current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 4q6g_A mol:protein length:267 Pyrrolysine--tRNA ligase, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .
# Score Template Links and tools%idFirst PALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMVAPNIFNYARKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFFQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCSVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNLLast
1 -113.0004q6g_A mol:protein length:267 Pyrrolysine--tRNA ligase  ali model  100  1PALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMVAPNIFNYARKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFFQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCSVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL 267
2 -107.0005k1p_A mol:protein length:274 Pyrrolysine--tRNA ligase  ali model follow..  97  2PALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLAFAQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL 268
3 -96.0004cs2_A mol:protein length:274 PYRROLYSINE--TRNA LIGASE  ali model follow..  97  2PALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLANYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVFGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL 268
4 -94.7004tqd_A mol:protein length:291 Pyrrolysine--tRNA ligase  ali model follow..  97  19PALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLSFIQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL 285
5 -93.4003qtc_A mol:protein length:290 Pyrrolysyl-tRNA synthetase  ali model follow..  96  17.ALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLTPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLVFWQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVFGDTLDVMHGDLELSSALVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL 282
6 -92.5002e3c_A mol:protein length:291 Pyrrolysyl-tRNA synthetase  ali model follow..  97  19PALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSGSYYNGISTNL 285
7 -90.8004bw9_A mol:protein length:291 PYRROLYSINE--TRNA LIGASE  ali model follow..  97  19PALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLGNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVFGDTLDVMHGDLELSSAVVGPRPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL 285
8 -70.6002zni_A mol:protein length:308 Pyrrolysyl-tRNA synthetase  ali model follow..  40  26SFWTKVQYQRLKELNASGEQLELSRDRAFQGIEHQLMSQGKRHLEQLRTVKHRPALLELEEKLAKALHQQGFVQVVTPTIITKSALAKMTIGEDHPLFSQVFWLDGKKCLRPMLAPNLYTLWRELERLWDKPIRIFEIGTCYRKESQGAQHLNEFTMLNLTELGTPLEHQRLEDMARWVLEAAGIEFELVTESSVVYGDTVDVMKGDLELASGAMGPHFLDEKWEIFDPWVGLGFGLERLLMIREGTQHVQSMARSLSYLDGVRLNI 301
9 -58.1002rhq_A mol:protein length:294 Phenylalanyl-tRNA synthetase alpha chain  ali model follow..  13  3........SSSSGLVPRGSHMGTELMEKLNQ-QLAEETIDVTLPSRQISIGSKHPLTRTVEEIEDLFLGLGYEIVDGYEVEQDYNFEALNLPKSHPARDMQDSFTDEILMRTHTSPVQARTMEKRNG--QGPVKIICPGKVYRRDSDDATHSHQFTQIEGLVVDKNIKMSDLKGTLELVAKKLFGADRRLRPSYFPFTEPSVEVDGWIEILGAGMVHPNVLEMAGFDSNGFAFGMGPDRIAMLKYGIEDIRYFYTNDVRF....... 276
10 -57.9001b70_A mol:protein length:350 PHENYLALANYL-TRNA SYNTHETASE  ali model follow..  13  48RKRGQELNAIKAALEAALEAREKALEEAALKEALERERVDVSLPGASLFSGGLHPITLMERELVEIFRALGYQAVEGPEVESEFNFDALNIPEHHPARDMWDTFEGRLLLRTHTSPMQVRYMVAH----TPPFRIVVPGRVFRFEQTDATHEAVFHQLEGLVVGEGIAMAHLKGAIYELAQALFGPDSRFQPVYFPFVEPGAQFAKWLELGGAGMVHPKVFQAVDAYRTGFAFGLGVERLAMLRYGIPDIRYFFGGRLKF....... 342
