current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 4p71_C mol:protein length:338 Phenylalanine--tRNA ligase alpha subunit, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .
# Score Template Links and tools%idFirst MENLDALVSQALEAVRHTEDVNALEQIRVHYLGKKGELTQVMKTLGDLPAEERPKVGALINVAKEKVQDVLNARKTELEGAALAARLAAERIDVTLPGRGQLSGGLHPVTRTLERIEQCFSRIGYEVAEGPEVEDDYHNFEALNIPGHHPARAMHDTFYFNANMLLRTHTSPVQVRTMESQQPPIRIVCPGRVYRCDSDLTHSPMFHQVEGLLVDEGVSFADLKGTIEEFLRAFFEKQLEVRFRPSFFPFTEPSAEVDIQCVICSGNGCRVCKQTGWLEVMGCGMVHPNVLRMSNIDPEKFQGFAFGMGAERLAMLRYGVNDLRLFFDNDLRFLGQFRLast
1 -133.0004p71_C mol:protein length:338 Phenylalanine--tRNA ligase alpha subunit  ali model  100  1MENLDALVSQALEAVRHTEDVNALEQIRVHYLGKKGELTQVMKTLGDLPAEERPKVGALINVAKEKVQDVLNARKTELEGAALAARLAAERIDVTLPGRGQLSGGLHPVTRTLERIEQCFSRIGYEVAEGPEVEDDYHNFEALNIPGHHPARAMHDTFYFNANMLLRTHTSPVQVRTMESQQPPIRIVCPGRVYRCDSDLTHSPMFHQVEGLLVDEGVSFADLKGTIEEFLRAFFEKQLEVRFRPSFFPFTEPSAEVDIQCVICSGNGCRVCKQTGWLEVMGCGMVHPNVLRMSNIDPEKFQGFAFGMGAERLAMLRYGVNDLRLFFDNDLRFLGQFR 338
2 -126.0003pco_A mol:protein length:327 Phenylalanyl-tRNA synthetase, alpha subunit  ali model follow..  67  1MSHLAELVASAKAAISQASDVAALDNVRVEYLGKKGHLTLQMTTLRELPPEERPAAGAVINEAKEQVQQALNARKAELESAALNARLAAETIDVSLPGRRIENGGLHPVTRTIDRIESFFGELGFTVATGPEIEDDYHNFDALNIPGHHPARADHDTFWFDTTRLLRTQTSGVQIRTMKAQQPPIRIIAPGRVYRNDYDQTHTPMFHQMEGLIVDTNISFTNLKGTLHDFLRNFFEEDLQIRFRPSYFPFTEPSAEVDVM-----------GKNGKWLEVLGCGMVHPNVLRNVGIDPEVYSGFAFGMGMERLTMLRYGVTDLRSFFENDLRFLKQFK 327
3 -114.0001b70_A mol:protein length:350 PHENYLALANYL-TRNA SYNTHETASE  ali model follow..  48  1......MLEEALAAIQNARDLEELKALKARYLGKKGLLTQEMKGLSALPLEERRKRGQELNAIKAALEAALEAREKALEEAALKEALERERVDVSLPGASLFSGGLHPITLMERELVEIFRALGYQAVEGPEVESEFFNFDALNIPEHHPARDMWDTFWLTGEGLLRTHTSPMQVRYMVAHTPPFRIVVPGRVFRFEQDATHEAVFHQLEGLVVGEGIAMAHLKGAIYELAQALFGPDSKVRFQPVYFPFVEPGAQFAVWWPEG----------GKWLELGGAGMVHPKVFQAVDAYREGVTGFAFGLGVERLAMLRYGIPDIRYFFGGRLKFLEQFK 347
4 -109.0002rhq_A mol:protein length:294 Phenylalanyl-tRNA synthetase alpha chain  ali model follow..  52  1.......................................................MGSSSSGLVPRGSHMGTELMEKLN-----QQLAEETIDVTLPSRQISIGSKHPLTRTVEEIEDLFLGLGYEIVDGYEVEQDYYNFEALNLPKSHPARDMQDSFYITDEILMRTHTSPVQARTMEKRNGPVKIICPGKVYRRDSDATHSHQFTQIEGLVVDKNIKMSDLKGTLELVAKKLFGADREIRLRPSYFPFTEPSVEVDVSCFKCKGKGCNVCKHTGWIEILGAGMVHPNVLEMAGFDSNEYSGFAFGMGPDRIAMLKYGIEDIRYFYTNDVRFLEQFK 281
