATELTVLGESAPLPFQLDEQAGEEARLKYRYLDLRREGPGNALRLRSKVNAAARSVLAEHDFVEIETPTLTRSTPEGARDFLVPARLQPGSFYALPQSPQLFKQLLMVAGMERYYQIARCYRDEDFRADRQPEFTQLDMEMSFVEADDVIAISEQVLKAVWATIGYDLPLPLPRISYEEAMRRFGSDKPDLRFGIELVECTEYFKDTTFRVFQAPYVGAVVMPGGASQPRRTLDGWQEFAKQRGHKGLAYVLVGEDGTLGGPVAKNLSDAERDGLVAHVGANPGDCIFFAAGPAKGARALLGATRIEIAKRLDLIDPNAWAFTWVVDFPMFEAADEATAAGDVAVGSGAWTAMHHAFTAPKPDSVDTFDSDPGNALSDAYDIVCNGNEIGGGSIRIHRRDIQERVFAMMGIDHDEAQEKFGFLLDAFSYGAPPHGGIAFGWDRITALLAGVDSIREVIAFPKSGGGVDPLTDAPAPITPQQRKESGIDAKPREDKPKEDAKSKA 614
2 -198.0004rmf_A mol:protein length:609 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  99  1................MLRTHAAGSLRPADAGQTVTLAGWVARRRDHGGVIFIDLRDASGVSQVVFREGDVLAAAHRLRAEFCVAVTGVVEVRPEGNENPEIPTGQIEVNATELTVLGESAPLPFQLDEQAGEEARLKYRYLDLRREGPGNALRLRSKVNAAARSVLAEHDFVEIETPTLTRSTPEGARDFLVPARLQPGSFYALPQSPQLFKQLLMVAGMERYYQIARCYRDEDFRADRQPEFTQLDMEMSFVEADDVIAISEQVLKAVWATIGYDLPLPLPRISYEEAMRRFGSDKPDLRFGIELVECTEYFKDTTFRVFQAPYVGAVVMPGGASQPRRTLDGWQEFAKQRGHKGLAYVLVGEDGTLGGPVAKNLSDAERDGLVAHVGANPGDCIFFAAGPAKGARALLGATRIEIAKRLDLIDPNAWAFTWVVDFPMFEAADEATAAGDVAVGSGAWTAMHHAFTAPKPDSVDTFDSDPGNALSDAYDIVCNGNEIGGGSIRIHRRDIQERVFAMMGIDHDEAQEKFGFLLDAFSYGAPPHGGIAFGWDRITALLAGVDSIREVIAFPKSGGGVDPLTDAPAPITPQQRKESGIDAKPREDKPKEDAKSKA 598
3 -193.0005w25_A mol:protein length:616 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  80  2....GSSSSGLVPRGFVLRSHAAGLLREGDAGQQVTLAGWVARRRDHGGVIFIDLRDASGIAQVVFRDPEVLAQAHRLRAEFCVSVAGVVEIRPEGNANPEIATGEIEVNATSLTVLGECAPLPFQLDEPAGEELRLKYRYLDLRRDDPAAAIRLRSRVNAAARAVLARHDFVEIETPTITRSTPEGARDFLVPARLHPGSFYALPQSPQLFKQLLMVAGMERYYQIARCYRDEDFRADRQPEFTQLDMEMSFVDAEDIIAISEEVLTELWALIGYRIPTPIPRIGYAEAMRRFGTDKPDLRFGLELVECTDFFSDTTFRVFQAPYVGAVVMPGGASQPRRTLDGWQDWAKQRGHRGLAYVLVAEDGTLGGPVAKNLTEAERTGLADHVGAKPGDCIFFSAGPVKSSRALLGAARVEIANRLGLIDPDAWAFVWVVDPPLFEPADEATAAGEVAVGSGAWTAVHHAFTAPKPEWEDRIESDTGSVLADAYDIVCNGHEIGGGSVRIHRRDIQERVFAVMGLDKAEAEEKFGFLLEAFMFGAPPHGGIAFGWDRTTALLAGMDSIREVIAFPKTGGGVDPLTDAPAPITAQQRKESGIDAQPKRVQQA....... 610
4 -177.0001eqr_A mol:protein length:590 ASPARTYL-TRNA SYNTHETASE  ali model follow..  47  1.................MRTEYCGQLRLSHVGQQVTLCGWVNRRRDLGSLIFIDMRDREGIVQVFFDPDDALKLASELRNEFCIQVTGTVRARDEKNINRDMATGEIEVLASSLTIINRADVLPLDSNHVNTEEARLKYRYLDLRRPEMAQRLKTRAKITSLVRRFMDDHGFLDIETPMLTKATPEGARDYLVPSRVHKGKFYALPQSPQLFKQLLMMSGFDRYYQIVKCFRDEDLRADRQPEFTQIDVETSFMTAPQVREVMEALVRHLWLEVKGVDLGDFPVMTFAEAERRYGSDKPDLRNPMELTDVADLLKSVEFAVFAGPAVAALRVPGGASLTRKQIDEYGNFVKIYGAKGLAYIKVNELEGINSPVAKFLNAEIIEDILDRTAAQDGDMIFFGADNKKIVADAMGALRLKVGKDLGLTDESKWAPLWVIDFPMFED-----------DGEGGLTAMHHPFTSPKDMTAAELKAAPENAVANAYDMVINGYEVGGGSVRIHNGDMQQTVFGILGINEEEQREKFGFLLDALKYGTPPHAGLAFGLDRLTMLLTGTDNIRDVIAFPKTTAAACLMTEAPSFANPTALAELSIQVVKKAENN........ 590
5 -175.0004ah6_A mol:protein length:617 ASPARTATE--TRNA LIGASE, MITOCHONDRIAL  ali model follow..  39  7..............SFVVRTNTCGELRSSHLGQEVTLCGWIQYRRQNT---FLVLRDFDGLVQVIIPQDSVKKILCEAPVESVVQVSGTVISRPAGQENPKMPTGEIEIKVKTAELLNACKKLPFEIFVKKTEALRLQYRYLDLRSFQMQYNLRLRSQMVMKMREYLCNLGFVDIETPTLFKRTPGGAKEFLVPSR-EPGKFYSLPQSPQQFKQLLMVGGLDRYFQVARCYRDEGSRPDRQPEFTQIDIEMSFVDQTGIQSLIEGLLQYSWPNDKDPVVVPFPTMTFAEVLATYGTDKPDTRFGMKIIDISDVFRNTEIGFLQDALSKPHGTEGAKYLKRKDIESIRNFAADHFNQEILPVFLNANRNWNSPVANFIMESQRLELIRLMETQEEDVVLLTAGEHNKACSLLGKLRLECADLVVLRDPTLFSFLWVVDFPLFLPKE---------ENPRELESAHHPFTAPHPSDIHLLYTEPKKARSQHYDLVLNGNEIGGGSIRIHNAELQRYILATLL---KEDVKMLSHLLQALDYGAPPHGGIALGLDRLICLVTGSPSIRDVIAFPKSFRGHDLMSNTPDSVPPEELKPYHIRVSKPTDSKAERAHV.. 607
6 -174.0004wj3_M mol:protein length:599 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  47  2...............GMMRSHYCGQLNESLDGQEVTLCGWVHRRRDHGGVIFLDVRDREGLAQVVFDPDETFAKADRVRSEFVVKITGKVRLRPEGARNPNMASGSIEVLGYELEVLNQAETPPFPLYSDVGEETRLRYRFIDLRRPEMAAKLKLRARITSSIRRYLDDNGFLDVETPILGRPTPEGARDYLVPSRTYPGHFFALPQSPQLFKQLLMVAGFDRYYQIAKCFRDEDLRADRQPEFTQIDIETSFLDESDIIGITEKMVRQLFKEVLDVEFDEFPHMPFEEAMRRYGSDKPDLRIPLELVDVADQLKEVEFKVFSGPRVAALRVPGAASMPRSQIDDYTKFVGIYGAKGLAYIKVNEREGLQSPIVKFIPEANLNVILDRVGAVDGDIVFFGADKAKIVCDALGALRIKVGHDLKL-LTREWAPMWVVDFPMFEENDD------------GSLSALHHPFTSPKCTPAELEANPGAALSRAYDMVLNGTELGGGSIRIHDKSMQQAVFRVLGIDEAEQEEKFGFLLDALKYGAPPHGGLAFGLDRLVMLMTGASSIREVIAFPKTQSAGDVMTQAPGSVDGKALRELHIRLREQPKAE........ 593
7 -171.0001efw_A mol:protein length:580 ASPARTYL-TRNA SYNTHETASE  ali model follow..  50  1................MRRTHYAGSLRETHVGEEVVLEGWVNRRRDLGGLIFLDLRDREGLVQLVAHPASPYATAERVRPEWVVRAKGLVRLRPEP--NPRLATGRVEVELSALEVLAEAKTPPFPVEKEASEELRLKYRYLDLRRRRMQENLRLRHRVIKAIWDFLDREGFVQVETPFLTKSTPEGARDFLVPYRHEPGLFYALPQSPQLFKQMLMVAGLDRYFQIARCFRDEDLRADRQPDFTQLDLEMSFVEVEDVLELNERLMAHVFREALGELPLPFPRLSYEEAMERYGSDKPDLRFGLELKEVGPLFRQSGFRVFQEAESVKALA-LPKALSRKEVAELEEVAKRHKAQGLAWARVEEG--GFSGGVAKFLEPVREALLQATEARPGDTLLFVAGPRKVAATALGAVRLRAADLL-GLKREGFRFLWVVDFPLL----------EWDEEEEAWTYMHHPFTSPHPEDLPLLEKDPGRVRALAYDLVLNGVEVGGGSIRIHDPRLQARVFRLLGIGEEEQREKFGFFLEALEYGAPPHGGIAWGLDRLLALMTGSPSIREVIAFPKNKEGKDPLTGAPSPVPEEQLRELGLMVVRP............ 580
8 -120.0004up7_A mol:protein length:777 LYSINE--TRNA LIGASE  ali model follow..  18  14.DVEEYQKAGHNPWPHFNVSITVPEFIAQVSDDIVSVAGRVLSKRSSSSLMFIDLHDSQTKLQIMLNKSAYENK-EDFVSLTKMIYRGDICGF--TGHPTRTKTGELSLIPISGMILSPCLMLPSMHYGLGDQETRFRKRYLDLINPESVKNFVLRTKVVKAVRKYLDDKGFLEVETPILNIPGGATARPFITHHNQLDIQMY-MRIAPELYLKELVVGGINRVYEIGRLFRNEGIDQTHNPEFTTCEFYMAYADYNDIMKMTEELLGNMVKD-----------ITGGSTKLEIKDRLMDINNEEDIKMLEKFFKEPIPRPFNSAECSKVIEKHCTELNYYYDGNNEKAMKKLFADFVTEKKMVLDF--TAPFKRISYVHALEEKFGEKIPRPLDGPEALTFLKKQAIRF---------NAICAEPQTTARVMDKLFGDLI----------EVDLVQPTFVCDQPQLMSPLAKY-----HRSEPELTERFELFILKREIANAYTELNNPIVQRSNFEQQAKGDDEAQLVDEVFLDAIEHAFPPTGGWGLGIDRLAMLLADVDNIKEVILFPTMRPEDELEKKAREAKEDAMVAQELAATEEKGGKKVVKPKANK 602