11 -54.3003l4g_A mol:protein length:508 Phenylalanyl-tRNA synthetase alpha chain  ali model follow..  17  179SAFSTSISKQETEL--SPEMISSGSWRDRPFKPYNFLAHGVL-----PDSGHLHPLLKVRSQFRQIFLEMGFTEMTDNFIESSWNFDALFQPQQHPARDQHDTFARKNLLRTHTTSASARALYRLAKKPFTPVKYFSIDRVFRNETLDATHLAEFHQIEGVVADHGLTLGHLMGVLREFFTKLGITQLRFKPAYNPYTEPSMEVFKWVEVGNSGVFRPEMLLPMGLPENVIAWGLSLERPTMIKYGINNIRELVGHKVNL....... 484
12 -53.7003pco_A mol:protein length:327 Phenylalanyl-tRNA synthetase, alpha subunit  ali model follow..  12  54PAAGAVINEAKEQVQQALNARKAELESAALNARLAAETIDVSLPGRRIENGGLHPVTRTIDRIESFFGELGFTVATGPEIEDDHNFDALNIPGHHPARADHDTFDTTRLLRTQTSGVQIRTMKAQ-----QPPIRIIAPGRVYRNDYDQTHTPMFHQMEGLIVDTNISFTNLKGTLHDFLRNFFEEDLRFRPSYFPFTEPSAEVDKWLEVLGCGMVHPNVLRNVGIDPEGFAFGMGMERLTMLRYGVTDLRSFFENDLRF....... 322
13 -52.5004p71_C mol:protein length:338 Phenylalanine--tRNA ligase alpha subunit  ali model follow..  15  54PKVGALINVAKEKVQDVLNARKTELEGAALAARLAAERIDVTLPGRGQLSGGLHPVTRTLERIEQCFSRIGYEVAEGPEVEDDHNFEALNIPGHHPARAMHDTFNANMLLRTHTSPVQVRTMESQ----QPPIRIVCPGRVYRCDSDLT-HSPMFHQVEGLLVDEGVSFADLKGTIEEFLRAFFEKQLRFRPSFFPFTEPSAEVDGWLEVMGCGMVHPNVLRMSNIDPEGFAFGMGAERLAMLRYGVNDLRLFFDNDLRF....... 333
14 -48.4005x6c_A mol:protein length:553 O-phosphoserine--tRNA(Cys) ligase  ali model follow..  14  79..FEEMINPVIVDEMEIYKQFGPEAMAVLDRCFYLAGLPRPDVGLGNEKVEIIKNLGIDIDEEKKERLREVLHLYKKGAIDGDEIAKALNVSNEMGLKVLETAFSTTLTLRSHMTSGWFITLSSLIKKRKLPLKLFSIDRCFRREQEDRSHLMSYHSASCVVVGEDVSVDDGKVVAEGLLAQFGFTKFKFKEKKSKYYTPETQTEEWIEVATFGVYSPIALAKYNIDVPVMNLGLGVERLAMIIYGYEDVRAMVYPQFYE....... 361
15 -45.7002du3_A mol:protein length:534 O-phosphoseryl-tRNA synthetase  ali model follow..  15  1..MKFDPQKYRELAEKDFEAAWKAGKEILAERSPNELYPRVG-----FSFGKEHPLFATIQRLREAYLSIGFSEVVNPLIVEDLIAEVLDVDDITAVKILDEVFSSTLTLRSHMTTGWFITLSHIADKLPLPIKLFSIDRCFRREQEDATRLYTYFSASCVLVDEELSVDDGKAVAEALLRQFGFENFRKDEKRSKYYIPDTQTEGWIEIATFGIYSPTALAEYDIPYPVMNLGLGVERLAMILYGYDDVRKMVYPQIHG....... 353
16 -39.3003hrk_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  15  1...............MAMGTLEAQTQGPGSMQKNMVETEPVQGCRDFPPEAMR-CRRHLFDVFHATAKTFGFEEYDAPVLESEELYIRKAGEETEQMFNFITKGGHRVALRPEMTPSLARLLLGKGRSLLLPAKWYSIPQCWRYEAITRGRRREHYQWNMDIVGVKSVSAEVECAACWAMRSLGLDVGIKVNSRKVLQTVVEQAGVTSDKFAPVCVIVDKMEKIPREE....................................... 218
17 -38.8003hri_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  14  1...............MAMGTLEAQTQGPGSMQMNMVETEPVQGCRDFPPETMR-LRKYLFDVFHSTARKFGFEEYDSPVLESEELYIKAGEEITEQMFNFITKGGHRVALRPEMTPSLARQLLAKGRSLLLPAKWYSIPQCWRYEAITRGRRREHYQWNMDIIGVKSVSSEVECAACTAMQSLGLDVGVKINSRKILQTVVEQAGVSADKFAPVCVIVDKMEKLPREE--------VAQLAAIGLESNVVDAI.............. 236
18 -38.2003od1_A mol:protein length:400 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  15  2.............................NAMSKPFMFEKPFGMRDTLPEWYKT-KKNICDQMTEEINLWGYDMIETPTLEYYETVGVVSAILDQQLFKLLDQQGNTLVLRPDMTAPIARLVASSLKDRAYPLRLAYQSNVYRAQQNEGGKPAEFEQLGVELIGDGTASADGEALMIAALKRAGLEFKVAIGHVGYVNALLMDVVGNEQRADRLRRFLYEKNYVGYREHVKSLNLSLMNLLSLRGGRAAIEE............... 232
19 -37.5004e51_A mol:protein length:467 Histidine--tRNA ligase  ali model follow..  14  5................TLEAQTQGPGSMTEQKRKLEKLTGVKGMNDILPQDAGL-WEFFEATVKSLLRAYGYQNIRTPIVEHTPLFTRGIGEVTDIVEKEMYSFGENLTLRPENTAAVVRAAIEHNMLYDGPKRLWYIGPMFRHERPQRGRYRQFHQVGVEALGFAGPDADAEMMCQRLWEDLGLTGIKLE-NLTVFEWVTDKLGAQGTVAAGGRYDPLIEQLGGKPTAACGWAMGIERILELLKEEHLVPEQEGVDVYV....... 353
20 -37.0002el9_A mol:protein length:431 Histidyl-tRNA synthetase  ali model follow..  15  4.............................YQDPMAKNIQAIRGMNDYLPGETAI-WQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTDVVEKEMYTFGDSLTLRPEGTAGCVRAGIEHGLLYNQEQRLWYIGPMFRHERPQKGRYRQFHQLGCEVFGLQGPDIDAEMLTARWWRALGISEHVTLENRTVFEWVTNSLGSQGTVCAGGRYDGLVEQLGGRATPAVGFAMGLERLVLLVQAVN................... 327
