current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 4pv4_A mol:protein length:445 Proline aminopeptidase P II, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .
# Score Template Links and tools%idFirst MTQQEYQNRRQALLAKMAPGSAAIIFAAPEATRSADSEYPYRQNSDFSYLTGFNEPEAVLILVKSDETHNHSVLFNRIRDLTAEIWFGRRLGQEAAPTKLAVDRALPFDEINEQLYLLLNRLDVIYHAQGQYAYADNIVFAALEKLRHGFRKNLRAPATLTDWRPWLHEMRLFKSAEEIAVLRRAGEISALAHTRAMEKCRPGMFEYQLEGEILHEFTRHGARYPAYNTIVGGGENGCILHYTENECELRDGDLVLIDAGCEYRGYAGDITRTFPVNGKFTPAQRAVYDIVLAAINKSLTLFRPGTSIREVTEEVVRIMVVGLVELGILKGDIEQLIAEQAHRPFFMHGLSHWLGMDVHDVGDYGSSDRGRILEPGMVLTVEPGLYIAPDADVPPQYRGIGIRIEDDIVITATGNENLTASVVKDPDDIEALMALNHAGENLYFQLast
1 -132.0004pv4_A mol:protein length:445 Proline aminopeptidase P II  ali model  100  1MTQQEYQNRRQALLAKMAPGSAAIIFAAPEATRSADSEYPYRQNSDFSYLTGFNEPEAVLILVKSDETHNHSVLFNRIRDLTAEIWFGRRLGQEAAPTKLAVDRALPFDEINEQLYLLLNRLDVIYHAQGQYAYADNIVFAALEKLRHGFRKNLRAPATLTDWRPWLHEMRLFKSAEEIAVLRRAGEISALAHTRAMEKCRPGMFEYQLEGEILHEFTRHGARYPAYNTIVGGGENGCILHYTENECELRDGDLVLIDAGCEYRGYAGDITRTFPVNGKFTPAQRAVYDIVLAAINKSLTLFRPGTSIREVTEEVVRIMVVGLVELGILKGDIEQLIAEQAHRPFFMHGLSHWLGMDVHDVGDYGSSDRGRILEPGMVLTVEPGLYIAPDADVPPQYRGIGIRIEDDIVITATGNENLTASVVKDPDDIEALMALNHAGENLYFQ 445
2 -128.0001a16_A mol:protein length:440 AMINOPEPTIDASE P  ali model follow..  81  3ISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQ-DRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARK....... 439
3 -127.0005wze_A mol:protein length:452 Aminopeptidase P  ali model follow..  48  4IPKSEYARRRKALMAQMEPNSIAILPAAPMYIRNRDVEHVYRQDSDFQYLTGFPEPEAVMALIP-GRAHGEYVLFCRERDPERELWDGLRAGQDGAIGQYGADDAFPIGDIDDILPGLIEGRDRVYYALGANPDFDRRLMDWINVIRSKARQGAQPPNEFVALDHLLHDQRLYKSANEVKVMRYAAEVSARAHIRAMEVCRPGLFEYHLEAELEYEFRKGGAKMPAYGSIVAAGRNACILHYRENDAAIKDGDLILIDAGCEIDCYASDITRTFPANGRFSPEQKAIYELVLEANMAAFDYIAPGRHWNEAHEATVRVITAGLVRLGLLEGDVDELIAHEAYKAFYMHRAGHWLGMDVHDVGEYRVGGEWRVLEPGMAMTVEPGIYIAPDTTVAKKWRGIGVRIEDDVVVTRNGCEVLTNGVPKTVAEIEALMAAAKSEAAL... 445
4 -121.0005x49_A mol:protein length:456 Probable Xaa-Pro aminopeptidase 3  ali model follow..  31  16LSQVEYALRRHKLMSLIQKDQTVVVLSNPTYYMSNDIPYTFHQDNNFLYLCGFQEPDSILVLQSLPGKSHKAILFVPRRDPSRELWDGPRSGTDGAIALTGVDEAYTLEEFQHLLPKMKAETNMVWYDWMRPSHAQLH----SDYMQPLTEAKAKSKNKVRGVQQLIQRLRLIKSPAEIERMQIAGKLTSQAFIETMFTSKAPVEEAFLYAKFEFECRARGADILAYPPVVAGGNRSNTLHYVKNNQLIKDGEMVLLDGGCESSCYVSDITRTWPVNGRFTAPQAELYEAVLEIQRDCLALCFPGTSLENIYSMMLTLIGQKLKDLGIMKNI-KENNAFKAARKYCPHHVGHYLGMDVHDTPDM---PRSLPLQPGMVITIEPGIYIPEDKDAPEKFRGLGVRIEDDVVVTQDSPLILSADCPKEMNDIEQICSQAS........ 456
5 -118.0003ig4_A mol:protein length:427 Xaa-pro aminopeptidase  ali model follow..  30  1MKSKFFAQNRERLVNTLPDESITILFAGQAPHMSADAHYKFVPNRNFYYVTGIDEPNVIFMLKKFG-NSVEETLFIEKSDPVMEKWVGKTVSNEEAEKISGIKKVIYLDSFEKTMSNIFFTENVKHLYLDLECREWKGTETKTLAFAKHV-REQYPHVTIGNVYPNICELRVFKTDEEIEIIKEAIAVTKDGIYNVLKHAKADMMEYELEAQFDFTLKSSGIKHHAFNTILASGKNATVLHYEDNDAQIQNGDLVLLDLGAQKDYYNADISYTFPANGTFSSRQKQIYNIVLNALKETTEIIKPGLKFAALNEHAKKVLAEGCKAVGLIQEDEE-------LSKYYYHGVSHFLGLDTHDVGTY----KDRVLEEGMVITIEPGLYIEE--------ESIGIRIEDDILVTKDGHENLSKDIIREVEEIEEFMRENNVNVK.... 420
6 -116.0002iw2_A mol:protein length:494 XAA-PRO DIPEPTIDASE  ali model follow..  33  19VPLALFALNRQRLCERLRKGSIVVLQGGEETQRCTDTGVLFRQESFFHWAFGVTEPGCYGVI---DVDTGKSTLFVPRLPASHATWMGKIHSKEHFKEKYAVDDVQYVDEIASVLTSQKPSVLLTLRGVNTDSGSVCRE--------ASFDGISKFEVNNTILHPEIVECRVFKTDMELEVLRYTNKISSEAHREVMKAVKVGMKEYELESLFEHYCSRGGMRHSSYTCICGSGENSAVLHYGHNDRTIQNGDMCLFDMGGEYYCFASDITCSFPANGKFTADQKAVYEAVLRSSRAVMGAMKPGVWWPDMHRLADRIHLEELAHMGILSGSVDAMVQAHLGAVFMPHGLGHFLGIDVHDVGGYRSLRTARHLQPGMVLTVEPGIYFIDNREVLQRFRGFGVRIEEDVVVTDSGIELLT-CVPRTVEEIEACMAGCDK....... 485
7 -101.0004qr8_A mol:protein length:443 Xaa-Pro dipeptidase  ali model follow..  23  11.HIATLQERTRDALARFKLDALLIHSGELFNVFLDDHPYPFKVNPQFKAWVPVTQVPNCWLLV--DGVNKPKLWFYLPVDYWHNVEPLPTSFWTED---VEVIALPKADGIGSLLPAARGNIGYIGPVPERALQLGI----------------EASNINPKGVIDYLHYYRSFKTEYELACMREAQKMAVNGHRAAEEAFRSGMSEFDINIAYLTATGHRDTD-VPYSNIVALNEHAAVLHYTKLDQAPEEMRSFLLDAGAEYNGYAADLTRTWS--AKSDNDYAQLVKDVNDEQLALIATMKAGVSYVDYHIQFHQRIAKLLRKHQIITDMSEEMVENDLTGPFMPHGIGHPLGLQVHDVAGFPYLRCTRILQPGMVLTIEPGIYFIESQKIEALKPFGGIRIEDNVVIHENNVENMTRDLKLA.................... 443