9 -90.1005eln_A mol:protein length:535 Lysine--tRNA ligase  ali model follow..  17  24.MMECIKDAGRPFYPHKFISMSLPAYALKYKDTTLSLSGRVTSIRSSSKLIFYDIFCEEQKVQIIANTGEFSVSHSEIRRGDVVGFTGFP----------KSKRGELSLFSKSVVLLSPCYMLPTAISGLKDQEVRYRQRYLDLLNEESRKVFKLRSRAIKYIRNYFDRLGFLEVETPMLNMIYGGAAARPFITYHNELETQLYMRIAPELYLKQLIVGGLDKVYEIGKNFRNEGIDLTHNPEFTAMEFYMAYADYYDLMDLTEELISGLVLEIHGSL-----KIPYHPDGPEGKCIEIDFTTPWKRFSFVEEIESGL-----------------------------------------------------------------------------------------------EKLKRPLDSQENIDFMVEMCEKHEIELPHPRTAAKLLDKLAGHFVETKCTNPSFIIDHPQTMSPLAKREKPEMTERFELFVLGKELCNAYTELNEPLQQRKFFEQQADGDVEACPIDETFCLALEHGLPPTGGWGLGIDRLIMFLADKNNIKEVILFPAMRNVKQNAQHSNQHSG.......................... 528
10 -89.8004j15_A mol:protein length:521 Aspartate--tRNA ligase, cytoplasmic  ali model follow..  22  27.KPREIMDAAEDYAKERYGISSVRDLTIQKADEVVWVRARVHTSRAKGKQCFLVLRQQQFNVQALVAVGDHASKAANINKESIVDVEGVVRKVNQK--IGSCTQQDVELHVQKIYVISLAERLPLQLDDTVNQDTRLDNRVIDLRTSTSQAVFRLQSGICHLFRETLINKGFVEIQTPKIISAASEGGANVFTVSYFKNNAY--LAQSPQLYKQMCICADFEKVFSIGPVFRAEDSNTHRHTEFVGLDIEMAFNYYHEVMEEIADTMVQIFKGLQERFQTEIQTVNKQFPCEPFKFLEPTLRLEYC-------------------------------------------------------------------------------------------------------------------------EALAMLREAGVEMGDEDDLSTPNEKLLGHLKEKYDTDFYILDKYPLAVRPFPDPRNPKQSNSYDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEK----IKAYIDSFRFGAPPHAGGGIGLERVTMLFLGLHNVRQTSMFPRDPK....................................... 511
11 -89.7005hgq_A mol:protein length:524 Lysine--tRNA ligase  ali model follow..  17  17.LINERRSKGINPYPHKFVSISLADFIAKYNDIVQSVAGRVFSKRESGKLIFYDLHGEGTRLQVLANARFHSGDHDRIKRGDIIGVNGYP----------RSKSGELSIIPYEIIQLTPCLMLPHTHFGLKNQETRYRMRYLDLMNPDVKNRFVTRSRMISFLRRYLDNLGFLEVETPMMNLIAGGATAKPFITHHNDLDMDLYLRVAPELYLKMLVVGGIDRVYEIGRVFRNEGIDQTHNPEFTSCEFYMAYADYEDLMKITEDMLARMVYYMHGTYKIQYH----PNGIVENPVYEVDFTPPFRKVNIYDGLQEKL----------------------------------------------------------------------------------------------QFPPADTLDTDEANKFFDKLAVENNVECPAPRTTARLLDKLIGEFLEPTFISPTFLTGHPQIMSPLAKRSIPGLTERFELFVVTKEIVNAYTELNDPLTQRLRFDEQAKGDDEAQNIDENYCTALEYGLPPTAGWGMGIDRLAMILTDSNNIKEVLFFPAMRPDEKGTNVLDEGGNA......................... 524
12 -89.1003bju_A mol:protein length:521 Lysyl-tRNA synthetase  ali model follow..  19  15.AIHQLKVNGEDPYPHKFVDISLTDFIQKYTDITLKVAGRIHAKRASGKLIFYDLRGEGVKLQVMANSRNYKSENNKLRRGDIIGVQGNP----------KTKKGELSIIPYEITLLSPCLMLPHLHFGLKDKETRYRQRYLDLLNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHNELDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKMVSGMVKHITGSY-----KVTYHPDGPEGQAYDVDFTPPFRRINMVEELEKA---------------------------------------------LGMKLPETNLFETEETRKILDDICVAKAVE-----------------------------------------------CPPPRTTARLLDKLVGEFLEVTCINPTFICDHPQIMSPLAKRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKGDDEAMFIDENFCTALEYGLPPTAGWGMGIDRVAMFLTDSNNIKEVLLFPAMKPEDK.................................... 510
13 -88.7003a74_A mol:protein length:493 Lysyl-tRNA synthetase  ali model follow..  19  15.KLKKIEELGVDPFGKRFRTHKAEELFELYQQIEVAVAGRIMTKRGMGKAGFAHIQDVTGQIQIYVRQDDVGEQFKISDLGDIVGVRGTM----------KTKVGELSIKVSSYEFLTKARPLPEKYHGLKDIEQRYRQRYLDLMNPESKKTFITRSLIIQSMRRYLDSHGYLEVETPMMHAVAGGAAARPFITHHNALDMTLYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGISTRHNPEFTMLELYEAYADFRDIMKLTENLIAHIATEVLGTTKIQYGEHLVDLTPEWRRLHMVDAIKEYVGVDFWRQMSDEEAR--------------------------------------------------------------------------------------------------------------ELAKEHGVEVAPHMTFGHIVNEFFEQKVEDKLIQPTFIYGHPVEISPLAKPDDPRFTDRFELFIVGREHANAFTELNDPIDQRQRFEEQLKGNDEAHEMDEDFLEALEYGMPPTGGLGIGVDRLVMLLTNSPSIRDVLLFPQMRH....................................... 492
14 -88.3001e1o_A mol:protein length:504 LYSYL-TRNA SYNTHETASE, HEAT INDUCIBLE  ali model follow..  20  24.KLAALRQQGVAFPNDFRRDHTSDQLHEEFLNIEVSVAGRMMTRRIMGKASFVTLQDVGGRIQLYVARDSLPEGFKKWDLGDIIGARGTL----------KTQTGELSIHCTELRLLTKARPLPDKFHGLQDQEVRYRQRYLDLANDKSRQTFVVRSKILAAIRQFMVARGFMEVETPMMQVIPGGASARPFITHHNALDLDMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYHDLIELTESLFRTLAQEVLGTTKVTYGEHVFDFGKPFEKLTMREAIKKYRPETDMADLDNF-------------------------------------------------------------------------------------------------------------DAAKALAESIGITVEKSWGLGRIVTEIFDEVAEAHLIQPTFITEYPAEVSPLARDVNPEITDRFEFFIGGREIGNGFSELNDAEDQAERFQEQVNGDDEAMFYDEDYVTALEYGLPPTAGLGIGIDRMIMLFTNSHTIRDVILFPAMRPQK..................................... 504
15 -87.7001bbu_A mol:protein length:504 PROTEIN (LYSYL-TRNA SYNTHETASE)  ali model follow..  20  24.KLANLREQGIAFPNDFRRDHTSDQLHAEFLNIEVAVAGRMMTRRIMGKASFVTLQDVGGRIQLYVARDDLPEGFKKWDLGDILGAKGKL----------KTKTGELSIHCTELRLLTKARPLPDKFHGLQDQEARYRQRYLDLSNDESRNTFKVRSQILSGIRQFMVNRGFMEVETPMMQVIPGGAAARPFITHHNALDLDMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYKDLIELTESLFRTLAQDILGKTEVTYGDVTLDFGKPFEKLTMREAIKKYRPETDMADLDNF-------------------------------------------------------------------------------------------------------------DSAKAIAESIGIHVEKSWGLGRIVTEIFEEVAEAHLIQPTFITEYPAEVSPLARDVNPEITDRFEFFIGGREIGNGFSELNDAEDQAQRFLDQVAGDDEAMFYDEDYVTALEHGLPPTAGLGIGIDRMVMLFTNSHTIRDVILFPAMRPVK..................................... 504