21 -36.8001wu7_A mol:protein length:434 Histidyl-tRNA synthetase  ali model follow..  14  1................................MYRLQIEKIRGFRDFYPEDMD-VEKFIFKTAEEAAEAFGFRRIDFPSLEYLDLYRKSGEELLQQTYSFVDKGGREVTLIPEATPSTVRMVTSR-KDLQRPLRWYSFPKVWRYEEPQAGRYREHYQFNADIFGSDSPEADAEALASSILDRLGLQYEIRINSRKIMEEIIGGMTSSDPFS-SIIDRYHKISREEFVDQLRSAGIGEDGVSMIADLCSGTRGIDE............ 227
22 -36.4003rac_A mol:protein length:373 Histidine-tRNA ligase  ali model follow..  14  7.....................TRSAWGARAWEAVRGFADRPPGMQDGYPDFAKR-RRAVETRLLSFVEDAGYEPVTSGLFEYVDTLRARSPESSRDWIRLFDGGGDAVALRPEMTPSIARMAAPRVAAGRTPIRWCYCERVYRRTSWASGKAAESTQVGIERIGEEASVMDVLRLLHEASAAAGVHHRIVVSHARLVPRLLDALGISASLSRAFLACLTSGNYVQFRE....................................... 223
23 -36.2001z7m_A mol:protein length:344 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  12  1......................MRGSGSIEGRMEKINYLLPEESAEMTLNQVKS-LRQIEGRLRKLFSLKNYQEVMPPSFEYTQLYTALESNGKEKMFQFIKHEGQSITLRYDFTLPLVRLYSQIKD--STSARYSYFGKIFRKEKRHKGRSTENYQIGIELFGESADKSELESLALQVIEQLGLKTVFEIGSAKFFQRLCQLADGSTELLTELLLKKDLS--------------GLNAFIEKNNFSKELRGLLKEIFITNELS... 232
24 -36.0004g85_A mol:protein length:517 Histidine-tRNA ligase, cytoplasmic  ali model follow..  13  31.GLKQQKASAELIEEEVAKLLKLKAQLGPDESKQKFVLKTPKGTRDYSPRQMA-VREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAMNK---LTNIKRYHIAKVYRRDNPARGRYREFYQCDFDIAGNFDPMAECLKIMCEILSSLQIDFLVKVNDRRILDGMFAICGVSDSKFRTICSSVDKLDKVSWEE....................................... 259
25 -35.9003net_A mol:protein length:465 Histidyl-tRNA synthetase  ali model follow..  14  1..........................SNAMAKNDKINFSTPSGFPEFLPSEKR-LELYLLDTIRRVYESYGFTPIETPAVERLEVLQAKGNQGDNEKDKSGDTGSEARALKFDQTVPLAAYIARHLNDLTFPFARYQMDVVFRGERAKDGRFRQFRQCDIDVVGRELYDAQMPAIITEIFEAVNIDFVIRINNRKVLTGFFQSLNISETQIKSCISIIDNLEKIGEA----KVKLELEKEGINPEQTQKIIDFVKIDGSVDDVLDKL 256
26 -35.7005e3i_A mol:protein length:438 Histidine--tRNA ligase  ali model follow..  14  1................................MAMSSIVAIKGFNDVLPTQTAA-WRRLEQHLASLMDAYGYQQIRLPIVEQTGLFKRAIGDATDIVEKEMYTFFESLTLRPEGTAGCVRALVEHNLLRGATPRVWYMGPMFRYEKPQKGRYRQFHQFGVETFGVATPDIDAEMLTARLWKRMGVDHMVQLE........................................................................... 167
27 -35.4004g84_A mol:protein length:464 Histidine--tRNA ligase, cytoplasmic  ali model follow..  14  6.............................FELRRQFVLKTPKGTRDYSPRQMA-VREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAMNK---LTNIKRYHIAKVYRRDNPTRGRYREFYQCDFDIAGNFDPMAECLKIMCEILSSLQIDFLVKVNDRRILDGMFAICGVSDSKFRTICSSVDKLDKVSWEE....................................... 206
28 -35.1004rdx_A mol:protein length:423 Histidine--tRNA ligase  ali model follow..  18  1.................................GPMTARAVRGTKDLFGKELRM-HQRIVATARKVLEAAGALELVTPIFEETQVFEKGVGAATDIVRKEMFTFGRSLTLRPEGTAAMVRYLEHGMKVWPQPVRLWMAGPMFRAERPQKGRYRQFHQVNYEALGSENPILDAEVLLYECLKELGLR................................................................................. 159
29 -34.7001qe0_A mol:protein length:420 Histidine--tRNA ligase  ali model follow..  17  1....................................MIKIPRGTQDILPEDSKK-WRYIENQLDELMTFYNYKEIRTPIFESTDLFARGVGDSTDVVQKEMYTFDRSITLRPEGTAAVVRSYIEHQGNPNQPIKLYYNGPMFRYERKQKGRYRQFNQFGVEAIGAENPSVDAEAMVMHIYQSFGLKHLKLV............................................................................ 162