8 -98.3004zwo_A mol:protein length:440 organophosphate anhydrolase/prolidase  ali model follow..  22  11.HIATLQKRTREIIERENLDGVVFHSGQAKRQFLDDMYYPFKVNPQFAWLPVIDNPHCWIVA---NGTDKPKLIFYRPVDFWHKVPDEPN---EYWADYFDIELLVKPDQVEKLLPYDKARFAYIGEYLEVAQALG------------------FELMNPEPVMNFYHYHRAYKTQYELACMREANKIAVQGHKAARDAFFQGKSEFEIQQAYLLAT-QHSENDTPFGNIVALNENCAILHYTHFDRVAATHRSFLIDAGANFNGYAADITRTYDFTGEGE--FAELVATMKQHQIALCNQLAPGKLYGELHLDCHQRVAQTLSDFNIVNLSADEIVAKGITSTFFPHGLGHHIGLQVHDVGGFPFLRCTRKIEANQVFTIEPGLYFIDSDKVAELKPFGGIRIEDNIIVHEDSLENMTRELELD.................... 440
9 -96.6003l24_A mol:protein length:517 Xaa-Pro dipeptidase  ali model follow..  21  11.HIATLQKRTREIIERENLDGVVFHSGQAKRQFLDDMYYPFKVNPQFAWLPVIDNPHCWIVA---NGTDKPKLIFYRPVDFWHKVPDEPN---EYWADYFDIELLVKPDQVEKLLPYDKARFAYIG------------------EYLEVAQALGFELMNPEPVMNFYHYHRAYKTQYELACMREANKIAVQGHKAARDAFFQGKSEFEIQQAYLLAT-QHSENDNPYGNIVALNENCAILHYTHFDRVAATHRSFLIDAGANFNGYAADITRTYDFTGEGE--FAELVATMKQHQIALMNQLAPGKLYGELHLDCHQRVAQTLSDFNIVDLSADEIVAKGITSTFFPHGLGHHIGLQVHDVGGFPFLRCTRKIEANQVFTIEPGLYFIDSDKVAELKPFGGIRIEDNIIVHEDSLENMTRELRLTTHSLRGLSAPQFSIND.... 458
10 -95.9003rva_A mol:protein length:451 Organophosphorus acid anhydrolase  ali model follow..  22  10QHIEELQARTREALQREGLDGLVIHSGQGKRLFLDDNHYPFKVNPQFAWVPVIDNPNCWLVV---NGVDKPTLIFYRPEDFWHKVPPEPN---DFWTDSFDIKLLQQADAVEKFLPYDKSRFAYVGEYIEVAKALG------------------FDNVNPDRVLHYLHYQRAYKTDYELDCMREANKLAVAGHKAAEQAFREGKSEFDINLAYAAASR-QGDNDVPYTSIVALNEHASILHYMQCDTVAKESRSFLIDAGANYHGYAADITRTYAQEGVHNSAMRDLIQAVDKVTLTLVDSLKPGVAYTDIHLLAHDGIAQILHDTGMVNLTPPEIVEMGITRTFFPHGIGHFLGLQVHDVGGLPFLRCTRMVEARQVFTIEPGLYFIDSDTIDAYKPFGGIRIEDNIIVHRDKNENMTRDLDLNLE.................. 445
11 -78.7005ce6_A mol:protein length:480 FACT-Spt16  ali model follow..  13  24IDLNTFQTRLKAFYSHWDDRRTDLWGSSDAIAPPSEDLRYLKSTALFLWLLGFEFPETIMVFTK------KQIHVLCSQKKASILESVKKPARESVGVEIILHVKPKNDDGASSMDAIIRAIRAQSKSDGHDSSTVGHIEPEGRLLDLWAEKLKNSKFRLSDVANGFSALFAAKSNEEITYIKRAAYLTGSVMKNFVVTKLENVIDEEKKILHSTLMEKADNVDICYPPIFQSGGKFDLRPSAVSNDEYDSASVIICAVGARYKSYCSNIARTFLIDA--DPIQSKAYEVLLKAQEAVIGSLKPGNKLSAAYLAAVSVVEKDAPDMV----------------SCLTKSAGTGIGIEFRESGLNINAKNDQIVKEGMVFNVSLGFQNLHCENSKSKNKVFSLLLADTIIINKDKTDVVTSIGSKALKDVAYSFNEDEEEEKPTSK 470
12 -68.3005xm2_A mol:protein length:437 FACT complex subunit SPT16  ali model follow..  13  5LDKDAYYRRVKRLYSNWRKGEDEYANVDAIVVGVDEEIVYAKSTALQTWLFGYELTDTIMVFCDDKASKKKVEFLKQIANTKGNENANGAPAITLLIREKNESNKSSFDKMIEAIKESKNGKKIGVFSKDKFP---------GEFMKSWNDCLNKEGFDKIDISAVVAYTIAVKEDGELNLMKKAASITSEVFNKFFEKVRHSKLAESVEKAIEEKKYLAGADEMCYPPIIQSGGNYNLKFSVVSDKNHMHFGAITCAMGIRFKSYCSNLVRTLMVDP--SQEVQENYNFLLQLQEELLKELRHGVKICDVYNAVMDVVKKQKPELL----------------NKITKNLGFGMGIEFREGSLVINSKNQYKLKKGMVFSINLGFSDLTNKEKKPEEKTYALFIGDTVLVDEDGPATVLTSVKKKVKNVGIFLKNEDE....... 437
13 -63.7003bip_A mol:protein length:467 FACT complex subunit SPT16  ali model follow..  14  8IDFDVFKKRIELLYSKYNEFEGSP--SLLFVLGSSNAENPYQKTTIHNWLLSYEFPATLIALVPGKVIIITSSAKAKHLQKAIDLFKDPESKITLELWQRNNKEPELNKKLFDDVIALINSAGKTVGIPEKDSYQGKFMTEWNPVWEA---AVKENEFNVIDISLGLSKVWEVKDVNEQAFLSVSSKGSDKFNAKLSDKIENKIDDVKFALCPPNYKFNFDLLDWTYSPIIQSGKKFDLVSARSTNDQLYGNGCILASCGIRYNNYCSNITRTFLIDP--SEEMANNYDFLLTLQKEIVNILKPGRTPKEVYESVIEYIEKTKPELV----------------PNFTKNIGSLIGLEFRDSNFINVKNDYRKIQRGDCFNISFGFNNLKDSQSANNY---ALQLADTVQIPLDETERFLTNYTKAKSQISFYFNNEEEDNN.... 457
14 -62.6003q6d_A mol:protein length:356 Proline dipeptidase  ali model follow..  25  1...SNAMEKIERLRSAFDEAGIDGIL--------------LTNEHSRRYMANFTGTAGVVLISKKR----------------AQFITDFRYVEQASKQAVGYEIVQHAGLIIDEVAKQVKELGIQKLGFEQDTLTYSSYSAHKEAI----------DAEFIPTSGLVEKLRLIKTDSEIKILKEAAQIADAAFEHILSFIRPGVSEIEVSNELEFFMRKQGATSSSFDIIVASGLRSALPHGVASEKVIETGDFVTLDFGAYYKGYCSDITRTIAV-GEPSDKLKEIYNIVLEAQLRGVNGIKAGLTGREADALTRDYITEK-------------------YGEYFGHSTGHGIGLEIHEAPGLAFRSDT-VLEPGMAVTVEPGIYIPG-----------GVRIEDDIIVTSEGNEVITK-SPKELIIL................ 356