16 -87.1004ex5_A mol:protein length:529 Lysine--tRNA ligase  ali model follow..  21  40.KLRALRDQGIAYPNDFQPTHHAADLQTAYKSLEVAIAGRMMLKRVMGKASFATVQDGSGQIQFFVTPADVGAEFKKWDLGDIVAARGVL----------RTNKGELSVKCTQLRLLAKALPLPDKFHGLADQETRYRQRYVDLVTPETRTTFRARTKAIASIRKFMGDADFMEVETPMLHPIPGGAAAKPFVTHHNALDMEMFLRIAPELYLKRLIVGGFERVFEINRNFRNEGVSPRHNPEFTMMEFYAAYTDYRWLMDFTERLIRQAAVDALGTATIQYQGRELDLAQPFHRLTITQAIQKYAPSYTDGQLSDDA---------------------------------------------------------------------------------------------------------FLRSELKRLGVDVTQPAFLNAGIGALQLALFEETAEAQLWEPTFIIDYPIEVSPLARDTVAGITERFELFITGREIANGFSELNDPEDQAARFKKQVEGDEEAMFFDADYIRALEYGMPPTGGCGIGIDRLVMLLTDSPTIRDVLLFPHLRRED..................................... 523
17 -87.1001b8a_A mol:protein length:438 PROTEIN (ASPARTYL-TRNA SYNTHETASE)  ali model follow..  28  1................MYRTHYSSEITEELNGQKVKVAGWVWEVKDLGGIKFLWIRDRDGIVQITAPKKKVDPEIPKLRSEDVVAVEGVVNFTPKA-------KLGFEILPEKIVVLNRAEPLPLDPTGKVELDTRLNNRFMDLRRPEVMAIFKIRSSVFKAVRDFFHENGFIEIHTPKIIATATEGGTELFPMKYFEEDAF--LAESPQLYKEIMMASGLDRVYEIAPIFRAEEHNTTRHNEAWSIDSEMAFIDEEEVMSFLERLVAHAINYVREHPKLPFPRVSYDKALEILGDLGKEIPWGEDI------------------------------------------------------------------------------------------------------------------------------------------DTEGERLLGKYMMENENAPLYFLYQYPSEAKPFYIDNKPEICRAFDLEYRGVEISSGGQREHRHDILVEQIKEKGLNPES----FEFYLKAFRYGMPPHGGFGLGAERLIKQMLDLPNIREVILFPRDRRRLTP................................... 438
18 -86.2004ycv_A mol:protein length:516 Lysine--tRNA ligase  ali model follow..  18  15.FIQDQKDKGINPYPHKFRTISIPEFIEKYEDTILNITGRIMRVSASGKLRFFDLVGDGEKIQVLANYSFHNHEKGNIRRGDIVGIVGFP----------KSKKGELSIFPKETILLSACLHMLPMKYGLKDTEIRYRQRYLDLINESSRHTFVTRTKIINFLRNFLNERGFFEVETPMMNLIAGGANARPFITHHNDLDLDLYLRIATELPLKMLIVGGIDKVYEIGKVFRNEGIDNTHNPEFTSCEFYWAYADYNDLIKWSEDFFSQLVYHLFGTY-----KISYNKDGPENQPIEIDFTPPYPKVSIVEEIEKVT-----------------------------------------------------------------------------------------------TILEQPFDSNETIEKMINIIKEHKIELPNPPTAAKLLDQLASHFIENKYNDKPFIVEHPQIMSPLAKRTKPGLTERLEMFICGKEVLNAYTELNDPFKQKECFKLQQKGDTEAAQLDSAFCTSLEYGLPPTGGLGLGIDRITMFLTNKNSIKDVILFPTMRPAN..................................... 508
19 -85.8001wyd_A mol:protein length:429 hypothetical aspartyl-tRNA synthetase  ali model follow..  29  1................MYRSHFIADVTPEYDGKEVIWAGWVHLLRDLGGKKFIILRDKTGLGQVVVDKNSAFGISQELTQESVIQVRGIVKADKRA-------PRGIELHAEEITLLSKAAPLPLDVSGKVKADTRLRERVLDLRRQEMQAVIKIQSLALKAFRETLYKEGFIEIFTPKIIASATEGGAQLF--PVIYFGKEAFLAQSPQLYKE-LMAGVVERVFEVAPAWRAEESDTPFHAEFISMDVEMAFADYNDVMQLLEKILHNIVKTIKEEVKIPIKRLKYTEAIEILRSKGYNIKFGDDIGT----------------------------------------------------------------------------------------------------------------------------------------------PELRILNEELKEDLYFIVDWPSDARPFSKSENPELSESFDLIYKFLEIVSGSTRNHKREVLEEALKKKGLKPES----FEFFLKWFDYGMPPHAGFGMGLARLMVMLTGIQSVKEIVPFPRDKKRLTP................................... 429
20 -85.5006aqh_A mol:protein length:508 Lysine--tRNA ligase  ali model follow..  22  23.KRADLLAQGRQPYPVVPRTHTLLEIRQAYTGEIVGVTGRVVFARNSGKLCFATLQEGDGQLQAMISLAEVGQEKTYVDIGDIVFVHGEV----------TSKRGELSVLADSWQMAAKALPLPVAHKEM-SEESRVRQRYVDLVRDQARKVARQRIAVMRAIRSALERRGFLEVETPMLQTLAGGAAARPFVTHSNALDTELYLRIAPELFLKRCLVGGFERVFELNRVFRNEGADSTHSPEFVMLETYQAYGTYDDSAVVTRELIQEVADEAIGTRQ-----------VPLPDGTVYDLDGEWESIQMYPSLSE---------------------------------------------------ALGEEITPDTPAETLWAIADRLGLD---------------------------------------------IPRDRGYGHGKLVEELWEHTVGAKLWAPTFVKDFPVETTPLTRRSIPGVTEKWDLYVRRIELATGYSELTDPIIQRERFEAQARGDDEAMALDEDFLAALEYGMPPSTGTGMGIDRLMMTLTGL-SIRETVLFPIVKP....................................... 501
21 -85.3005vl1_A mol:protein length:506 Lysine--tRNA ligase  ali model follow..  22  20.KRARLLAEGYDPYPVAIRTHTLAEIRATYTEDIVGVAGRVVFARNTGKLCFATLQDGDGQLQAMISLDEVGREKADVDIGDVVYVHGTV----------SSRRGELSVLADSWRMAAKALPLPVAHKEM-SEESRVRQRYVDLVRPQAREVARQRIAVIRAVRNALERRGFLEVETPMLQTLAGGAAARPFVTHSNALDIDLYLRIAPELFLKRCIVGGFDRVFELNRVFRNEGSDSTHSPEFSMLETYQTYGTYDDSALITRELIQEVADEAIGTRQLSM-----------PDGSVYDIDGEWATMEMYSSLSE---------------------------------------------------ALGEQITPETTVARLRDIASGLDVEIDN----------------------------------------------SVFGHGKLVEELWEHAVGNKLTAPTFVKDFPVETTPLTRRSIPGVTEKWDLYVRGVELATGYSELNDPVVQRDRFADQARGDDEAMQLDEDFLTALEYGMPPCTGTGMGIDRLLMCLTGL-SIRETVLFPIVRPHSN.................................... 500
22 -84.7006chd_A mol:protein length:597 Lysine--tRNA ligase  ali model follow..  18  83.AIHQLKVNGEDPYPHFHVDISLTDFIQKYTDITLKVAGRIHAKRASGKLIFYDLRGEGVKLQVMANSRNYKSENNKLRRGDIIGVQGNP----------KTKKGELSIIPYEITLLSPCLMLPHLHFGLKDKETRYRQRYLDLLNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHNELDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKMVSGMVKHITGSY-----KVTYHPDGPEGQAYDVDFTPPFRRINMVEELEKAL----------------------------------------------------------------------------------------------KLPETNLFETEETRKILDDICVAKAVECPPPRTTARLLDKLVGEFLEVTCINPTFICDHPQIMSPLAKRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKGDDEAMFIDENFCTALEYGLPPTAGWGMGIDRVAMFLTDSNNIKEVLLFPAMKPEDKKENVATTDTLESTTVGTSV................. 597
23 -83.8001asy_A mol:protein length:490 ASPARTYL-tRNA SYNTHETASE  ali model follow..  23  34..........................EAKDSDKEVLFRARVHNTRQQGALAFLTLRQQASLIQGLVKANNMVKWAGSLNLESIVLVRGIVKKVDEPIKSAT--VQNLEIHITKIYTISETEALPILLEDVVNLDTRLDYRVIDLRTVTNQAIFRIQAGVCELFREYLATKKFTEVHTPKLLGAPSEGGSSVFEVTYFKGKAY--LAQSPQFNKQQLIVADFERVYEIGPVFRAENSNTHRHTEFTGLDMEMAFEEYHEVLDTLSELFVFIFSELPKRFAHEIELVRKQYPVEEFKLPKDGKMVRLTYKEGIEMLRAAGKEI------------------------------------------GDFEDLSTENEKFLGKLVRDKY----------------------------------------------------------------------------DTDFYILDKFPLEIRPMPDPANPKYSNSYDFFMRGEEILSGAQRIHDHALLQERMKA--HGLSPEDPGLKDYCDGFSYGCPPHAGGGIGLERVVMFYLDLKNIRRASLFPRDPK....................................... 486