30 -34.3003cmq_A mol:protein length:415 Phenylalanyl-tRNA synthetase, mitochondrial  ali model follow..  15  2AAECATQRAPGSVVELLGKSYPQDDHSNLTRKVLTRVGRNLH-------NQQHHPLWLIKERVKEHFYKQYVGRFGTPLFSTWQNFDSLLIPADHPSRKKGDNY----YLNRTHMLRAHTSAHQWDLLHAGLDAFLVVGDVYRRDQIDSQHYPIFHQLEAVRLAVKLVEFDLKQTLTRLMAHLFGDELEIVDCYFPFTHPSFEMEEWLEVLGCGVMEQQLVNSAGAQDRGWAFGLGLERLAMILYDIPDIRLFWCEDERF....... 303
31 -31.9006FTT Entity 1(prereleased)  ali follow..  5.........................................DGVADVLFEDAHK-QEVLRHQLTQQLITHGYQLVSPPMIEFTESLSGASEDLKRQTFKIIDQLTRLMGIRADITPQILRIDAHHGG--DGIARYCYAGDVIHTLPSGLFGSRTPLQLGAEIFGCESIAADIEDVLFSMINSLDMSLHVDLGHVTIFKRLAELAALSASDTEQLMQLYANKNLPELKQVCQVLPMGAQQDTKIVTAIDELQRLKAHLQVQWQCAVSI 256
32 -31.9005m8h_A mol:protein length:388 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  5.........................................DGVADVLFEDAHK-QEVLRHQLTQQLITHGYQLVSPPMIEFTESLSGASEDLKRQTFKIIDQLTRLMGIRADITPQILRIDAHHGG--DGIARYCYAGDVIHTLPSGLFGSRTPLQLGAEIFGCESIAADIEDVLFSMINSLDMSLHVDLGHVTIFKRLAELAALSASDTEQLMQLYANKNLPELKQVCQVLPMGAQQDTKIVTAIDELQRLKAHLQVQWQCAVSI 256
33 -29.9001usy_A mol:protein length:275 ATP PHOSPHORIBOSYLTRANSFERASE REGULATORY SUBUNIT  ali model follow..  17  7.........................................................EKVFSFYSKATKKGFSPFFVPALEKAEEPA---------GNFFLDRKGNLFSIREDFTKTVLNHRKRYSP--DSQIKVWYADFVYRYSG---SDLVAEYQLGLEKVPRNSLDDSLEEIIVESASEFFEPVIVEIGHTGVYEDLLKEIPKDLH.......................................................... 147
34 -28.6003a5y_A mol:protein length:345 Putative lysyl-tRNA synthetase  ali model follow..  16  2...........................GSSSSGLVPRGSHMSETASWQPSASIPNLAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLVPFETRFVGPGHSQGMNLWLMTSPEYHMKRLLVAGCG------PVFQLCRSFRNEEMGRYHNPEFTMLEWYRPHYDMYMNEVDDLLQQVLAQISTEDHRVAERFEVYYKGIELANGFHELTDAREQQQRFEQDNRKRPDCSGVALGVDRLVMLALGAETLAEV.............. 331
35 -28.5003ig2_A mol:protein length:213 Phenylalanyl-tRNA synthetase beta chain  ali model follow..  17  8.........................................................KLQNLVAEQLVGCGFNEILNNSLTRAAYYDGLESYPSKNLVMLLNPLSADLCMRQTLLFGGLESIAHNANRKNADLKFFEFGNCYHFDAEKKNPEKEDYHLGLWVTGKMVSNSELKAYVENIFKRLGLDLHSLVVGNLS-TALTVNTKGGKRLATFGVVTKKMLKAFDVDNEVYYADLNWKELM.......................... 213
36 -28.2003ica_A mol:protein length:213 Phenylalanyl-tRNA synthetase beta chain  ali model follow..  16  8.........................................................KWQTVVSEQLVGAGFNEILNNSLTAGSYYEGLKSHPREMAVELMNPLSQELCMRQTLLFGGLETLSHNLRRKHLSLYLFEWGKCYRFHAAKRTDETEDDRLGIWICGQRVHNSELKAVVEQVLCRVGIETGAYTLKTA--SAMEVKTRSGKLLGTFGTVSTELIKRFEIEQPVYFAELLWDALM.......................... 213
37 -27.3003g1z_A mol:protein length:326 Putative lysyl-tRNA synthetase  ali model follow..  17  15..................................................PNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLFPFETRFVGPGHSQGINLYLMTSPEYHMKRLLAAGCG------PVFQLCRSFRNEEMGRHHNPEFTMLEWYRPHYDMYMNEVDDLLQQVLAQISTEDHRVAERFEVYYKGIELANGFHELTDAREQQQRFEQDNRKRPDCSGVALGVDRLVMLALGAESLADV.............. 318
38 -26.0005hgq_A mol:protein length:524 Lysine--tRNA ligase  ali model follow..  18  138............IQLTPCLHMLPHTHFGLKNQETRYRMRYLDLIMNPDVKNRFVTRSRMISFLRRYLDNLGFLEVETPMMNLI-----AGGATAKPFITHHNDLDMDLYLRVAPELYLKMLVVGGID------RVYEIGRVFRNEGIDQTHNPEFTSCEFYMAYAD--YEDLMKITEDMLARMV-SIPGLTERFELFVVTKEIVNAYTELNDPLTQRLRFDEQAKQKPPTAGWGMGIDRLAMILTDSNNIKEVL............. 503