15 -60.6006a8m_A mol:protein length:461 FACT complex subunit SPT16  ali model follow..  14  7IDFSTFENRLLALRDRFPSFDGSPSSLVFILGSADEENPYQKTTILHNWLLGYEFPTTLIAVFKE-----GCVVITSAAKTREEGVAQMNKKLENTFKIELWQSSKEPGHNLKLFEDLVERVREAGSAVGLATKDSYQGKFITEWKGVWDTAVEKHGLNGVDVSLGLSSLWAVKDEKEQAYLQVSSRGSDKFMNLLSDELVRKITDAKLSDNVENEIDKSNYLDWAYSPIIQSGPKYDLRVSASSETQLDGNGCILASCGIRYKNYCSNISRTFLIDP--SDEMTDNYDFLLLLQEEIINLLRVGATPKQIYDGAVNYINSKKPELS----------------AGFTKNVGSLMGLEFRDSQFVNNKNDYRKVENGDCFNISLGFNNLKDSKTGASY---ALQLADTVQLTSGGPKVLT-NYTKSRSQISFYFNNEDDGTT.... 453
16 -60.6005cnx_A mol:protein length:361 Aminopeptidase YpdF  ali model follow..  21  1......STLLASLRDWLKAQQLDAVL--------------LSSRQNKQPHLGISTGSGYVVISRE-----SAHILVDSRYYVEV---------EARAQGYQLHLLDATNTLTTIVNQIIADEQLQTLGFEG------------QQVSWETAHRWQSELNAKLVSATPDVLRQIKTPEEVEKIRLACGIADRGAEHIRRFIQAGMSEREIAAELEWFMRQQGAEKASFDTIVASGWRGALPHGKASDKIVAAGEFVTLDFGALYQGYCSDMTRTLLVNGAESHLLFNVYQIVLQAQLAAISAIRPGVRCQQVDDAARRVITEA-------------------YGDYFGHNTGHAIGIEVHEDPRFSPRDTT-TLQPGMLLTVEPGIYLPG-----------GVRIEDVVLVTPQGAEVLYA-MPKTVLLTGE.............. 360
17 -60.4002zsg_A mol:protein length:359 Aminopeptidase P, putative  ali model follow..  22  2.......DRSERLIQLISEEGIAFLIMNIENSAR----------ASSVYFSGFTGSFSIILISENT----------------RLLITDSRYTVQAKQETDFEVREVKGGDFIDVLKKTVNDLKIKTIALEEER---------VSLSLFRRISSAFGDRKFIGIDDEVKQMRMVKDEGEIEKIKQAIEISERAFLETVQQIRAGMTEKEIAALLEYTMRKEGAEGVAFDTIVASGCRSALPHGKASDKVVERGDVIVIDFGATYENYCADITRVVSI-GEPSDEVKEVHSIVLEAQERALKIAKAGVTGKLLDSVAREFIREK-------------------YGEFFGHSLGHGIGLEVHEGPAISFRNDS-PLPENVVFTVEPGIYLEG-----------GIRIEEDVVLKEQGCEILTT-LPRSIFVV................ 359
18 -60.3005cdl_A mol:protein length:349 Proline dipeptidase  ali model follow..  27  1......SSKMDQLRPVLGRAGVDALW--------------VSAPANVRWLSGFTSAEDGKVLVSPD---------------GATLYTDARYTVQAQEESSLPQYIARPPATYEHAADTVRGLRVGF-------------AESLTVAELEDLRQAWPNSTLVALRGTLGGLRAVKTPEEIGAIRAAQDLADRVYTEVRPMIRAGVRELDVAVEIETRLRRAGGES-AFELIVASGPNGAKPHGHASKRVIEDGDLVTIDMGARLGGYNSDMTRTVAV-GTPSAEMKRVYDAVLEAEEAAIAAIRPGVRAADLDKLARDLLTRH-------------------LGEAFAHSLGHGVGLEVHEGPGLRGTSQD-VLEAGMVITIEPGAYLPG-----------GVRIEDLILVTEDGYEVLSH-SAKES................... 348
19 -60.1001wy2_A mol:protein length:351 Xaa-Pro dipeptidase  ali model follow..  26  1..MDIMNEKVKKIIEFMDKNSIDAVL--------------IAKNPNVYYISGASPLAGGYILITGE----SATLYVPEL-------------YEMAKEESNIPVEKFKKM--DEFYKALEGIKSLGIE------------SSLPYGFIEELKKKANIKEFKKVDDVIRDMRIIKSEKEIKIIEKACEIADKAVMAAIEEITEGKKEREVAAKVEYLMKMNGAEKPAFDTIIASGYRSALPHGVASDKRIERGDLVVIDLGALYQHYNSDITRTIVV-GSPNEKQKEIYEIVLEAQKKAVESAKPGITAKELDSIARNIIAEY-------------------YGEYFNHSLGHGVGLEVHEWPRVSQYDET-VLREGMVITIEPGIYIPK-----------GVRIEDTILITKNGSKRLTK-TEREL................... 350
20 -60.0001pv9_A mol:protein length:348 Xaa-Pro dipeptidase  ali model follow..  26  1.....MKERLEKLVKFMDENSIDRVF--------------IAKPVNVYYFSGTSPLGGGYIIVDGD----EATLYVPEL-------------YEMAKEESKLPVVKFKKF--DEIYEILKNTETLGIE------------GTLSYSMVENFKEKSNVKEFKKIDDVIKDLRIIKTKEEIEIIEKACEIADKAVMAAIEEITEGKREREVAAKVEYLMKMNGAEKPAFDTIIASGHRSALPHGVASDKRIERGDLVVIDLGALYNHYNSDITRTIVV-GSPNEKQREIYEIVLEAQKRAVEAAKPGMTAKELDSIAREIIKEY-------------------YGDYFIHSLGHGVGLEIHEWPRISQYDET-VLKEGMVITIEPGIYIPK-----------GVRIEDTVLITENGAKRLTK-TEREL................... 347
21 -59.7003cb5_A mol:protein length:444 FACT complex subunit spt16  ali model follow..  13  8IDEITFHKRLGILLTSWKNDSILVTVG-----AHDDTNPYQKSTALHTWLLGYEFPSTLILLEKHRI----TILTSVNKANMLTKLAETKGAAADVNILKRTKDAEENKKLFEKIIEYIRATNKKVGVFPKDKTQGKFINEWDSIF-----EPVKSEFNLVDASLGLAKCLAIKDEQELANIKGASRVSVAVMSKYFVDEGKKITHSKFSDQMESLIDNEDQLEWCYTPIIQSGGSYDLKPSAITDDRNLHGDVVLCSLGFRYKSYCSNVGRTYLFDP--DSEQQKNYSFLVALQKKLFEYCRDGAVIGDIYTKILGLIRAKRPDLE----------------PNFVRNLGAGIGIEFRESSLLVNAKNPRVLQAGMTLNLSIGFGNLINPHPKNSQSKYALLLIDTIQITRSDPIVFT-DSPKAQGDISYFFGED......... 444
22 -58.6004fkc_A mol:protein length:377 Xaa-Pro aminopeptidase  ali model follow..  24  4SGSMDYKRRIHKFQAHFGKKGFEGAL--------------VAPGSNFYYLTGFNPLGTLERLFVLILPSEGLLTAIAPR------LYEKELEEFNGEVVLWSDSENPYKIFATKIKETFKEGEKLLID------------DTMPVGVFLKAKDIFDKYSLHPISPVISELREIKDKDEIKAHKKAAEIVDKVFYRFIEGKLEGKSERELANRIEYMIKNEGADDVSFEPIVASGPNGANPHHRPSHRKIRKGDVVIFDYGAKYLGYCSDVTRTVVV-GPPSEEVKKVYEIVKEAQETAVQKVAEGIPAEVVDATARGIISKY-------------------YGEYFIHRTGHGLGIDVHEEPYISP-GNKKILKDGMVFTIEPGIYLQG-----------GVRIEDDVALVDKKGIRLTN-ADRELITL................ 371