5 -100.0003l4g_A mol:protein length:508 Phenylalanyl-tRNA synthetase alpha chain  ali model follow..  21  120.ADGPRVFRVVDSMEDEVQRRLQLVRGGQAEKLGEKERSELRKRKLLAEVTLKTYWVSKGSAFSTSISKQETELSPEMISSGSWRDRPFKPYNFLAHGVLPDSGHLHPLLKVRSQFRQIFLEMGFTEMTDNFIESSFWNFDALFQPQQHPARDQHDTFFLRDPAEALQLPMDYVQRVKRTHSTPVKYFSIDRVFRNETDATHLAEFHQIEGVVADHGLTLGHLMGVLREFFTKLGIT--QLRFKPAYNPYTEPSMEVFSY----------HQGLKKWVEVGNSGVFRPEMLLPMGL-PENVSVIAWGLSLERPTMIKYGINNIRELVGHKVNLQMVYD 489
6 -71.8002du3_A mol:protein length:534 O-phosphoseryl-tRNA synthetase  ali model follow..  17  3.FDPQKYRELAEKDFEAARSPNELYPRVGFSFGKEHPLFATIQRLREAYLSIGSEVVNPLIVEDVHVKKQFGREALAVLDRCFYLATLPKPNVGISAEKIRQIEAITKREVDSKPLQEIFHRYKKGEIDGDDLS--YLIAEVLDVDDITAVKILDEVFPISSTLTLRSHMTTGWFITLDKLPLPIKLFSIDRCFRREEDATRLYTYFSASCVLVDEELSVDDGKAVAEALLRQFGFENFRFRKDEKRSKYYIPDTQTEVFAFHPKLVGSSTKYSDGWIEIATFGIYSPTALAEYDIP---YPVMNLGLGVERLAMILYGYDDVRKMVYPQIHGEIKLS 358
7 -70.1005x6c_A mol:protein length:553 O-phosphoserine--tRNA(Cys) ligase  ali model follow..  16  17.FDIKKVLELAEKDFETAKHIDNKYPRLKPVYGKPHPVMETIERLRQAYLRMGFEEMINPVIVDEM--EIYKQFGPEAMAVLDRCFYLAGLPRPDVGLGNEKVEIIKNLGIDIDEEKKERLREVLHLYKKGAIDGDFEIAKALNVSNEMGLKVLETAFPESTTLTLRSHMTSGWFITLKKRKLPLKLFSIDRCFRREQDRSHLMSYHSASCVVVGEDVSVDDGKVVAEGLLAQFGFTKFKFKPDEKKSKYYTPETQTEVY--------AYHPKLGEWIEVATFGVYSPIALAKYNID---VPVMNLGLGVERLAMIIYGYEDVRAMVYPQFYEYRLSD 366
8 -61.7003cmq_A mol:protein length:415 Phenylalanyl-tRNA synthetase, mitochondrial  ali model follow..  29  1...........................................................MAAECATQRAPGSVVELLGKSYPQDDHSNLTRKVLTRVGRNLHNQQHHPLWLIKERVKEHFYKQYVGRFGTPPVVTTWQNFDSLLIPADHPSRKKGDNYYLNRTHMLRAHTSAHQWDLLHA--GLDAFLVVGDVYRRDQIDSHYPIFHQLEAVRLFSKLVEFDLKQTLTRLMAHLFGDELEIRWVDCYFPFTHPSFEMEINF------------HGEWLEVLGCGVMEQQLVNSAGAQDR--IGWAFGLGLERLAMILYDIPDIRLFWCEDERFLKQFC 308
9 -52.5004q6g_A mol:protein length:267 Pyrrolysine--tRNA ligase  ali model follow..  15  1.....................................................PALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPL-EYIERMGIDNDTELSKQIFRV--DKNFCLRPMVAPNIFNYARKLPDPIKIFEIGPCYRKESDGKHLEEFTMLNFFQMGSGCTRENLESIITDFLNHLGIDFK--IVGDSCSVYGDTLDVMH-----------------GDLELSSAVVGPIPLDREWGIDKP---WIGAGFGLERLLKVKHDFKNIKRAARSESYY..... 260
10 -49.9004tqd_A mol:protein length:291 Pyrrolysine--tRNA ligase  ali model follow..  13  2.................................................................................GSSSSGLVPRGSHMASAPALTKSQTDRLEVLLNPKDEISLNSGFRELESELLSRRKKDLQQIYAEERENEREITRFFVVDKNFCLRPMLAPNLYNYLRKLPDPIKIFEIGPCYRKEDGKEHLEEFTMLSFIQMGSGCTRENLESIITDFLNHLGID--FKIVGDSCMVYGDTLDVM-----------------HGDLELSSAVVGPIPLDREWGIDKP---WIGAGFGLERLLKVKHDFKNIKRAARSESYY..... 278