39 -26.0003bju_A mol:protein length:521 Lysyl-tRNA synthetase  ali model follow..  17  136............TLLSPCLHMLPHLHFGLKDKETRYRQRYLDLILNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNII-----PGGAVAKPFITYHNELDMNLYMRIAPELYHKMLVVGGID------RVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYAD--YHDLMEITEKMVSGMV-SKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKAKPPTAGWGMGIDRVAMFLTDSNNIKEV.............. 499
40 -25.9001e1o_A mol:protein length:504 LYSYL-TRNA SYNTHETASE, HEAT INDUCIBLE  ali model follow..  17  143............RLLTKALRPLPDKFHGLQDQEVRYRQRYLDLIANDKSRQTFVVRSKILAAIRQFMVARGFMEVETPMMQVI-----PGGASARPFITHHNALDLDMYLRIAPELYLKRLVVGGFE------RVFEINRNFRNEGISVRHNPEFTMMELYMAYADYHIELTESLFRTLAQEVLGTTKVTYGEHVFITDRFEFFIGGREIGNG-FQEQVNAKAAGDDPPTAGLGIGIDRMIMLFTNSHTIRDVI............. 495
41 -25.8001bbu_A mol:protein length:504 PROTEIN (LYSYL-TRNA SYNTHETASE)  ali model follow..  16  143............RLLTKALRPLPDKFHGLQDQEARYRQRYLDLISNDESRNTFKVRSQILSGIRQFMVNRGFMEVETPMMQVI-----PGGAAARPFITHHNALDLDMYLRIAPELYLKRLVVGGFE------RVFEINRNFRNEGISVRHNPEFTMMELYMAYADYKIELTESLFRTLAQDILGKTEVTYGDVTLITDRFEFFIGGREIGNG-FLDQVAAKDAGDDPPTAGLGIGIDRMVMLFTNSHTIRDV.............. 494
42 -25.8003a74_A mol:protein length:493 Lysyl-tRNA synthetase  ali model follow..  14  134............EFLTKALRPLPEKYHGLKDIEQRYRQRYLDLIMNPESKKTFITRSLIIQSMRRYLDSHGYLEVETPMMHAV-----AGGAAARPFITHHNALDMTLYMRIAIELHLKRLIVGGLE------KVYEIGRVFRNEGISTRHNPEFTMLELYEAYAD--FRDIMKLTENLIAHIA-DDPRFTDRFELFIVGREHANAFTELNDPIDQRQRFEEQLKERPPTGGLGIGVDRLVMLLTNSPSIRDVL............. 485
43 -25.7005eln_A mol:protein length:535 Lysine--tRNA ligase  ali model follow..  16  146............VLLSPCYHMLPTAISGLKDQEVRYRQRYLDLMLNEESRKVFKLRSRAIKYIRNYFDRLGFLEVETPMLNMI-----YGGAAARPFITYHNELETQLYMRIAPELYLKQLIVGGLD------KVYEIGKNFRNEGIDLTHNPEFTAMEFYMAYAD--YYDLMDLTEELISGLV-EKPEMTERFELFVLGKELCNAYTELNEPLQQRKFFEQQADAKPPTGGWGLGIDRLIMFLADKNNIKEVI............. 508
44 -25.6004ex5_A mol:protein length:529 Lysine--tRNA ligase  ali model follow..  16  158............RLLAKALRPLPDKFHGLADQETRYRQRYVDLIVTPETRTTFRARTKAIASIRKFMGDADFMEVETPMLHPI-----PGGAAAKPFVTHHNALDMEMFLRIAPELYLKRLIVGGFE------RVFEINRNFRNEGVSPRHNPEFTMMEFYAAYTDYRMDFTERLIRQAAVDALGTATIQYQGRELITERFELFITGREIANG-FKKQVEQKDAGDEPPTGGCGIGIDRLVMLLTDSPTIRDVL............. 514
45 -25.2003p8t_A mol:protein length:294 AsnS-like asparaginyl-tRNA synthetase related protein  ali model follow..  21  6...........................................IISRDIYKAIDIQTKILDYMTKFFTDRGFKWLLPIMLSPITDPLWPDPAGEGIRPAEVDVYGVRMRLTH--SMILHKQLAIAMG------KIFVLSPNIRLESRRKRHSYEFTQLDFEIEGAK--MKDVMRLIEELIYGLFRKAEEWTGREFPRARHFKVYDGYGEVSSGGEREWEYEKRAGKLKPSAGAGIGVERLVRFIVGAKHIAEV.............. 281
46 -25.2004h2w_A mol:protein length:346 Amino acid--[acyl-carrier-protein] ligase 1  ali model follow..  13  1..MGSSSSGLVPRGSHMNIAVLPNSPDTAPQIADPLDHLADKLFHSMGSDGVTALYESIVERLAALITSHGTEALRFPPVMSRAQLEKSGSRFDAGGDWTTSLSPADLVLSPAACYPVYPIAASRGPLPKGGLRFDVAADCFRREPSHLDRLQSFRMREYVCIGTPDDVERWMVRAQAIARDLGLTFRVDYASDPFFGRAGKMLEQPTACMSFNYHREHFGTTWGIQDA--CVAFGMDRLAVAMFH-AKVRDILGLQ.......... 327
47 -24.6006chd_A mol:protein length:597 Lysine--tRNA ligase  ali model follow..  17  204............TLLSPCLHMLPHLHFGLKDKETRYRQRYLDLILNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNII-----PGGAVAKPFITYHNELDMNLYMRIAPELYHKMLVVGGID------RVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYAD--YHDLMEITEKMVSGMV-SKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKAKPPTAGWGMGIDRVAMFLTDSNNIKEV.............. 567
48 -24.6003mey_A mol:protein length:346 Bll0957 protein  ali model follow..  14  1..MGSSSSGLVPRGSHMNIAVLPNSPDTAPQIADPLDHLADKLFHSMGSDGVTALYESIVERLAALITSHGTEALRFPPVMSRAQLEKSG-GTEREINAAVSRFDADLVLSPAACYPVYPIAASRGPLPKGGLRFDVAADCFRREPSHLDRLQSFRMREYVCIGTPDDVERWMVRAQAIARDLGLTFRVDYASDPFFGRPLRSEEQPTACMSFNYHREHFGTTWGIQDA--CVAFGMDRLAVAMFHTAKVRDILGLQ.......... 327