23 -58.0004r60_A mol:protein length:400 Proline dipeptidase  ali model follow..  21  28IGADEYQQRIERARVLMRAQGVDALL--------------IGAGTSLRYFSGVPERLVALLLTTEGDPVLICPAFEEGSLDAVLQLPVRKRLWEEHEDPY------------ALVVQAMDEQHAHALALDPGIAFAVHTG------------RAHLGTAIRDAGAIIDGCRMCKSPAELALMQQACDMTLLVQRLAAGIAHEGIGTDQLVRFIDEAHRALGADNGSTFCIVQFGHATAFPHGIPGVQHLRAGELVLIDTGCTVQGYHSDITRTWIY-GTPSDAQQRIWELELAAQAAAFAAVRPGVACEAVDQAARAVLQAA--------------LGPDYRLPGLPHRTGHGCGLAIHEAPYLVR-GNRQPLQPGMCASNEPMIVVPGA----------GVRLEDHFYVTDTGAQWFTP-PSVAIDQ................. 397
24 -58.0001wn1_A mol:protein length:356 dipeptidase  ali model follow..  23  1.......MRLEKFIHLLGERGFDGAL--------------ISPGTNLYYLTGLRLHEVGERLAILAVSAEGDYRFLAPS-------------YENVVNNFPATFWHDGENPYAKLREILEELGISKGRILIEDTMRADWLIGIMKL---------GKFTFQPLSSLIKELRMIKDKEEVKMMEHASRIADKVFEEILTWDLIGMKERELALKIELLIR-ELSDGIAFEPIVASGENAANPHHEPGERKIRKGDIIILDYGARWKGYCSDITRTIGL-GELDERLVKIYEVVKDAQESAFKAVREGIKAKDVDSRAREVISKA-------------------YGEYFIHRTGHGLGLDVHEEPYIGP-DGEVILKNGMTFTIEPGIYVPG-----------GVRIEDDIVVDEGKGRRLTK-AERELIIL................ 356
25 -56.0004zng_C mol:protein length:362 Prolidase  ali model follow..  22  2.......SKIERISAFLNDKEVDMTF--------------ITNPTTLNYLTGLAIDPHERIAGLMIFRDSTPMLFTPALE------------VEKAKEHTSGLDIFGYEDSQNPWEVVKNHVKSDVKSIAVEFSD-------IPLAKTEGLKAQFGDINFVNLTPLIERMRLIKSADEIEKMKVAGDFADKCFEIGFAAERNGVTESDIVAKIEYEMKRMGVPQMSFDTLVLSGARAANPHGAPENVEIQENKLLLFDLGVMSGGYASDATRTIAI-GQPNDFDAEIHKIVKEAQQAAMDFIKPGVTAHEVDAVARDLITKA-------------------YGEYFNHRLGHGIGMDVHEYPSIVA-GNDLVIQEGMCFSNEPGIYIPG-----------GVRIEDCLYVTENGCESFTH-TDHDLLIF................ 362
26 -55.6001chm_A mol:protein length:401 CREATINE AMIDINOHYDROLASE  ali model follow..  19  18FSAQEYANRQARLRAHLAAENIDAAI--------------FTSYHNINYYSDFLGRPYALVVTEDD-----VISISANIDGGQPW-------RRTVGTDNIVYTDWQRDNYFAAIQQALPKARRIGIEHDH-----------LNLQNRDKLAARYPDAELVDVAAACMRMRMIKSAEEHVMIRHGARIADIGGAAVVEALGDQVPEYEVALHATQAMVRAIADTMDTWTWFQSGINTDGAHNPVTTRKVNKGDILSLNCFPMIAGYYTALERTLFL-DHCSDDHLRLWQVNVEVHEAGLKLIKPGARCSDIARELNEIFLKH-------------------VLQYRTFGYGHSFGTLSHYYGREAREDIDTVLEPGMVVSMEPMIMLPEGLP--------GYREHDILIVNENGAENIT-KFPYGPEKN................ 398
27 -55.2001kp0_A mol:protein length:402 CREATINE AMIDINOHYDROLASE  ali model follow..  19  19FSXAEMTRRXXRLRAWMAKSXIDAVL--------------FTSYHNINYYSGWLGRKYAXVI-----XXVKAVTISKGIDGGMPW--------RRSFGXNIVYTDWKRDNFYSAVKKLVKGAKXIGIEHDH-----------VTLXHRRXLXKALPGTEFVDVGXPVMWXRVIKSSEEXXLIRXGARISDIGGAATAAAISAGVPEYEVAIATTXAMVRXIARXFPYVELFQSGINTDGAHNPVTXRVVXRGDILSLNCFPMIFGYYTALERTLFL-XXVXDASLXIWXKNTAVHRRGLXLIKPGARCKDIASELNXMYRXW-------------------LLRYRTFGYGHSFGVLXHYYGREAREDIXTVLEPGMVVSMEPMVMXPEGEP--------GYREHDILVIKENXTENIT-GFPFGPEHN................ 398
28 -53.7005xev_A mol:protein length:416 Xaa-Pro dipeptidase,Peptidase-related protein  ali model follow..  19  2......STPIPAMQAALAATDLWLVYDFQ------------GLNPHARRVLGIG---------DDVFLTRRFFVWVPRAGRAVVLHNHIEGGNWNRITQEWDAELRPFGSHAELDAALRGVVSGQRLAMEYSPNGAVPYVSRVDAGTLERVRG--AGAAEVASSADLLQAFLVWTPDDLAAHRRAAALLMRAKDDAFRLIHQSVTEWEVQQLIMDQIRAAGMQ-AGHDVNVSFGVNAADSHYEPSEQTLHPGECVLIDLWAQEPGRPADVTWVGFA-GEPGTEYLDAWQAVRAAREAALELLRSRFVAEGYGRLQGWELDRAARDA------------GERWAPHFLHRTGHDLGVQIHGAGANLETRDTRTLTPGLSVTVEPGTYPAAA--SPSGQGGFGIRSEVDVYLAPDGPEVTTD-LQQAVGDWDAVRAAG......... 412
29 -52.6004ege_A mol:protein length:378 Dipeptidase PepE  ali model follow..  21  10FDTAVYARRLAAAAAATEQAGLAGLV--------------ITPGYDLRYLIGSRADTFERLTALVLPASGVPTIVLPRLELASLK------ESAASDLGVCVRDWVDGDDPYQLVAVALGGAPAATAVTDS-------------PALHLLPLADALGVLPVLATDVLRQLRMVKEAAEVDALAKAGAAIDRVHARVPAFLVPGRTEAQVAADIAEAIVAEGHSAVAF-VIVGSGPHGADPHHGYSDRKLQVGDIVVVDIGGTYEGYYSDSTRTYSI-GDPSPDVAQQYSALQRAQRAAVDAVRPGVTAAQVDAAARDVLADA-------------------LAEYFVHRTGHGIGLCVHEEPYIVA-GNELPLVAGMAFSIEPGIYFPGR----------GARIEDIVVVTENGALSVNN-RPHELMVVP............... 377
30 -50.1004b28_A mol:protein length:470 METALLOPEPTIDASE, FAMILY M24, PUTATIVE  ali model follow..  16  70..AAMRRFRHRRLTDHVVARGYAGLL--------------MFDPLNIRYATDSTNPFRATLLCADGYMVMWDYKNSPFLSEFNPLVREQRAGADLFYFDRGDKVDVAADVFANEVRILLRDHAPGLRRLAVDKVMLHGLRAL-----------QAQGFEIMDGEEVTEKARSVKGPDEIRAMRCASHACEVAVRKMEDFARSKVCENDIWAILHSENVRRGGEWIET-RLLASGPRSNPWFQECGPRVCQRNEIISFDTDLGAYGICTDISRSWWI-GDQKPRADMIYAMQVEHIRTNMEMLKPGVMIPEL--------------------SANTHVLDAKFQKQKYGCLMHGVGLCAYPDHAVAG-AYDYPLEPGMTLCVEALISEEGG--------DFSIKLEDQVLITEDGYENLTK-YPFDPALM................ 461