11 -48.4005k1p_A mol:protein length:274 Pyrrolysine--tRNA ligase  ali model follow..  14  2.....................................................PALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEY-IERMGIDNDTELSKQIFRV--DKNFCLRPMLAPNLYNYLRKLPDPIKIFEIGPCYRKEDGKEHLEEFTMLAFAQMGSGCTRENLESIITDFLNHLGIDFK--IVGDSCMVYGDTLDVMH-----------------GDLELSSAVVGPIPLDREWGIDKP---WIGAGFGLERLLKVKHDFKNIKRAARSESYY..... 261
12 -39.0002e3c_A mol:protein length:291 Pyrrolysyl-tRNA synthetase  ali model follow..  13  2.................................................................................GSSSSGLVPRGSHMASAPALTKSQTDRLEVLLNPKDEISLNSGFRELESELLSRRKKDLQQIYAEERENYLEITRFFVVDKNFCLRPMLAPNLYNYLRKLDDPIKIFEIGPCYRKEDGKEHLEEFTMLNFCQMGSGCTRENLESIITDFLNHLGIDFK--IVGDSCMVYGDT-----------------LDVMHGDLELSSAVVGPIPLDREWGIDKP---WIGAGFGLERLLKVKHDFKNIKRAARSGSYY..... 278
13 -28.9004bw9_A mol:protein length:291 PYRROLYSINE--TRNA LIGASE  ali model follow..  16  8...............................LVPRGSHMASAPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQI-----------YAEERENYLGKLEREITRFFVDRGFLEIKSPILI-----------PLEYIERMGIDNFRVDKNFCLRPMLAPNLGNYLRKLPDPIKIFEIGPCYRKESDGKHLEEFTMLNFCQMGSGCTRENLESIITDFLNHL-------------------GIDFKIVGDSCMVFGDTLDVMHGDLELSSAVVGPRPLDREWGIDKP---WIGAGFGLERLLKVKHDFKNIKRAARSES-YYNGIS 282
14 -28.5004cs2_A mol:protein length:274 PYRROLYSINE--TRNA LIGASE  ali model follow..  16  1.........................................MPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQI-----------YAEERENYLGKLEREITRFFVDRGFLEIKSPILI-----------PLEYIERMGIDNFRVDKNFCLRPMLAPNLANYLRKLPDPIKIFEIGPCYRKESDGKHLEEFTMLNFCQMGSGCTRENLESIITDFLNHL-------------------GIDFKIVGDSCMVFGDTLDVMHGDLELSSAVVGPIPLDREWGIDKP----IGAGFGLERLLKVKHDFKNIKRAARS-ESYYNGIS 265
15 -28.5003qtc_A mol:protein length:290 Pyrrolysyl-tRNA synthetase  ali model follow..  16  5...............................LVPRGSHGASAPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQI-----------YAEERENYLGKLEREITRFFVDRGFLEIKSPILIPL---IERMGIDNDTELSKQIFR--VDKNFCLRPMLTPNLYNYLRKLPDPIKIFEIGPCYRKESDGKHLEEFTMLVFWQMGSGCTRENLESIITDFLNHL-------------------GIDFKIVGDSCMVFGDTLDVMHGDLELSSALVGPIPLDREWGIDKP---WIGAGFGLERLLKVKHDFKNIKRA-ARSESYYNGIS 279