49 -24.4004ycv_A mol:protein length:516 Lysine--tRNA ligase  ali model follow..  17  151...........................GLKDTEIRYRQRYLDLLINESSRHTFVTRTKIINFLRNFLNERGFFEVETPMMNLI-----AGGANARPFITHHNDLDLDLYLRIATELPLKMLIVGGID------KVYEIGKVFRNEGIDNTHNPEFTSCEFYWAYAD--YNDLIKWSEDFFSQLV-TKPGLTERLEMFICGKEVLNAYTELNDPFKQKECFKLQQKDRPPTGGLGLGIDRITMFLTNKNSIKDVI............. 499
50 -24.1006aqh_A mol:protein length:508 Lysine--tRNA ligase  ali model follow..  20  159..............................SEESRVRQRYVDLIVRDQARKVARQRIAVMRAIRSALERRGFLEVETPMLQTL-----AGGAAARPFVTHSNALDTELYLRIAPELFLKRCLVGGFE------RVFELNRVFRNEGADSTHSPEFVMLETYQAYGT--YDDSAVVTRELIQEV.................................................................................... 298
51 -24.1005vl1_A mol:protein length:506 Lysine--tRNA ligase  ali model follow..  20  156..............................SEESRVRQRYVDLIVRPQAREVARQRIAVIRAVRNALERRGFLEVETPMLQTL-----AGGAAARPFVTHSNALDIDLYLRIAPELFLKRCIVGGFD------RVFELNRVFRNEGSDSTHSPEFSMLETYQTYGT--YDDSALITRELIQEV.................................................................................... 295
52 -23.9001nnh_A mol:protein length:294 asparaginyl-tRNA synthetase-related peptide  ali model follow..  20  6...........................................IISREISPTLDIQTKILEYMTDFFVKEGFKWLLPVIISPITDPLWPDPAGEGMEPAEVEIYGVKMRLT--HSMILHKQLAIAMG------KIFVLSPNIRLESRQKDHAYEFTQLDFEVERAK--MEDIMRLIERLVYGLFRKAEEWTGREFPKTKRFEVFEGYGEVASGGEREWEYEKKAGKLKPSAGAGIGVERLVRFIVGAKHIAEV.............. 281
53 -23.3004up7_A mol:protein length:777 LYSINE--TRNA LIGASE  ali model follow..  17  134............MILSPCLHMLPSMHYGLGDQETRFRKRYLDLIVNPESVKNFVLRTKVVKAVRKYLDDKGFLEVETPILNT-----IPGGATARPFITHHNQLDIQMYMRIAPELYLKELVVGGIN------RVYEIGRLFRNEGIDQTHNPEFTTCEFYMAYAD--YNDIMKMTEELLGNM.................................................................................... 291
54 -23.0003l4g_B mol:protein length:589 Phenylalanyl-tRNA synthetase beta chain  ali model follow..  12  335.YLKSEVIGDGNQIEIEIPPTRADIIHACDIVEDAAIAYGYNNIQMTLPKANQFPLNKLTELLRHDMAAAGFTEALTFALCSQEDIADKDISATKAVHISNPKTAEFQVARTTLLPGLLKTIAANRKM-PLPLKLFEISDIVIKDSNTDVGAKNYRHLCAVYYNKNPGFEIIHGLLDRIMQLLDVPPGEDKGGYVI-GRCAEIFARGQSVGKLGVLHPDVITKFELTMPCSSLEINIGPFL.......................... 589
55 -22.3004j15_A mol:protein length:521 Aspartate--tRNA ligase, cytoplasmic  ali model follow..  17  177..................EAEGEEEGRATVNQDTRLDNRVID-LRTSTSQAVFRLQSGICHLFRETLINKGFVEIQTPKIISAA-----SEGGANVFT--VSYFKNNAYLA--QSPQLYKQMCICAD------KVFSIGPVFRAEDSNTRHLTEFVGLDIEMAFNY-HYHEVMEEIADTMVQI---YTMPDPRNPKQSNSYDMFMRGEEILSGAQLLTERALHHGIDLEKIGGGIGLERVTMLFLGLHNVRQT.............. 503
56 -21.8004wj3_M mol:protein length:599 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  18  96....EVLGYELEVLNQAETPPFPLDEYSDVGEETRLRYRFID-LRRPEMAAKLKLRARITSSIRRYLDDNGFLDVETPIL-----GRPTPEGARDYLVPSRTYPGHFFALP--QSPQLFKQLLMVAG------RYYQIAKCFRDEDLRADRQPEFTQIDIETS---LDESDIIGITEKMVRQL.................................................................................... 260
57 -21.7005xix_A mol:protein length:472 Asparagine--tRNA ligase, cytoplasmic  ali model follow..  16  113PGGHELSCDFWELIGLAPAGGADNLINEESDVDVQLNNRHMM-IRGENMSKILKARSMVTRCFRDHFFDRGYYEVTPPTLVQTQVEGGATL--------KLDYFGEEAFLT--QSSQLYLETCLPALG-----DVFCIAQSYRAEQSRTRHLAEYTHVEAECLTFDDLLNRLEDLVCDVVDRILKSPAGSIVKRMNYSDAIVWLKE--EIVGGSMRIFDSEKREGIDPTPYGYGLGLERFLTWILNRYHIRDV.............. 454