31 -48.5004rzy_A mol:protein length:447 Peptidase M24  ali model follow..  15  53..DRMREYRWKRLTQAIVDRGYGGLL--------------MFDPLNIRYATDSTNPFRAVLLCADGYMVIWDYKNSPFLSKFNPLVREQRSGADLFYFDRGDKVDVQADVFANEVRVLMQDHAPGHTRLAVDKIMLHGLRAL-----------EAQGFEIMEGEEVTEKTRAIKGPDEILAMRCASHACETAVAEMEKFARAHVGEDDIWAVLHAENIKRGGEWIET-RLLASGPRTNPWFQECGPRITQKNEIIAFDTDLGSYGICVDISRTWWI-GDQKPRPDMVYQHAHEHIMTNMEMLKPGVMIPDLTANCHRLD--------------------DKFQAQKYGCLMHGVGLCAYPDKAVPG-SYDYPLEPGMVLCVEAAVGEVGGD---------SIKLEDQVLITEDGYENLTT-YPFDAALM................ 444
32 -36.5003mx6_A mol:protein length:262 Methionine aminopeptidase  ali model follow..  20  2......................................................................................................................................................................PGSMIKIHTEKDFIKMRAAGKLAAETLDFITDHVKPNVTTNSLNDLCHNFITSHNANYKGFPKSICTSINHVVCHGIPNDKPLKNGDIVNIDVTVILDGWYGDTSRMYYV-GDVAIKPKRLIQVTYDAMMKGIEVVRPGAKLGDIGYAIQSYAEKH--NYSVVRD------------------TGHGIGRVFHDILNYGRNGTGLTLKEGMFFTVEPMINALDGWTVTTRDKSLSAQFEHTIGVTKDGFEIFTL......................... 252
33 -36.0001qxw_A mol:protein length:252 methionyl aminopeptidase  ali model follow..  21  3............................................................................................................................................................................VKTEEELQALKEIGYICAKVRNTMQAATKPGITTKELDNIAKELFEEYGAIDENFPGQTCISVNEEVAHGIPSKRVIREGDLVNIDVSALKNGYYADTGISFVVGESDDPMKQKVCDVATMAFENAIAKVKPGTKLSNIGKAVHNTARQN--DLKVIKN------------------TGHGVGLSLHEVLNYFDPKDKTLLTEGMVLAIEPFIEGKNEWAFETSDKSFVAQIEHTVIVTKDGPILTTK......................... 248
34 -35.3003tb5_A mol:protein length:264 Methionine aminopeptidase  ali model follow..  22  1.........................................................................................................................................................................MITLKSPREIEMMDESGELLADVHRHLRTFIKPGITSWDIEVFVRDFIESHGGVYEGYKYATCCSINDEICHGFPRKKVLKDGDLIKVDMCVDLKGAISDSCWSYVV-GESTPEIDRLMEVTKKALYLGIEQAQVGNRIGDIGHAIQTYVEGE--GYGVVRD------------------VGHGIGPTIHEIPHYGEAGKGLRLKEGMVITIEPMVMDPNGWTAYTEDGGLSCQYEHSLAITKEGPRILTS......................... 247
35 -34.8001o0x_A mol:protein length:262 Methionine aminopeptidase  ali model follow..  21  5.......................................................................................................................................................................KIMIRIKTPSEIEKMKKAGKAVAVALREVRKVIVPGKTAWDVETLVLEIFKKLRVKYGGYKYATCVSVNEEVVHGLPLKKVFKEGDIVSVDVGAVYQGLYGDAAVTYIV-GETDERGKELVRVTREVLEKAIKMIKPGIRLGDVSHCIQETVESV--GFNVIRD------------------VGHGVGRELHEIPNYGTPGTGVVLRKGMTLAIEPMVVKEDGWTAVTVDGSRCAHFEHTILITENGAEILTKE........................ 255
36 -34.7004fo7_A mol:protein length:280 Methionine aminopeptidase  ali model follow..  22  5............................................................................................................................................................................IKTPDDIEKMRIAGRLAAEVLEMIGEHIKPGVTTEELDRICHDYIVNEQKAIPAFPKSICTSINHVVCHGIPNEKPLKEGDILNVDITVIKDGYHGDTSKMFLV-GKTPEWADRLCQITQECMYKGISVVRPGAHLGDIGEIIQKHAEKN--GFSVVRE------------------CGHGIGKVFHEVLHYGRAGTGIELKEGMIFTIEPMILLGDGWTAITKDRKLSAQWEHTVLVTADGYEILTL......................... 249
37 -34.7002b3h_A mol:protein length:329 Methionine aminopeptidase 1  ali model follow..  18  69............................................................................................................................................................................LLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFV-GEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQAN--GFSVVRS------------------CGHGIHKLFHTVPHYAKNKAVGVMKSGHVFTIEPMITWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTR......................... 312