24 -83.7003m4p_A mol:protein length:456 Asparaginyl-tRNA synthetase, putative  ali model follow..  22  2.PGSMMTEATTTPVETPIVCNIRD--AAGLEGKLVTFKGWAYHIRKARKLIFVELRDGSGYCQCVIFGKELPEKVKLLTRECSLEITGRLNAYAGKNHPPEIADLNLEMQVTEWKVIGESIDLENIINKDSSIPQKMQNRHIVIRSEHTQQVLQLRSEIQWYFRKYYHDNHFTEIQPPTIVKTQCEGGSTLFKLQYFNEPAY--LTQSSQLYLE-SVIASLGKSFCMLSSYRAEQSRTVRHAEYLHLEAELPFISFEDLLNHLEDLVCTVIDNVMAVPTRPFKRMTYADAIKYCNDHGILNK------------------------------------------------------------------------------------------------------------------------------------------DKPFEYGEDISEKPERQMTDEIGCPIFMIHFPSKMKAFKVPGHPDLTESVDLLMPGVEIVGGSMRIWNYDELMGAYKANGLNPDP----YYWYTQQRKYGSCPHGGYGLGVERLVMWLLGEDHIRKVCLYPRYLERCEP................................... 456
25 -80.3001x54_A mol:protein length:434 Asparaginyl-tRNA synthetase  ali model follow..  24  1................MIEKVYCQEVKPELDGKKVRLAGWVYTNMRVGKKIFLWIRDSTGIVQAVVAKNVVGEEAKKLGRESSVIVEGIV-------KADERAPGGAEVHVEKLEVIQAVSEFPIPEPEQASPELLLDYRHLHIRTPKASAIMKVKETLIMAAREWLLKDGWHEVFPPILVTGAVEGGATLF--KLKYFDKYAYLSQSAQLYLEAA-IFGLEKVWSLTPSFRAEKSRTRRHTEFWHLELEAAWMDLWDIMKVEEELVSYMVQRTLELTEPPFPRISYDEAIDILQSKGVNVEWGDDLGADEERVLTE-----------------------------------------------------------------------------------------------------------------------------------------------EFDRPFFVYGYPKHIKAFEDPNDPRKVLASDMLAGYGEIIGGSQREDDYDKLLNRILEEGMDPKD----YEWYLDLRRYGSVPHSGFGLGVERLVAWVLKLDHIRWAALFPRTPA....................................... 430
26 -80.1005xix_A mol:protein length:472 Asparagine--tRNA ligase, cytoplasmic  ali model follow..  23  39...........................EGYRGQRVKVFGWVHRLRRQGKLMFLVLRDGTGYLQCVLADELCQYNGVLLSTESSVAVYGMLNLTPKG----KQAPGGHELSCDFWELIGLAAGGADNLIEESDVDVQLNNRHMMIRGENMSKILKARSMVTRCFRDHFFDRGYYEVTPPTLVQTQVEGGATLFKLDYFGEEAF--LTQSSQLYLE-TCLPALGDVFCIAQSYRAEQSRTRRHAEYTHVEAECPFLTFDDLLNRLEDLVCDVVDRILKSPKRPFKRMNYSDAIVWLKEHDVKKEDGTFY-----------------------------------------------------------------------------------------------------------------------------------------EFGEDIPEAPERLMTDTINEPILLCRFPVEIKSFRCPEDSRLTESVDVLMNVGEIVGGSMRIFDSEEILAGYKREGIDPTP----YYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRDVCLYPRFVQ....................................... 462
27 -79.0002xti_A mol:protein length:437 ASPARAGINYL-TRNA SYNTHETASE, CYTOPLASMIC, PUTATIVE  ali model follow..  25  9...........................VKHRNERVCIKGWIHRMRRQGKLMFFILRDGTGFLQVLLMDKLCQYDALTVNTECTVEIYGAIKEVPEG----KEAPNGHELIADFWKIIGNAPPIDNVLNEEASVDKMLDNRHLVIRGENAAALLRLRAAATRAMREHFYNAGYVEVAPPTLVQTQVEGGSTLFNLDYFGEQSF--LTQSSQLYLETC-IPTLGDVFCIAQSYRAEKSRTRRHAEYAHVEAECPFITLDDLMEKIEELVCDTVDRLLADPERPFLRMEYKDAIKWLQEHNVENEFG-----------------------------------------------------------------------------------------------------------------------------------------NTFTYGEDIAEAAERFMTDTINKPILLNRFPSEIKAFRDAKDNTLTESVDLLMPGVEIVGGSMRIWKFDELSKAFKNVEIDPKP----YYWYLDQRLYGTCPHGGYGLGLERFICWLTNTNHIRDVCLYPRFVG....................................... 433
28 -79.0003i7f_A mol:protein length:548 Aspartyl-tRNA synthetase  ali model follow..  19  25.ELVSGENFKVMPMHQSLKYTEIEELVPAMAEKTVTIRARVQAVRGKGNMVFLFLRKGIYTCQALVMKSETISKCQKISAESICDITGIVKAVEKPI--EKATQQDVEIHVTSIAVVSLAEKASAQKYVKVSQDTRLDNRMLDLRTVTNIAIFRIQSACCGLFREFLTSQKFVEIHTPKLIGCSSEGGSNIFEVKYFDRKAY--LAQSPQLYKQMAIMGDFRKVFEVGPVFRAENSNTRRHTEFEGLDIEMEIVNYHECIDVMEKLFTFIFDEIPKRIYRPFLRLTYKEAIEMLRASGETIGDYDDF------------------------------------------------------------------------------------------------------------------------------------------TTPQEVKLGELIKAKYNTDFYILDKFPAAIRPFPDIDDPNYSNSYDVFVRGQEITSGAQRIHDPEFLMKRCIEKGVDPAT----LKDYIESFRFGSWPHAGCGIGLERITMLYLGIPNIRKVTLFPRDPIR------NP.............................. 548
29 -78.8001n9w_A mol:protein length:422 aspartyl-tRNA synthetase 2  ali model follow..  30  9...........................KAHVGQEVELLGFLHWRRDLGRIQFLLLRDRSGVVQVVTGGL------KLPLPESALRVRGLV-------VENAKAPGGLEVQAKEVEVLSPAEPTPVEIEWRANPDTLLEYRYVTLRGEKARAPLKVQAALVRGFRRYLDRQDFTEIFTPKVVRAGAEGGSGLFGVDYFEKRAY--LAQSPQLYKQ-IMVGVFERVYEVAPVWRMEEHHTSRHNEYLSLDVEMGFIDEEDLMRLEEALLAEMLEEALNTFPQDIPRLTHAEAKR-------------------------------------------------------------------------------------------------------------------------------------------ILKEELGYPVGQDLSEEAERLLGEYAKERWGSDWLFVTRYPRSVRPFYTYPEDGTTRSFDLLFRGLEITSGGQRIHRYEELLESLKAKGMDPEA----FHGYLEVFKYGMPPHGGFAIGAERLTQKLLGLPNVRYARAFPRDRH....................................... 418
30 -64.5003a5y_A mol:protein length:345 Putative lysyl-tRNA synthetase  ali model follow..  18  2................................................................................................................................GSSSSGLVPRGSHMSEQPSASIPNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIETRFVGPGHSQGMNLWLMTSPEYHMKRLLVAGCGPVFQLCRSFRNEEMGRYHNPEFTMLEWYRPHYDMYRLMNEVDDLLQQVLDC------PAAESLSYQQAFLRYLEIDPLSADKTQLREV--------------------------------------------AAKLDLSNVADTEEDRDTLLQLLFTFGVEP--------------------------------------------------------------------------NIGKEKPTFVYHFPASQASLAQTEDHRVAERFEVYYKGIELANGFHELTDAREQQQRFEQDNRRGLPQHPIDQNLIEALKVGMPDCSGVALGVDRLVMLALGAETLAEVIAFSVDRA....................................... 339