58 -21.4001asy_A mol:protein length:490 ASPARTYL-tRNA SYNTHETASE  ali model follow..  17  146................RSEAEAEAAGLPVVNLDTRLDYRVID-LRTVTNQAIFRIQAGVCELFREYLATKKFTEVHTPKLLGAP-------SEGGSSVFEVTYFKGKAYLA--QSPQFNKQQLIVAD------RVYEIGPVFRAENSNTHHMTEFTGLDMEMAFEE-HYHEVLDTLSELFVFI---YTMPDPANPKYSNSYDFFMRGEEILSGAQLLQERMKAHGLSPPHAGGGIGLERVVMFYLDLKNIRRA.............. 478
59 -21.4001efw_A mol:protein length:580 ASPARTYL-TRNA SYNTHETASE  ali model follow..  16  115......................RGEEEKEASEELRLKYRYLDLRRRRM-QENLRLRHRVIKAIWDFLDREGFVQVETPFL-----TKSTPEGARDFLVPYRHEPGLFYALP--QSPQLFKQMLMVAG------RYFQIARCFRDEDLRADRQPDFTQLDLEMS---VEVEDVLELNERLMAHV.................................................................................... 261
60 -21.3001n9w_A mol:protein length:422 aspartyl-tRNA synthetase 2  ali model follow..  16  76....EVQAKEVEVLSPALEPTPVEKEEWRANPDTLLEYRYVT-LRGEKARAPLKVQAALVRGFRRYLDRQDFTEIFTPKVVR-------AGAEGGSGLFGVDYFEKRAYLA--QSPQLYKQIMVGVFE-----RVYEVAPVWRMEEHTSRHLNEYLSLDVEMGFIA-DEEDLMRLEEALLAEMSVRPFYTYPEEDGTTRSFDLLFRGLEITSGGQRIHRYEKAKGMDPEAFGFAIGAERLTQKLLGLPNVRYA.............. 410
61 -21.2003i7f_A mol:protein length:548 Aspartyl-tRNA synthetase  ali model follow..  17  209................LLKEKASAQKYVKVSQDTRLDNRMLD-LRTVTNIAIFRIQSACCGLFREFLTSQKFVEIHTPKLIGCS-----SEGGSNIFE--VKYFDRKAYLA--QSPQLYKQMAIMGD------KVFEVGPVFRAENSNTRHLTEFEGLDIEMEIVE-NYHECIDVMEKLFTFI---YTMPDIDDPNYSNSYDVFVRGQEITSGAQRIHDPEIEKGVDPATLGCGIGLERITMLYLGIPNIRKV.............. 536
62 -21.2001x54_A mol:protein length:434 Asparaginyl-tRNA synthetase  ali model follow..  18  96............EVIQAVSEFPIPENPEQASPELLLDYRHLH-IRTPKASAIMKVKETLIMAAREWLLKDGWHEVFPPILVT-------GAVEGGATLFKLKYFDKYAYLS--QSAQLYLEAAIFGLE-----KVWSLTPSFRAEKSRTRHLTEFWHLELEAMDLWDIMKVEEELVSYMVQRTLELRKKEIEPRISYDEAIDILQGYGEIIGGSQREDDYDLEEGMDPKDYGFGLGVERLVAWVLKLDHIRWA.............. 422
63 -21.0001wyd_A mol:protein length:429 hypothetical aspartyl-tRNA synthetase  ali model follow..  16  86....ELHAEEITLLSKAKAPLPLDVSGKVKADIDTRLRERVLDLRRQEMQAVIKIQSLALKAFRETLYKEGFIEIFTPKIIASAT-------EGGAQLFPVIYFGKEAFLA--QSPQLYKELMAGVVE-----RVFEVAPAWRAEESDTPHLAEFISMDVEMADYNDVMQLLEKILHNIVKTIKEEYTKSKSENPELSESFDLIYKFLEIVSGSTVLEEALKKKGLKPESFGFGMGLARLMVMLTGIQSVKEI.............. 417
64 -20.8004rmf_A mol:protein length:609 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  17  84...PEIPTGQIEVNATELTVLGESA-DEQAGEEARLKYRYLD-LRREGPGNALRLRSKVNAAARSVLAEHDFVEIETPTL-----TRSTPEGARDFLVPARLQPGSFYALP--QSPQLFKQLLMVAG------RYYQIARCYRDEDFRADRQPEFTQLDMEMSFVE--ADDVIAISEQVLKAV-----------------WATIGYDLPLPLPRISYEEAMRRFGSDKPDLRFGIELVECTEY........................ 297
65 -20.7003m4p_A mol:protein length:456 Asparaginyl-tRNA synthetase, putative  ali model follow..  12  117............KVIGESPIDLENIINKDSSIPQKMQNRHIV-IRSEHTQQVLQLRSEIQWYFRKYYHDNHFTEIQPPTIVKTQ-------CEGGSTLFKLQYFNEPAYLT--QSSQLYLESVIASLG-----KSFCMLSSYRAEQSRTVHLAEYLHLEAELISFEDLLNHLEDLVCTVIDNVMAVHGDKIRKMNTYADAIKYCND--EIVGGSMRIWNYDKANGLNPDPYGYGLGVERLVMWLLGEDHIRKV.............. 444
66 -20.7004o2d_A mol:protein length:620 Aspartate--tRNA ligase  ali model follow..  17  100...PEIPTGQIEVNATELTVLGESA-DEQAGEEARLKYRYLD-LRREGPGNALRLRSKVNAAARSVLAEHDFVEIETPTL-----TRSTPEGARDFLVPARLQPGSFYALP--QSPQLFKQLLMVAG------RYYQIARCYRDEDFRADRQPEFTQLDMEMS---VEADDVIAISEQVLKAV-----------------WATIGYDLPLPLPRISYEEAMRRFGSDKPDLRFGIELVECTEY........................ 313