38 -34.7004fli_A mol:protein length:326 Methionine aminopeptidase 1  ali model follow..  18  51............................................................................................................................................................................LLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFV-GEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQAN--GFSVVRS------------------CGHGIHKLFHTVPHYAKNKAVGVMKSGHVFTIEPMITWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTR......................... 294
39 -34.7001y1n_A mol:protein length:291 Methionine aminopeptidase 1B  ali model follow..  23  41............................................................................................................................................................................VQTPEVIEKMRVAGRIAAGALAEAGKAVAPGVTTDELDRIAHEYLVDNGAGYKGFPKSCCTSLNEVICHGIPDSTVITDGDIVNIDVTAYIGGVHGDTNATFPA-GDVADEHRLLVDRTREATMRAINTVKPGRALSVIGRVIESYANRF--GYNVVRD------------------TGHGIGTTFHNVLHYDQPAVETIMQPGMTFTIEPMIIWDDGWTVVTKDRKWTAQFEHTLLVTDTGVEILTC......................... 284
40 -34.5003iu7_A mol:protein length:288 Methionine aminopeptidase  ali model follow..  23  44............................................................................................................................................................................VQTPEVIEKMRVAGRIAAGALAEAGKAVAPGVTTDELDRIAHEYLVDNGAGYKGFPKSCCTSLNEVICHGIPDSTVITDGDIVNIDVTAYIGGVHGDTNATFPA-GDVADEHRLLVDRTREATMRAINTVKPGRALSVIGRVIESYANRF--GYNVVRD------------------TGHGIGTTFHNVLHYDQPAVETIMQPGMTFTIEPMIIWDDGWTVVTKDRKWTAQFEHTLLVTDTGVEILTC......................... 287
41 -34.2004km3_A mol:protein length:286 Methionine aminopeptidase  ali model follow..  23  1.........................................................................................................................................................................MITLKSAREIEAMDKAGDFLASIHIGLRDLIKPGVDMWEVEEYVRRRCKEENFAMMDYPYATCCSLNDEVAHAFPRHYILKDGDLLKVDMVLSYSGGLADSCWAYAV-GTPSEEVKNLMDITKEAMYKGIEQAVVGNRIGDIGAAIQEYAESR--GYGVVRD------------------VGHGVGPTMHEVPNYGIAGRGLRLREGMVLTIEP-TDMKTGWAHKTIDGGLSCQYEHQFVITKDGPVILTS......................... 279
42 -33.8004fuk_A mol:protein length:337 Methionine aminopeptidase  ali model follow..  17  63............................................................................................................................................................................SKKTAEIQRIKTVCQLSREVLDIATAAAKPGITTDELDRIVHEATVERNMNYYGFPKSVCTSVNEVICHGIPDSRELEEGDILNIDVSSYLNGFHGDLNETVFI-GRPDDDSVRLVHAAYECLCAGIGVVKPEALYKQVGDAIEACASQY--QCSVVRT------------------TGHGVGHLFHTVCHYANNKSLGMMRPGHVFTIEPMITWPDKWTSTTKDGRRSAQFEHTMVVTNGGVEIFTD......................... 306
43 -33.1004mat_A mol:protein length:278 PROTEIN (METHIONINE AMINOPEPTIDASE)  ali model follow..  23  5............................................................................................................................................................................IKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSAYPKSVCISINEVVCHGIPDDKLLKDGDIVNIDVTVIKDGFHGDTSKMFIV-GKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAE--GFSVVRE------------------CGHGIGQGFHEVLHYDSRETNVVLKPGMTFTIEPMVTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTL......................... 250
44 -33.1003tav_A mol:protein length:286 Methionine aminopeptidase  ali model follow..  21  22......................................................................................................................................................................RKKTVEQRTPGELDAMAAAGSIVGAALVAVRDAAKAGVSTLELDQVAESVIREAGAVYHGFPASICSSVNDQVVHGIPSAAVLADGDLVSIDCGAILDGWHGDSAWTFAV-GTVIPSDEALSEATRLSMEAGIAAMIPGNRLTDVSHAIELGTRAA---------EKQFDRAFGIVDGY----GGHGIGRSMHLLPNEGAPGKGPLLAVGSVLAIEPMLVLADDWTVVTTDGSRAAHWEHTVAVTEAGPRILTM......................... 278
45 -33.0004iu6_A mol:protein length:384 Methionine aminopeptidase 1  ali model follow..  17  130............................................................................................................................................................................LLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFV-GEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQAN--GFSVVRS------------------CGHGIHKLFHTVPHYAKNKAVGVMKSGHVFTIEPMITWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHF................ 382