31 -61.6003p8t_A mol:protein length:294 AsnS-like asparaginyl-tRNA synthetase related protein  ali model follow..  19  2...........................................................................................................................................NAVEIISRDIYKAIDIQTKILDYMTKFFTDRGFKWLLPIMLSPITPDPAGEGIRPAEVD-GVRMRLTHSMILHKQLAIAMGLEKIFVLSPNIRLESRRKDHSYEFTQLDFEIEGAKMKDVMRLIEELIYGLFRKAEEPRARHFKVYDYKDILEEFGSDEKASM--------------------------------------------------------------------------------------------------------------------------------------------------------------EMEEPFWIVNIPREFYDREENG-VWKNYDLILPYGYGEVSSGGEREWEYEKIVAKIRAAGLKEDS----FRPYLEIARAGLKPSAGAGIGVERLVRFIVGAKHIAEVQPFPRVPGIPAVI.................................. 294
32 -61.0003g1z_A mol:protein length:326 Putative lysyl-tRNA synthetase  ali model follow..  19  9................................................................................................................................................QPSASIPNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIETRFVGPGHSQGINLYLMTSPEYHMKRLLAAGCGPVFQLCRSFRNEEMGRHHNPEFTMLEWYRPHYDMYRLMNEVDDLLQQVLDCQPAESLSYQQAFQRHLEIDPLSADKTQLREAAAKLDLSNIADTE--------------------------------------------------EDRDTLLQLLFTMGVEP--------------------------------------------------------------------------HIGKEKPTFIYHFPASQASLAQTEDHRVAERFEVYYKGIELANGFHELTDAREQQQRFEQDNRRGLPQQPIDQNLLDALAAGLPDCSGVALGVDRLVMLALGAESLADVIAFTVDRA....................................... 326
33 -58.1001nnh_A mol:protein length:294 asparaginyl-tRNA synthetase-related peptide  ali model follow..  18  2...........................................................................................................................................NAVEIISREISPTLDIQTKILEYMTDFFVKEGFKWLLPVIISPITPDPAGEGMEPAEVE-GVKMRLTHSMILHKQLAIAMGLKKIFVLSPNIRLESRQKDHAYEFTQLDFEVERAKMEDIMRLIERLVYGLFRKAEEPKTKRFEVFEYSEVLEEFGSDEKASQ--------------------------------------------------------------------------------------------------------------------------------------------------------------EMEEPFWIINIPREFYDREVDG-FWRNYDLILPYGYGEVASGGEREWEYEKIVAKIRKAGLNEDS----FRPYLEIAKAGLKPSAGAGIGVERLVRFIVGAKHIAEVQPFPRIPGIPAVI.................................. 294
34 -43.50011as_A mol:protein length:330 ASPARAGINE SYNTHETASE  ali model follow..  14  1....................................................................................................................................................MKTAYIAKQRQISFVKSHFSRQGLIEVQAPILSRVGDGTQDNLSVKVKALPDAQFEVVHSLAKWKRQTLFSAGEGLYTHMKALRDEDRLSPLH-YVDQWDWERVMGDGERQFSTLKSTVEAIWAGIKATLPDQIHFVHSQELLSRYPDLDAKGRERAIAKDLGAVFLVGIGGKLSDG---------------------------------------------------------------------------------------------------------------------------------HRHDVRAPDYDDWSTPSELGHAGLNGD----ILVWNPVLEDAFELSSMGIRVDADTLKHQLALT----GDEDRLELEWHQALLRGEMPQTIGGGIGQSRLTMLLLQLPHIGQVQAWPAAVRE...................................... 324
35 -43.3004lns_A mol:protein length:351 Asparagine synthetase a  ali model follow..  13  4..........................................................................................................................................DGYSSYV-LLQEQILTVKRSFSEALEKEL---NLVEVRAPILFRVGDGTQDNLSVPVKAIPNASFEVVHSLAKWKRRTLFAPGHGLYTHMTALRDDVLDNIHSVVVDQWDWEMVMKDDQRNLAFLKEVVCKVYAAIRKTELAVCEKYKQKPILPE----------------------------------------------------------------------TIQFVHAEHLLLAYPNLTAKEREREIAREYGAVFLI---------------------------------------GIGAVLSSGDRHDARAPDYDDWTSPVEASQVVFPRTSKPIPTMNSLSSLKGNPTLDDSLEVSSMGIRVNAEALRHQ----ISLTGDDSLLKSEWHQQLLNGEFPQTVGGGIGQSRMVMFMLRKKHIGEVQCWPEEIRKKHNLL................................. 351
36 -41.4005gro_A mol:protein length:115 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  39  3..............VGTMRSHFCTEISEKDVGKIVKVAGWCNTYRDHGGVVFIDLRDKSGLVQLVCDPSKAYEKALEVRSEFVLVAKGKVRLRGAGLENPKLKTGKIEIVLEELIIENKS.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 109
37 -37.9004gn5_A mol:protein length:113 OBody AM3L15  ali model follow..  25  2...............SPKKTHWTAEITPNLHGSEVVVAGWVAHLGDYGRVKIVKVSDREGGAAVPVYLEHLFKVFAELSREDVVVIKGIVEAGWPVAL-----DTGVEIFPSEIWILNKAKPLPID........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 113
38 -35.7004gn3_B mol:protein length:113 OBody AM1L10  ali model follow..  24  4.............SVYPKKTHWTAEITPNLHGTEVVVAGWVASLGDYGRVKIVKVSDREGGAAVSVYLEHLFKVFAELSREDVVVIKGIVEASKA---AADMHNG-VEIFPSEIWILNKAK............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 113
39 -35.7004gla_C mol:protein length:109 OBody NL8  ali model follow..  23  2.............SVYPKKTHWTAEITPNLHGTEVVVAGWVASLGDYGRVKIVKVSDREGGAAVPVYLEHLFKVFAELSREDVVVIKGIVEASK-------GVGRGVEIFPSEIWILNKAKA............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 109
40 -35.5004gn4_B mol:protein length:108 OBody AM2EP06  ali model follow..  23  2..............VYPKKTHWTAEITPNLHGSEVVVAGWVAHLGDYGRVKIVKVSDREGGAAVPVYLEHLFKVFAELSREDVVVIKGIVEASEQYGS-----ATGVEIFPSEIWILNKA.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 108
41 -35.0002zni_A mol:protein length:308 Pyrrolysyl-tRNA synthetase  ali model follow..  15  4........................................................................SSSGLVPRGSHMFLTRRDPPLSSFTKVQYQRLKELNASGEQLEMGFSDASRDRAFQGIEHQLMSQGKRHLELRTVKHRPAL---LELEEKLAKALHQQGFVQVVTPTILAKMTIGEDHPLFSQVFWLDGKKCLRLAPNLYTLWRLWDKPIRIFEIGTCYRKESQGAQHLNEFTMLNLTELGTPLEERHQRLEDMARWVLEAAG------IREFELVTESSVVYGDTVDVM........................................................................................................................................................................................................................................................................................................................ 238