16 -19.7002zni_A mol:protein length:308 Pyrrolysyl-tRNA synthetase  ali model follow..  14  13.............................SHMFLTRRDPPLSSFWTKVQYQRLKELNASGEQLEMGFSDALSRDRAFQGIEHQLMSQGKRHLEQLRTVKHRPA-----LLELEEKLAKALHQQGFVQVVTPTIITKS--LAKMTIGEDHPLFSQVFW--LDGKKCLRPMLAPLWRELERLWDKPIRIFEIGTCYRKEQGAQHLNEFTMLNLTELGTPLEHQRLEDMARWVLEAAGIREFELVTESS------------------VVYGDTVDVMKGDLELASGAMGPHFLDEKWEIFDP---WVGLGFGLERLLMIREGTQHVQSMARS......... 290
17 -14.4003p8t_A mol:protein length:294 AsnS-like asparaginyl-tRNA synthetase related protein  ali model follow..  16  19.............................................................................................................TKILDYMTKFFTDRGFKWLLPIMLSPI----DPLWPDPAGEGIRPAEVDVYGVRMRLTHSMILHKQLAIAMGLE--KIFVLSPNIRLESRRKHSYEFTQLDFEIE---AKMKDVMRLIEELIYGLFRKAEEWTGRPRARHFKVYDYKDILEEFGSDEKASMEMEEPFWIEVSSGGE---AKIRAAGLKEDSFRPYGAGIGVERLVRFIVGAKHIAEV............ 281
18 -14.3001nnh_A mol:protein length:294 asparaginyl-tRNA synthetase-related peptide  ali model follow..  16  19.............................................................................................................TKILEYMTDFFVKEGFKWLLPVIISPI----DPLWPDPAGEGMEPAEVEIYGVKMRLTHSMILHKQLAIAMGLK--KIFVLSPNIRLESRQKHAYEFTQLDFEVE---AKMEDIMRLIERLVYGLFRKAEE-REFPKTKRFEVFEYSEVLEEFGSDEKASQEMEEPFWIEVASGGE---AKIRKAGLNEDSFRPYGAGIGVERLVRFIVGAKHIAEV............ 281
19 -12.6001asy_A mol:protein length:490 ASPARTYL-tRNA SYNTHETASE  ali model follow..  12  69..LIQGLVKANKEGTISKNMVKWAGSLNLEIVLVRGIVKKVDEPIKSATVQNLEIHITKIYTISETPEALPILLEDASRSEAEAEAAGLPVVNLDTRLDYRVIDLRTV-AGVCELFREYLATKKFTEVHTPKLLGA----------PSEGGSSVFEVTYFKGKAYLAQSPQFNKQQLIVADFE--RVYEIGPVFRAENSNTHMTEFTGLDMEMAFEE-HYHEVLDTLSELFVFIFSEPVEEFKLPKDGKMVRLTYKEGIEMLRAAGKEIGDFEDLS--EILSGAQLLQERMKAHGLSPEDPG--GGGIGLERVVMFYLDLKNIRRA............ 478
20 -12.4005xix_A mol:protein length:472 Asparagine--tRNA ligase, cytoplasmic  ali model follow..  12  67.......LRDGTGYLQCVLADELCQCYNGVLLSTESSVAVYGMLNLTPKGKQAPGGHELSCDFWELIGLAPAGGADNLINEESDVDVQLNNRHMMIRGENMSK--LKARSMVTRCFRDHFFDRGYYEVTPPTLVQT----------QVEGGATLFKLDYFGEEAFLTQSSQLYLETCLPALG---DVFCIAQSYRAEQSRTHLAEYTHVEAECP---LTFDDLLNRLEDLVCDVVDRILKSPAGSIVHPFKRMNYSDAIVWLKEHDVKKEDGTFYEF-EIVGGSM---AGYKREGIDPTPYYWYGYGLGLERFLTWILNRYHIRDV............ 454