46 -32.3005jqk_A mol:protein length:664 Peptidase, putative  ali model follow..  16  203..GEKIDKLKQSLMYDIKNVDNLLLSELDEI-------------AYLLNLRGYDYQYSPLFYSYLLFQFDREEQDFS----KIVFFTTVKNLPADVKNLLEINKV-IVKEYEEIVPYLRDVVIPSIPKHNDDNPDFKKYDISLSPYINLMIYKLFDRKNVLLQNSPVVKMKAVKNDVEIDNMKQAHILDGLALLQFFHWCEQNETEMSLRHKVDFRSTKKNFIFPSFSTISASGPNAAVIHYTDKTNATIKPAIYLLDSGGQYLHGTTDVTRTTHF-GEPTAEEKRIYTLVLKGHLRLRKVIFAYTNSSALDFIARENLFNNFMD--------------------YNHGTGHGVGLNVHEGGCSIGPVGGAPLKKNMVLSNEPGYYMKDK---------FGVRIENMQYVISKSFDDLT--YPYEKKLLDFSLLTNQEIK..... 614
47 -30.0004s2r_P mol:protein length:639 Protein APP-1  ali model follow..  15  188DTGLTTSKKVENLREKLKQKKCDAAVFTLL----DDVMWLLN-------IRGSDIPYNPLAYSYLFVAMREIHVFIDNEKLDEKS-------------------RAHFHKSNVSIHPYGEVYSWISNWLKAKEASKEPHMVYLTPETNYAIGSIIGEENSMVDTSLVQTAKATKNDHEMQGMRNSHLRDSAALVEFLCWLEKEYTEIELADKIDLRSLQDKYVTLSFDTISAVGDHAALPHYKSGNRKAAANQVFLLDSGAHYGDGTTDVTRTVWY-TNPPKEFILHNTLVLKGHINLARAKFPGIYGSRLDTLTRDALWKLGLD--------------------FEHGTGHGVGLNVHE--GHRSVPTGGELHASQVLTIEPGFYAKEK---------YGIRIENCYETVEATFKSLT--VPIQTSIVDKSLLIEEEIN..... 593
48 -29.7003ctz_A mol:protein length:623 Xaa-Pro aminopeptidase 1  ali model follow..  18  173YTGISWKDKVADLRLKMAERNVMWFVVTAL----DEIAWLFN-------LRGSDVEHNPVFFSYAIIGLETIMLFIDGDRIDAPSVKEHLLLDLGLEAEYRI-QVHPYKSILSELKALCADLS------------PREKVWVSDKASYAVSETIPKDHRCCMPYTPICIAKAVKNSAESEGMRRAHIKDAVALCELFNWLEKEVTEISAADKAEFRRQQADFVDLSFPTISSTGPTGAIIHYAETNRTLSLDEVYLIDSGAQYKDGTTDVTRTMHF-ETPTAYEKECFTYVLKGHIAVSAAVFPGTKGHLLDSFARSALWDSGLD--------------------YLHGTGHGVGLNVHECGISYKTFSDEPLEAGMIVTDEPGYYEDGA---------FGIRIENVVLVVPVTLEPLT--VPIQTKMIDVDSLTDKECD..... 583
49 -29.1003s6b_A mol:protein length:368 Methionine aminopeptidase  ali model follow..  17  97............................................................................................................................................................................VNNEEEIQRIREACILGRKTLDYAHTLVSPGVTTDEIDRKVHEFIIKNNANYYKFPKSCCTSVNEIVCHGIPDYRPLKSGDIINIDISVFYKGVHSDLNETYFVGNDVPKEGKELVETCYFSLMEAIKKCKPGMFYKNIGTLIDAYVSKK--NFSVVRS------------------SGHGVGKLFHSVPHFKKNKAVGIMKPGHVFTIEPMILWPDQWTSATSDGKLSAQFEHTLLITNNGVEILTK......................... 343
50 -24.5002dfi_A mol:protein length:301 Methionine aminopeptidase  ali model follow..  19  2.................................................................................................................................................................................DTEKLMKAGEIAKKVREKAIKLARPGMLLLELAESIEKMIMELGGK-PAFPVNLS---NEIAAHYTGDTTVLKEGDYLKIDVGVHIDGFIADTAVTVRVGME----EDELMEAAKEALNAAISVARAGVEIKELGKAIENEI---------------RKRGFKPIVNLSGHKIERYKLHAGISIPNIYRPHDNYVLKEGDVFAIEP-FATIGAGQVIEVPPTLIYMYVRDVPVRVAQARFLLAKIKREYGTL................ 233
51 -22.9003fm3_A mol:protein length:358 Methionine aminopeptidase 2  ali model follow..  12  39............................................................................................................................................................................FTESDILQDARRAAEAHRRARYRVQSIVRPGITLLEIVRSIEDSTRTLLKNGIGFPAGMS---NSCAAHYTEQDIVLKEDDVLKIDFGTHSDGRIMDSAFTVAFKEN----LEPLLVAAREGTETGIKSLGVDVRVCDIGRDINEVISSYEVE------IGGRMWPIRPISDLHGHSISQFR-IHGGISIPAVNNRDTTRIKGDSFYAVETFATTGKGSIDDRPPCSHFVLNTYDLIKVYEFVKDSLGTLPFSPRHLDYYGLVKGGSLKSVNL 314
52 -22.6001b6a_A mol:protein length:478 METHIONINE AMINOPEPTIDASE  ali model follow..  16  160............................................................................................................................................................................QASEEIWNDFREAAEAHRQVRKYVMSWIKPGMTMIEICEKLEDCSRKLIKAGLAFPTGCS---NNCAAHYTGDTTVLQYDDICKIDFGTHISGRIIDCAFTVTFN----PKYDTLLKAVKDATNTGIKCAGIDVRLCDVGEAIQEVMESYEVE------IDGKTYQVKPIRNLNGHSIGQYR-IHAGKTVPIVKGGEATRMEEGEVYAIETGVVHDDMECSHYMKNFDVGHVPIRLPRTKHLLNVINENLAFCRRWLDRLGESKYLM...... 430