42 -34.7004glv_B mol:protein length:107 OBody AM3L09  ali model follow..  23  2...............SPKKTHWTAEITPNLHGSEVVVAGWVAHLGDYGRVKIVKVSDREGGAAVPVYLEHLFKVFAELSREDVVVIKGIVEATTVTRW-----DTGVEIFPSEIWILNKA.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 107
43 -25.8004bw9_A mol:protein length:291 PYRROLYSINE--TRNA LIGASE  ali model follow..  12  4.................................................................................SSSGLVPRGSHMASAPALTKSQTDRLEVLLNPKDEISLNS--GKPFRELESELLSRRKKDLQQIYAE--ERENYLGKLEREITRFFVDRGFLEIKSPILIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLGNYLLPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQ--MGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVFGDTLDVMHGDLEL......................................................................................................................................................................................................................................................................................................................... 228
44 -25.6002e3c_A mol:protein length:291 Pyrrolysyl-tRNA synthetase  ali model follow..  15  13..........................................................................................SHMASAPALTKSQTDRLEVLLNPKDEISLN--SGKPFRELESELLSRRKKDLQQIYAE--ERENYLGKLEREITRFFVDRGFLEIKSPILIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLLPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCENLESIITDFLNHLLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFK........................................................................................................................................................................................................................................................................................................ 266
45 -24.7004tqd_A mol:protein length:291 Pyrrolysine--tRNA ligase  ali model follow..  16  7....................................................................................GLVPRGSHMASAPALTKSQTDRLEVLLNPKDEISLN--SGKPFRELESELLSRRKKDLQQIYAE--ERENYLGKLEREITRFFVDRGFLEIKSPILIERMGIDNDTELSKQIFRVDKNFCLRLAPNLYNYLRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLSFIQMGSGRENLESIITDFLNHLLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFK........................................................................................................................................................................................................................................................................................................ 266
46 -21.3003qtc_A mol:protein length:290 Pyrrolysyl-tRNA synthetase  ali model follow..  17  5.....................................................................................LVPRGSHGASAPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKK----DLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIERMGIDNDTELSKQIFRVDKNFCLRLTPNLYNYLRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLVFWQMGSGRENLESIITDFLNHL........................................................................................................................................................................................................................................................................................................................................................ 198
47 -21.2005k1p_A mol:protein length:274 Pyrrolysine--tRNA ligase  ali model follow..  18  3...........................................................................................................ALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKK-EERENYLGKLEREITRFFVDRGFLEIKSPILIERMGIDNDTELSKQIFRVDKNFCLRPAPNLYNYLRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLAFAQMGSGRENLESIITDFLNHL-DVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKV............................................................................................................................................................................................................................................................................................................. 244
48 -20.7004q6g_A mol:protein length:267 Pyrrolysine--tRNA ligase  ali model follow..  17  4...................................................................................................TKSQTDRLEVLLNPKDEISLNS------KPFRELESELLSRRKKLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIERMGIDNDTELSKQIFRVDKNFCLRVAPNIFNYARKLDR--KIFEIGPCYRKESDGKEHLEEFTMLNFFQM-CTRENLESIITDFLNHLLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKV............................................................................................................................................................................................................................................................................................................. 243
49 -19.3004cs2_A mol:protein length:274 PYRROLYSINE--TRNA LIGASE  ali model follow..  17  3...........................................................................................................ALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKK-EERENYLGKLEREITRFFVDRGFLEIKSPILIERMGIDNDTELSKQIFRVDKNFCLRLAPNLANYLRKLD---KIFEIGPCYRKESDGKEHLEEFTMLNFCQSGCTRENLESIITDFLNHL........................................................................................................................................................................................................................................................................................................................................................ 184