21 -12.3001b8a_A mol:protein length:438 PROTEIN (ASPARTYL-TRNA SYNTHETASE)  ali model follow..  13  49TAPKKKVDPELFKLIPKLRDVVAVEGVVNFTPKAKLGFEILPEKIVVLNRAETPLPLDPTGKVKAELDTRLNNRFMDLRRPEVMAIFKIR-------------------SSVFKAVRDFFHENGFIEIHTPKIIAT----------ATEGGTELFPMKYFEEDAFLAESPQLYKEIMMASGLD--RVYEIAPIFRAEEHNTHLNEAWSID-SEMAFIEDEEEVMSFLERLVAHAINDILNFELEEPKLPFPRVSYDKALEILGDLGKEIPWGEDID--EISSGGQILVEQIKEKGLNPESFEFYGFGLGAERLIKQMLDLPNIREV............ 426
22 -12.3004j15_A mol:protein length:521 Aspartate--tRNA ligase, cytoplasmic  ali model follow..  13  101VQALVAVGDHASKQMVKFAANINKESI----VDVEGVVRKVNQKIGSCTQQDVELHVQKIYVISLAEPRLPLQLDDAVRPEAEGEEEGRATVNQDTRLDNRVIDLRTS-SGICHLFRETLINKGFVEIQTPKIISA----------ASEGGANVFTVSYFKNNAYLAQSPQLYKQMCICADFE--KVFSIGPVFRAEDSNTHLTEFVGLDIEMAFNY-HYHEVMEEIADTMVQIFKQTVNKQFPCEPFKFLEPTLRLEYYPLAVRPFYTMPDPRNPKQEILSGAQLLTERALHHGIDLEKIKAYGGGIGLERVTMLFLGLHNVRQT............ 503
23 -12.2002xti_A mol:protein length:437 ASPARAGINYL-TRNA SYNTHETASE, CYTOPLASMIC, PUTATIVE  ali model follow..  13  36......ILRDGTGFLQVLLMDKLCQTYDALTVNTECTVEIYGAIKEVPEGKEAPNGHELIADFWKIIGNAPPGGIDNVLNEEASVDKMLDNRHLVIRGENAAA--LRLRAAATRAMREHFYNAGYVEVAPPTLVQT----------QVEGGSTLFNLDYFGEQSFLTQSSQLYLETCIPTLG---DVFCIAQSYRAEKSRTHLAEYAHVEAECP---ITLDDLMEKIEELVCDTVDRHINPKFQPPERPFLRMEYKDAIKWLQEHNVENEFGNTFTY-EIVGGSM--SKAFKNVEIDPKPYYWYGYGLGLERFICWLTNTNHIRDV............ 425
24 -11.8003m4p_A mol:protein length:456 Asparaginyl-tRNA synthetase, putative  ali model follow..  13  54LRDGSGYCQCVIFGKELCEPEKVKLLTRECSLEITGRLNAYAGKNHPPEIADILNLEMQVTEWKVIGESPIDLENIINKDSSIPQKMQNRHIVIRSEHTQ---QVLQLRSEIQWYFRKYYHDNHFTEIQPPTIVKT----------QCEGGSTLFKLQYFNEPAYLTQSSQLYLESVIASLG---KSFCMLSSYRAEQSRTHLAEYLHLEAELP---ISFEDLLNHLEDLVCTVIDNKMNPHLKLPTRPFKRMTYADAIKYCNDHGILNKDKPFPGVGEIVGGSMELMGAYKANGLNPDPYYWYGYGLGVERLVMWLLGEDHIRKV............ 444
25 -11.7001wyd_A mol:protein length:429 hypothetical aspartyl-tRNA synthetase  ali model follow..  13  46GQVVVDKNSSAFGISQELTSVIQVRGIVKADKRAPRGIELHAEEITLLSKAKAPLPLDVSGKVKADIDTRLRERVLDLRRQEMQAVIKIQ-------------------SLALKAFRETLYKEGFIEIFTPKIIAS----------ATEGGAQLFPVIYFGKEAFLAQSPQLYKELMAGVVE---RVFEVAPAWRAEESDTHLAEFISMDVEMA---ADYNDVMQLLEKILHNIVKKILNYEPPEVKIPIKRLKYTEAIEILRSKGYNIKFGDD-KFLEIVSGSTVLEEALKKKGLKPESFEFFGFGMGLARLMVMLTGIQSVKEI............ 417
26 -11.6001n9w_A mol:protein length:422 aspartyl-tRNA synthetase 2  ali model follow..  17  5VRDLKAHVGQEVELLGFLHWRRDLGRIQFLLLRRSGVVQVVTGGLKLPLPESALRVGLVVENAKAPGGLEVQAKEVEVLSPALEPTPVEIPKEEWRANPDTLLEYRY--AALVRGFRRYLDRQDFTEIFTPKVVRA----------GAEGGSGLFGVDYFEKRAYLAQSPQLYKQIMVGVFE---RVYEVAPVWRMEEHHTHLNEYLSLD-VEMGFIADEEDLMRLEEALLAEMLEERYPRSVRPFYTYPEEDGTTRSFDLLFRGL------------EITSGGQELLESLKAKGMDPEAFHGYGFAIGAERLTQKLLGLPNVRYA............ 410