53 -22.0005lyw_A mol:protein length:378 Methionine aminopeptidase 2  ali model follow..  16  54............................................................................................................................................................................QASEEIWNDFREAAEAHRQVRKYVMSWIKPGMTMIEICEKLEDCSRKLIKEGLAFPTGCS---NNCAAHYTGDTTVLQYDDICKIDFGTHISGRIIDCAFTVTFN----PKYDTLLKAVKDATNTGIKCAGIDVRLCDVGEAIQEVMESYEVEI------DGKTYQVKPIRNLNGHSIGQYR-IHAGKTVPIVKGGEATRMEEGEVYAIETGVVHDDMECSHYMKNFDVGHVPIRLPRTKHLLNVINENLAFCRRWLDRLGESKYLM...... 324
54 -20.4002v6c_A mol:protein length:353 PROLIFERATION-ASSOCIATED PROTEIN 2G4  ali model follow..  14  5............................................................................................................................................................................IAEDLVVTKYKMGGDIANRVLRSLVEASSSGVSVLSLCEKGDAMIMEETGKKKGIAFPTSISVNNCVCHFSDQDYILKEGDLVKIDLGVHVDGFIANVAHTFVIGVQVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVA---------------HSFNCTPIEGMLSHQLKQHV-IIQNPTDQQKKDHEKAEFEVHEVYAVDVGVVECAKHELLQPF-EFVAQFKFTVLLMPNGPMRITSEMEVQDAELKALLQS.......... 353
55 -19.0002q8k_A mol:protein length:401 Proliferation-associated protein 2G4  ali model follow..  14  13............................................................................................................................................................................IAEDLVVTKYKMGGDIANRVLRSLVEASSSGVSVLSLCEKGDAMIMEETGKIFKKEKEMKKG-NNCVCHFSDQDYILKEGDLVKIDLGVHVDGFIANVAHTFVVDVQVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVA---------------HSFNCTPIEGMLSHQLKQHV-IIQNPTDQQKKDHEKAEFEVHEVYAVDVGVVECAKHELLQPF-EFVAQFKFTVLLMPNGPMRITSEMEVQDAELKALLQSSASRKTQKKK 371
56 -18.7004ipa_A mol:protein length:423 Putative curved DNA-binding protein  ali model follow..  15  14............................................................................................................................................................................AISVDVLTKYKTAAQISEKVLAEVSKLCVPGAKIIDICEQGDKLMEEELSKNKGFSHPTTVSPAAFITPYTPLATEIQPGEPIKIQLGAQIDGYGTIVCDTIVAKNVIEGRQADLFLATYYANEVLLRLMVPPGLLATGTDEEKAKAAAVQAKISSLLEKVAKAYDCNIIESTTSWLFDKNE---IEGKKKIENIKGEGVPEVGDVWGVEVGVIECVRGGVFRQY-APVCRLLTTIAITKNGITRIGGPPAWDLSKFKT.............. 366
57 -18.1005fl8_u mol:protein length:380 ARX1  ali model follow..  11  5............................................................................................................................................................................ILQESVLNKYRTAGQIAQTALKYVTSLINDSYH-PELCLLTDSFILTRLEQERGIAIPTTIDIDQISGGWCDVTGTLRPGDLVKITLGVHIDGYTSEVSHTMVIYGPLLGGKADAVAAAHIAMETVVALLSSGITGQLIRTIVDTIA---------------RSYNCGVVPGSRVRRIRRFL-IVAEFTNVSAIPSDDFVVQSGEVYLIDLKM-YPFKLSHLLKSFRLGMRECNTIVLCDSSVSTTDRELNPQDSIVQGIFQLAT........ 380
58 -16.5005apn_x mol:protein length:616 Probable metalloprotease ARX1  ali model follow..  11  27...................................................................................................................................................................TQILLKDKNILQESVLNKYRTAGQIAQTALKYVTSLINDQLTVPELCLLTDSFILTRLEQGIAIPTTID---DQISGGWCSVTGTLRPGDLVKITLGVHIDGYTSEVSHTMVIYGPLLGGKADAVAAAHIAMETVVALLACALTPEKLPASLGGT-GITGQLIRTIVDTIARSYNCGVVPGSRVRRIRRFL-AGQNEGIVAEREYKGVVWTESHQEADLL.............................................................. 296
59 -15.2004v8t_t mol:protein length:614 PROBABLE METALLOPROTEASE ARX1  ali model follow..  11  25...................................................................................................................................................................TQILLKDKNILQESVLNKYRTAGQIAQTALKYVSKTTQRQLTVPELCLLTDSFILTRLEQGIAIPTTID---DQISGGWCSVTGTLRPGDLVKITLGVHIDGYTSEVSHTMVIYGPLLGGKADAVAAAHIAMETVVALLACALTPEKLPASLGGT-GITGQLIRTIVDTIARSYNCGVVPGSRVRRIRRFL-AGQNEGIVAEREYKGVVWTESHQEADLL.............................................................. 294

FFAS is supported by the NIH grant R01-GM087218-01
1 2 5 9 7 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Godzik A. cd-hit: a fast program for clustering and comparing large sets of protein or nucleotide sequences. Bioinformatics. 2006 May 26;