50 -14.2002j3l_A mol:protein length:572 PROLYL-TRNA SYNTHETASE  ali model follow..  13  1...........................................................................................MKQSKMLIPTLREVPNDAEVLSHQILLRAGYIRQVAAGI--------YSYLPL-------ANRVLEKLKTIMREEFEKIDAVEMLMPALLPAE-ETYGPNLYRLKDRNDRDYILGPTHEETFTELIRDEINSYYQIQTKYRDE-----RGREFIMKDGYSFHADEASLDQSYRD-YEKAYSRIFERCGLEFRAII-GDGGAMGGKDSKEFMAISEIGEDTICYSTESDYAANLEMATSLYTPKKSHETQLDLEKIATPEVGTIAEVANFFEVEPQRIIKSVLFIADEEPVMVLVRGDHDVNDVKLKNFLGADFLDEATEEDARRVLGAGFGSIGPVNVSEDVKIYADLAVQDLANAIVGANEDGYHLTNVNPDRDFQPISYEDLRFVQEGDPSPDGNGVLAFTKGIEIG-------------HIFK---LGTRYSDAMGATVLDENGREKSVIMGYGIGVSRLLSAIVEQNADERGINWPTG---------APFDLH-AMMTEAGYEVLVDDRNERAGVK... 515
51 -13.4005ucm_A mol:protein length:579 Proline--tRNA ligase  ali model follow..  12  1.........................................................................................MAMRTSQYLLSTLKETPADAVVISHQLLLRAGMIRRLASGL--------YTWLPM-------GLRVLRKVETIVREEMNAAGALEVLMPAVQPAE-EQYGPELLRLKDRHEREFCVGPTHEEVITDLARNELNSYYQIQTKFRDE-----RGREFIMKDAYSFHLSQDSLQQTYDGM-YQAYSKIFSRLGLDFRPVQ-ADNGSIGGSGSHEFHVLANSGEDDIVFSDSSDYAANIEKAEAVPRESARGSATEDMRLVDTPNTKTIAALVDGFQLPIEKTIKTLVVHGAEEGVALIVRGDHELNEIKAANQPLVASPLVFASEAEIRAAIGAGPGSLGPVNLPIACIVDRSVALMSDFAAGANIEDKHYFGVNWERD-LPLPEVADLRNVVEGDPSPDGKGTLVIKRGIEVG----------------HIFQLGTKYSEAMKLSVLSEQGKPVNLIMGYGIGVSRVVAAAIEQNHDERGILWPSALAPFQIALVPLKYETESELTAAGFEVLLDDRDKKTS..... 516
52 -12.4003hri_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  14  1....................................................................................................................MAMGTLEAQTQGPGSMQMNMVETEPVQGCRDFPPETMRLRKYLFDVFHSTARKFGFEEYDSPLYIRKAGEEITEQMFNFITKGGHRVALPEMTPSLARQLLAKGRSKWYSIPQCWRYEAITRGRRREHYQWNMDISVSSEVELVCAACTAMQSLGLSSKDVGVKINSRKILQTVVEQAGVSADKFAPVCVIVDKME-------------------------------------------------KLPREEVVAQLAAIGLESNVVDAITSTLSLKTIDEIAQRIGEEHEAVRELRDFITQI-EAYGFGDWVIFDASVVRGLAYYT--------------------------------------------GIVFEGFDRDGNFGGG--------------------------RYDNLLTTYGSPTAPCVGFGFGDCVIVELLNEKKLLPDDLVIPFDETMRPHALSILRRLRDAGRSDIVFDKKKVVQAFNYADRIGA 406
53 -11.7003net_A mol:protein length:465 Histidyl-tRNA synthetase  ali model follow..  13  1...............................................................................................................................SNAMAKNDKINFSTPSGFPEFLPSEKRLELYLLDTIRRVYESYGFTPIETPALEPILPPNRQAEKDKSGDTGSEARALFDQTVPLAAYIARHLNDARYQMDVVFRGERAKDGRFRQFRQCDIDVSLLYDAQMPAIITEIFEAV--NIGDFVIRINNRKVLTGFFQSLNISETQIKSCISIIDNLEKIGEAKVK---------------------LELEKEGINPEQTQKIIDFVKIDGSVDDVLDKLKHLSQTLPESEQFNLGVSELETVI-----------------------------------------------------------------------------TGVRNLGVPDKRFCIDLIARGLNYYTGT-----------VYETTLIGHEALGSRYEELVGTFIGEKMPGVGISIGLTRLISRLLKAGILNQVVVVNMQDELMPTYLKV-----SQQLRQAGLNVITNFEKRQLGKQ... 413
54 -11.5003hrk_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  14  1....................................................................................................................MAMGTLEAQTQGPGSMQKNMVETEPVQGCRDFPPEAMRCRRHLFDVFHATAKTFGFEEYDAPLYIRKAGEEITEQMFNFITKGGHRVALPEMTPSLARLLLGKGRSKWYSIPQCWRYEAITRGRRREHYQWNMDISVSAEVELVCAACWAMRSL------------------------GLSSKDVGIKVNSRKVLQTVVEQAGVTSDKFAPVCVIVDKMEKIPREEVEAQLA-------------------------VLGLEPTVVDAITTTLSLKSIDEIAQRVGEEHEAVKELRQFFEQV-EAYGYGDWVLFDASVVRGLAYYT--------------------------------------------GIVFEGFDREGKFGGG--------------------------RYDNLLTTYGSPTPPCAGFGFGDCVIVELLQEKRLLPDDVVIPFDESMRPHALAVLRRLRDAGRSDIILDKKKVVQAFNYADRVGA 406
55 -10.8004g85_A mol:protein length:517 Histidine-tRNA ligase, cytoplasmic  ali model follow..  11  17....................................................................................ALEELVKLQGERVRGLKQQKASAELIEEEVAKLLKLKAQLGPDESKQKFVLKTPKGTRDY----SPRQMAVREKVFDVIIRCFKRHGAEVIDTPVTLMGKYGEDSKLIYDLKDQGGELLSLYDLTVPFARYLAMNKLTKRYHIAKVYRRDAMTRGRYREFYQCDFDIPMIPDAECLKIMCEILSSL------------------------QIGDFLVKVN-------------------------------------------------------------------------DRRILDGMFAICGVSDSKFRTICSSVDKLDKVSWEEVKNEMVGEKGLAPEVADR--------IGDYVQQHGGVSLVEQLLQDPKLSQNKQALEGLGDLKLLFEYLTLFIDDKISFLARGLDYYTGV-----------IYEAVLLQTPAQAGEEPLGVGSVAAG--PCVGLSIGVERIFSIVEQDAGIKAELLYKKNPKLLNQLQYCEEAIGEQELKDGVIKLRSVTSREEVDVRRED 504
56 -10.7001wu7_A mol:protein length:434 Histidyl-tRNA synthetase  ali model follow..  12  3.......................................................................................................................................RLQIEKIRGFRDFYPEDMDVEKFIFKTAEEAAEAFGFRRIDFPSLRIKSGEELLQQTYSFVDKGGREVTLPEATPSTVRMVTSRKD-RWYSFPKVWRYEEPQAGRYREHYQFNADISPEADAEVIALASSILDRL--GLQDIYEIRINSRKIMEEIIGGMTSSDPFSVFSIIDRYHKISREE--------FVDQLRSAGIGEDGVSMIADLCSGTRGIDEMARITGKSSEEIARMAAVEDLLASYGVKNVRYDFSIVRG-------------------------------------------------------------------LSYYTGIV--------------------FEAYDRSGQFGGG--------------------------RYDNLASLMSGESVPAVGFGMGDAVISLLLKREREKKSVYICRVGKINSSIMNEYSRKLRERGMNTVEIMERGLSAQLKYASAIGA 383
57 -10.6001nnx_A mol:protein length:109 Protein ygiW  ali model follow..  18  24..................SVTTVESAKSLRDDTWVTLRGNIVERISDDLYVF---KDASGTINVDIDHKRWNGV--TVTPKDTVEIQGEV----------DKDWNSVEIDVKQIRKVNP............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 109