67 -20.5002xti_A mol:protein length:437 ASPARAGINYL-TRNA SYNTHETASE, CYTOPLASMIC, PUTATIVE  ali model follow..  15  83PNGHELIADFWKIIGNAPPGGIDNVLNEEASVDKMLDNRHLV-IRGENAAALLRLRAAATRAMREHFYNAGYVEVAPPTLVQTQVEGGSTL--------NLDYFGEQSFLT--QSSQLYLETCIPTLG-----DVFCIAQSYRAEKSRTRHLAEYAHVEAECITLDDLMEKIEELVCDTVDRLLADEEAKKLLRMEYKDAIKWLQE--EIVGGSMRIWKFDKNVEIDPKPYGYGLGLERFICWLTNTNHIRDV.............. 425
68 -20.3002i4l_A mol:protein length:458 Proline-tRNA ligase  ali model follow..  13  8.LVPRGSHMRLSRFFLPILKENPKEAEIVSHRRAGMLRQEAAGIYAWLPLGHR-VLKKIEQIVREEQNRAGAIELLMPTLQLADLWRESGDAYGPEMLRIADRHKRELLYGPTNEEMITEIFRAYIKSYKSPLNLYHIQWKFRDEQRPRFRGREFLMKDAYSFDVDEAGARMFVAYLRTFARMGLKAIPMRAETGPIG..................................................................... 217
69 -20.3005w25_A mol:protein length:616 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  15  97PEGNANPEIATGEIEVNATSLTV-QLDEPAGEELRLKYRYLD-LRRDDPAAAIRLRSRVNAAARAVLARHDFVEIETPTI-----TRSTPEGARDFLVPARLHPGSFYALP--QSPQLFKQLLMVAG------RYYQIARCYRDEDFRADRQPEFTQLDMEMS---VDAEDIIAISEEVLTEL-----------------WALIGYRIPTPIPRIGYAEAMRRFGTDKPDLRFGLELVECTDF........................ 316
70 -20.1001b8a_A mol:protein length:438 PROTEIN (ASPARTYL-TRNA SYNTHETASE)  ali model follow..  17  89....EILPEKIVVLNRAETPLPLDPTGKVKAELDTRLNNRFMDLRRPEVMAIFKIRSSVFKAVRDFFHENGFIEIHTPKIIATA-------TEGGTELFPMKYFEEDAFLAESPQLYKEIMMASGLD------RVYEIAPIFRAEEHNTTHLNEAWSIDSEMADEEEVMSFLERLVAHAINYVREHYIMKYDNKPEICRAFDLEYRGVEISSGGQILVEQIKEKGLNPESFGFGLGAERLIKQMLDLPNIREV.............. 426
71 -19.8001eqr_A mol:protein length:590 ASPARTYL-TRNA SYNTHETASE  ali model follow..  16  79DEKNINRDMATGEIEVLASSLTI-DSNHVNTEEARLKYRYLD-LRRPEMAQRLKTRAKITSLVRRFMDDHGFLDIETPML-----TKATPEGARDYLVPSRVHKGKFYALP--QSPQLFKQLLMMSG------RYYQIVKCFRDEDLRADRQPEFTQIDVETS---MTAPQVREVMEALVRHL.................................................................................... 255
72 -19.0004ah6_A mol:protein length:617 ASPARTATE--TRNA LIGASE, MITOCHONDRIAL  ali model follow..  15  101....EIKVKTAELLNACKKLPFEIKNFVKKTEALRLQYRYLDLRSFQM-QYNLRLRSQMVMKMREYLCNLGFVDIETPTL------FKRTPGGAKEFLVPSREPGKFYSLP--QSPQQFKQLLMVGG------RYFQVARCYRDEGSRPDRQPEFTQIDIEMS---VDQTGIQSLIEGLLQYS.................................................................................... 265
73 -18.4002cim_A mol:protein length:522 SERYL-TRNA SYNTHETASE  ali model follow..  16  225........................................................ARIFRTFEKIVLELGYREMIFPKLVTWEVWMKSGTHEVPTKLIKEKIAEPIGGMCYAQCPPFWMYVAGETLPNEEPVKVFDRGTSHRYESHGIERVDEFHRIEIVWIGTKEEVLKLHDRYMHIFNDILDIEWRKARVTPWFMAQEGLLGEWLEFQNVSINGDKYPKGFNVKLQ--CSGVGLERWAAV........................ 486
74 -18.4004lns_A mol:protein length:351 Asparagine synthetase a  ali model follow..  10  11..................................................LLQEQILTVKRSFSEALEKLNLVEVRAPILFRVGDGTQDNLSGFEKAVQVPVKAIPNASFEVVHSLAKWKRRTLANYKFAPGHGLYTHMTALRVDDLDNIHSVVVDQWDWEMVDDQRNLAFLKEVVCKVYAAIRKTELAVCEKYKQKPILPETIDDSLEVSSMGI-AEALRHQISLTPQTVGGGIGQSRMVMFMLRKKHIGEVQCSVWPEEIRKKH. 348
75 -18.1004hvc_A mol:protein length:519 Bifunctional glutamate/proline--tRNA ligase  ali model follow..  7...QGPKKQTRLGLEAKKEENLADWYSQVITKSEMIEYHDISGCYILRPWAYA-IWEAIKDFFDAEIKKLGVENCYFPMFVSQSALEKEKTHVADVTRSGKTELAEPIAIRPTSETVMYPAYAKWVQSHRDPIKLNQWCNVVRWEFKHPQRTREFLWQEGHSAEAAEEVLQILDLYAQVYEELLAIPVVK............................................................................. 208

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 7 1 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I. and Godzik A Connecting the Protein Structure Universe by Using Sparse Recurring Fragments. Structure (Camb.) (2005) Aug;13(8):1213-24