27 -11.5003i7f_A mol:protein length:548 Aspartyl-tRNA synthetase  ali model follow..  13  248.............................................................................................................SACCGLFREFLTSQKFVEIHTPKLIGC----------SSEGGSNIFEVKYFDRKAYLAQSPQLYKQMAIMGDFR--KVFEVGPVFRAENSNTHLTEFEGLDIEMEIVE-NYHECIDVMEKLFTFIF-DEIPKRFPDEL-PFLRLTYKEAIEMLRASGETIGDYDDFT--EITSGAQFLMKRCIEKGVDPATLKDYGCGIGLERITMLYLGIPNIRKV............ 536
28 -11.4003l4g_B mol:protein length:589 Phenylalanyl-tRNA synthetase beta chain  ali model follow..  283..TVEAAEVVFPNGKSHTFPELAYRKEMVRADLINKKVGIRETPENLAKLLTRMYLKSEVIGDGNQIEIEIPPTRADIIHACDIVEDAAIAYGYNNIQMTLPKANQFPLNKLTELLRHDMAAAGFTEALTFALCSQEDIADKLGVDISATKAVHISNPKTAEFQVARTTLLPGLLKTIAANRKPLKLFEISDIVKDSNTDVGAKNYRHLCAVYYNKNPGFEIIHGLLDRIMQLLDVPPGEDKGGYVIKASEGPAFF--------PGRCAEIFARGQ--SVGKLGVLHPDVITKFEL---TMPCSSLEINIGPFL........................ 589
29 -11.3001x54_A mol:protein length:434 Asparaginyl-tRNA synthetase  ali model follow..  12  38......WIRDSTGIVQAVVAKNVVGEETFEKAKK--GRESSVIVEGIVKADERAPGGAEVHVEKLEVIQAVSEFPIPENPEQASPELLLDYRHLHIRTPKASA--MKVKETLIMAAREWLLKDGWHEVFPPILVTG----------AVEGGATLFKLKYFDKYAYLSQSAQLYLEAAIFGLE---KVWSLTPSFRAEKSRTHLTEFWHLELEAA---MDLWDIMKVEEELVSYMVQRTLRISYDEAIDILQSKGVNVEWGDDLGADEERVLTEEEGYGEIIGGSQREDDYILEEGMDPKDYEWYGFGLGVERLVAWVLKLDHIRWA............ 422
30 -10.4004h2w_A mol:protein length:346 Amino acid--[acyl-carrier-protein] ligase 1  ali model follow..  12  3.....................................................SSSSGLVPRGSHMNIAVLPNSPDTAPQIADPLDHLADKLFHSMDGVYARTALYESIVERLAALITSHREAGTEALRFPPVMSRLKSFPNLLGCVCGLHGTERETTSLSPADLVLSPAAPIAASRGPLPKGGLRFDVAADCFRREPSKDRLQSFRMREYVCIGTPDDVSDFRERWMVRAQAIARDGLTFRVDYASDPFGKMLANNQRDQQLKFELLIPLRSEEQPTACMSFNYHREHFGTTWGINGEPAHTGCVAFGMDRLAVAMFH-AKVRDILGLQ........ 327
31 -10.3003mey_A mol:protein length:346 Bll0957 protein  ali model follow..  11  1.........................................MGSSSSGLVPRGSHMNIAVLPNSPDTAPQIADPLDHLADKLF--------HSMGSDGVYARTALYESIVERLAALITSHREAGTEALRFPPVMSRLKSFPNLLGCVCGLHGTEREI-SLSPADLVLSPAAPIAASRGPLPKGGLRFDVAADCFRREPSKDRLQSFRMREYVCIGTPDDVSDFRERWMVRAQAIARDGLTFRVDYASDPFGQMKAVSQKQQQLKFELLIPLRSEEQPTACMSFNYHREHFGTTWGINGEPAHTGCVAFGMDRLAVAMFH-AKVRDILGLQ........ 327