58 -10.3003rac_A mol:protein length:373 Histidine-tRNA ligase  ali model follow..  15  30.................................................................................................................................................QDGYPDFAKRRRAVETRLLSFVEDAGYEPVTSGTLLRARSPESSRDWIRLFDGGGDAVALR--PEMTPSIARMAAPRRWCYCERVYRRTDDPASLSWESTQVGIERSVDVDMDVLRLLHEASAAA--------------------------GVRHHRIVVSHARLVPRLLDA------------------LGISASLSRAFLACLTSGNYVQFRELWQLHAAKDVDLLANLLTWSPAERDAAKRSREASDRELEALLRDAVDPRAAADVRDAWRYLCRL--------------------------------------------------AEALHDSGLASDVVTFDLLHRELDYYTGL-----------VFEMFAPGVGAPIARYDELLAQFGAGAPA--GFAFEVERVMAVLEAQEEGEG................................................ 371
59 -10.1004g84_A mol:protein length:464 Histidine--tRNA ligase, cytoplasmic  ali model follow..  11  4................................................................................................................................SEFELRRQFVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFLMGKYGEDSKLIYDLKDQGGELLSLYDLTVPFARYLAMNKLTKRYHIAKVYRRDAMTRGRYREFYQCDFDIPMIPDAECLKIMCEILSSL--------------------------QIGDFLVKVNDRRILDGMFAICGVSDSKFRTICSSVDKLDKVSWEEVKNEMVGEKGLAPEVADRIGDYVQQHGGVSLVEQLLQDPKLSQNKQALEGLGDLKLLF----------------EYLTLFGIDDKISFDLSLARGLDYYTGVIYEAVLLQTPAQAGEEPLGVGSVAA-----------------GGRYDGLVG--MFDPKGRKV------------------------------------PCVGLSIGVERIFSIVEQDAGIKAELLYKKNPKLLNQLQYCEEAIGEQELKDGVIKLRSVTSREEVDVRRED 451
60 -9.7504rdx_A mol:protein length:423 Histidine--tRNA ligase  ali model follow..  15  2.......................................................................................................................................PMTARAVRGTKDLFGKELRMHQRIVATARKVLEAAGALELVTPIFEETATDIVRKEMFTFQDRGGRSLTLPEGTAAMVRAYLEHGMKRLWMAGPMFRAERPQKGRYRQFHQVNYEANPILDAEAVVLLYECLKEL----LRRLKVKLSSVGDPEDRARY----------------------------------------------------------------------------NAYLREVLSPHREALSEDSKER---------------------LELNPMRILDSKSERDQALLKELGVRPMLDFLGEEARAHLKEVERHLERLSVPYELE-----PALVRGLDYYVRTAFEVHHEEIGGGGG--------------------------RYDGLSELLGGPRVPGVGFAFGVERVALALEAEEKGPDLYLIPLTEEAVAEAFYLAEALRPRLRAEYALAPRKPAKGLEEALKRGA 380
61 -9.7204e51_A mol:protein length:467 Histidine--tRNA ligase  ali model follow..  13  1.................................................................................................................MAMGTLEAQTQGPGSMTEQKRKLEKLTGVKGMNDILPQDAGLWEFFEATVKSLLRAYGYQNIRTPIVEHTP--GEVTDIVEKEMYSGENLTLPENTAAVVRAAIEHNMLRLWYIGPMFRHERPQRGRYRQFHQVGVEA------------------------------------------LGFAGPDADAEI--------------------------------------------------------------------------MMCQRLWEDLGLTGIKLEINSLGLAEERAAHRVELIKYLEQHADKLDDDAQR--------------------RLYTNPLRVLDTKNPALQEIVRNAPKLIDFLGDVSRAHFEGLQRLLKANNVPFTINPRLVRLTVFEWVTDKLGAQGTRYDPLIEQLGGKPTAACGWAMGIERILELLKEEHLVPDVYVVHQGDAAREQAFIV-----AERLRDTGLDVILHCSADGAGASFKS 393
62 -9.5803od1_A mol:protein length:400 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  13  17.................................................................................................................................................RDTLPEWYKTKKNICDQMTEEINLWGYDMIETPTLVGVVSAILDQQLFKLLDQQGNTLVLR--PDMTAPIARLVASSRLAYQSNVYRAQQNEGGKPAEFEQLGVELTASADGEVIALMIAALKRA--------------------------GLSEFKVAIGHVGYVNALLMD-----------------------------VVGNEQRADRLRRFLYEKNYVGYREHVKSLNLSTIDKSRLMNLLSLRGGRAAIEEARGLIQTEKGKTALAEMTKLYEVLESYGASEYVKFDLTLVLHMSY--------------------YT------------------GVVFEGYGNGVPLCSGG-------------------------RYDELLSKFHRPAQA--GFGVRIDLLVEALNGEIISNGCILFSNERRFEAIEL-------ARKKRANGEAVVLQDLAGVTDVD... 377
63 -9.5002el9_A mol:protein length:431 Histidyl-tRNA synthetase  ali model follow..  12  4..................................................................................................................................YQDPMAKNIQAIRGMNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTP--GEVTDVVEKEMRNGDSLTLPEGTAGCVRAGIEHGLLRLWYIGPMFRHERPQKGRYRQFHQLGCEVGPDIDAELIMLTARWWRAL--GISEHVTLELNSIGSLEARANY------------------------------------------------------------------------RDALVAFLEQHKEKLDEDCKRRMYTNPLRVLDSKNPEVQALLNDAPALGDYLDEESREHFAGLCKLLESAGIAYTVNQRLVRGLDYYNRTVFEWVTN---------------------------SLGSQGTVCAGG--------------------------RYDGLVEQLGGRATPAVGFAMGLERLVLLVQAVDPVVDIYLVASGADTQSAAMALAERLRDEL....................... 362
64 -9.0605f9y_A mol:protein length:511 Aminoacyl-tRNA synthetase  ali model follow..  10  1...................................................................................................................MASKENESLLGITADKITSFADWYSQVIVKSEMIEYYYFIWETIQSVFDQKIKQHDVQNAYFPIFVTQKSDLAEPIAIRPTSETIMYPYFAKWIRSHRDLPL-----KINQWTSIVRWEFKHP-RTREFLWQEGHTAHSTRKEALEMVDIIL-NEYASIYEDLLATPVVKGTKSENEKFPGGDITKSIEGFIPEIGRAVQAAT-------------------------------------------------------SHLLGQNFSKMFGVEFEDEKGNKEYAHQTSWGLTTRAIGVMIMTHGDNKGLVLPPKVAPVQVIIIPIIFKTVITEEQKKICNEVEC-KAGVRVKIDDRSNYTPGWKYNHWEVKGVCLRFEVGPRDIEKRSVRVVVRDNMEKMDELESKIPKLLEEFQNRLLFKAKQRQNESIIRVDTFDKVMDTLCEDVSCEEEI---KKETARLSLDNEDNQSMTGAMKSLCIPNDQIFKIEEGKTK... 487

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 4 6 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Sasin JM, Godzik A, Bujnicki JM. SURF'S UP! - protein classification by surface comparisons. J Biosci. 2007 Jan;32(1):97-100.