32 -9.8103g1z_A mol:protein length:326 Putative lysyl-tRNA synthetase  ali model follow..  15  21.............................................................................................................AAIMAEIRRFFADRGVLEVETPCMSQA--HLFPFETRFVGPGHSQGINLYL------MTSPEYHMKRLLAAGCG--PVFQLCRSFRNEMGRHHNPEFTMLEWYRPHYDMYMNEVDDLLQQVLDCQPAESLSYQLQLLFTMGVEPHIGKETFIYHFPASQASLAQIST-FEVYYKGIIDQNLLDALAAGLPDCSGV--ALGVDRLVMLALGAESLADV............ 318
33 -9.4902cim_A mol:protein length:522 SERYL-TRNA SYNTHETASE  ali model follow..  12  133IKSMENIEGGIQLELEVGEAEMKNRV-------PDRILTLLEEKIEAAQYGAKAEHWNLLWQREPMEHPFKEDPTQAMMKEGWLKRGSSRGQWIHGP----------QSARIFRTFEKIVLELGYREMIFPKLTRDPDYWEEV-VPTKLIKEKIAEPIGGMCYAQCPPFWMYVAGETLPNEEIPVKVFDSGTSHRYESGGIH--EFHRIEIVWIGTKEEVLKCAEELHDRYMHIFND-RKARVTPWFMAQEGLLGLAEENTVGTTDYEACL-PDGEWLEFQNVSINGDKYPKGFNVSGDELWSGCSGVGLERWAAVF-----LAQKGLDPANWPEEFR 503
34 -9.2304lns_A mol:protein length:351 Asparagine synthetase a  ali model follow..  12  12........................................................................................................LQEQILTVKRSFSEALEKLNLVEVRAPILFRVGDGTQDNLSGFEKAVQVPVKAIPNASFEVVHSLAKWKRRTLANYKFAPGGLYTHMTALRVDDVLDHSVVVDQWD-VMKDDQRNLAFLKEVVCKVYAAIRKTELAVCEKPETIQFVHAEHLLLAYPNLTAKEREREIAREY-LEVSSMGILRHQISLTGDDSLLKSEWHGGGIGQSRMVMFMLRKKHIGEVWPEEIRKKHNL. 350
35 -9.1203a5y_A mol:protein length:345 Putative lysyl-tRNA synthetase  ali model follow..  14  34.............................................................................................................AAIMAEIRRFFADRGVLEVETPCMSQA--HLVPFETRFVGPGHSQGMNLWL------MTSPEYHMKRLLVAGCG--PVFQLCRSFRNEMGRYHNPEFTMLEWYRPHYDMYMNEVDDLLQQVLDCPAAESLSYQLQLLFTFGVEPNIGKETFVYHFPASQASLAQIST-FEVYYKGIIDQNLIEALKVGMPDCSGV--ALGVDRLVMLALGAETLAEV............ 331
36 -9.05011as_A mol:protein length:330 ASPARAGINE SYNTHETASE  ali model follow..  12  8........................................................................................................KQRQISFVKSHFSRQLEELGLIEVQAPILSRVGDGTQDNLSGAEKAVQVKVKALPDAQFEVVHSLAKWKRQTLGQHDFSAGGLYTHMKALRPDEDRLHSVYVDQWERVMGDGERQFSTLKSTVEAIWAGIKATEAAVSEEFGLAPFLPDQIAPDYDDWSTPSELGHAGLNGDILELSSMGILKHQLALTGDEDRLELEWHGGGIGQSRLTMLLLQLPHIGQVQAG......... 316

FFAS is supported by the NIH grant R01-GM087218-01
1 2 6 4 6 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Rodrigues AP, Grant BJ, Godzik A, Friedberg I. The 2006 automated function prediction meeting. BMC Bioinformatics. 2007 May 22;8 Suppl 4:S1-4.