current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 4rdx_A mol:protein length:423 Histidine--tRNA ligase, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420
# Score Template Links and tools%idFirst GPMTARAVRGTKDLFGKELRMHQRIVATARKVLEAAGALELVTPIFEETQVFEKGVGAATDIVRKEMFTFQDRGGRSLTLRPEGTAAMVRAYLEHGMKVWPQPVRLWMAGPMFRAERPQKGRYRQFHQVNYEALGSENPILDAEAVVLLYECLKELGLRRLKVKLSSVGDPEDRARYNAYLREVLSPHREALSEDSKERLELNPMRILDSKSERDQALLKELGVRPMLDFLGEEARAHLKEVERHLERLSVPYELEPALVRGLDYYVRTAFEVHHEEIGAQSALGGGGRYDGLSELLGGPRVPGVGFAFGVERVALALEAEGFGLPEEKGPDLYLIPLTEEAVAEAFYLAEALRPRLRAEYALAPRKPAKGLEEALKRGAAFAGFLGEDELRAGEVTLKRLATGEQVRLSREEVPGYLLQALGLast
1 -133.0004rdx_A mol:protein length:423 Histidine--tRNA ligase  ali model  100  1GPMTARAVRGTKDLFGKELRMHQRIVATARKVLEAAGALELVTPIFEETQVFEKGVGAATDIVRKEMFTFQDRGGRSLTLRPEGTAAMVRAYLEHGMKVWPQPVRLWMAGPMFRAERPQKGRYRQFHQVNYEALGSENPILDAEAVVLLYECLKELGLRRLKVKLSSVGDPEDRARYNAYLREVLSPHREALSEDSKERLELNPMRILDSKSERDQALLKELGVRPMLDFLGEEARAHLKEVERHLERLSVPYELEPALVRGLDYYVRTAFEVHHEEIGAQSALGGGGRYDGLSELLGGPRVPGVGFAFGVERVALALEAEGFGLPEEKGPDLYLIPLTEEAVAEAFYLAEALRPRLRAEYALAPRKPAKGLEEALKRGAAFAGFLGEDELRAGEVTLKRLATGEQVRLSREEVPGYLLQALG 423
2 -125.0001qe0_A mol:protein length:420 Histidine--tRNA ligase  ali model follow..  41  2....IKIPRGTQDILPEDSKKWRYIENQLDELMTFYNYKEIRTPIFESTDLFARGVGDSTDVVQKEMYTFKDKGDRSITLRPEGTAAVVRSYIEHKMGNPNQPIKLYYNGPMFRYERKQKGRYRQFNQFGVEAIGAENPSVDAEVLAMVMHIYQSFGLKHLKLVINSVGDMASRKEYNEALVKHFEPVIHEFCSDCQSRLHTDPMRILDCKVDRDKEAIK--TAPRITDFLNEESKAYYEQVKAYLDDLGIPYTEDPNLVRGLDYYTHTAFELMMDNPNAITTLCGGGRYNGLLELLDGPSETGIGFALSIERLLLALEEEGIELDIEENLDLFIVTMGDQADRYAVKLLNHLRHGIKADKDYLQRKIKGQMKQADRLGAKFTIVIGDQELENNKIDVKNMTTGESETIELDALVEYFKK... 420
3 -121.0005e3i_A mol:protein length:438 Histidine--tRNA ligase  ali model follow..  36  2AMSSIVAIKGFNDVLPTQTAAWRRLEQHLASLMDAYGYQQIRLPIVEQTGLFKRAIGDATDIVEKEMYTFFDKGNESLTLRPEGTAGCVRALVEHNL-LRGATPRVWYMGPMFRYEKPQKGRYRQFHQFGVETFGVATPDIDAELIMLTARLWKRMGVDHVQLELNTLGETDERTEYRNALVAFLNEHKDALDEDSQRRLTTNPLRILDSKIESTQKILE--NAPKLHDFLKEDSLSHFQQLQDYLTAAGIKFVINQKLVRGLDYYNKTVFEWTTTALGSQGTVCAGGRYDGLVGQLKGKSVPAVGFAMGMERLLLLLEQVEQAE--IVRDCEAFLVAEPAYQSKALVLAEQLRQLEAANSNIRQGSMKSQMKKADQAGAVYAIILGEREWEAQQLAVKELATAEQSQVALAELVPFLIEKFT 431
4 -121.0002el9_A mol:protein length:431 Histidyl-tRNA synthetase  ali model follow..  41  9.AKNIQAIRGMNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTDVVEKEMYTFEDRNGDSLTLRPEGTAGCVRAGIEHGL-LYNQEQRLWYIGPMFRHERPQKGRYRQFHQLGCEVFGLQGPDIDAELIMLTARWWRALGISHVTLELNSIGSLEARANYRDALVAFLEQHKEKLDEDCKRRMYTNPLRVLDSKNPEVQALLN--DAPALGDYLDEESREHFAGLCKLLESAGIAYTVNQRLVRGLDYYNRTVFEWVTNSLGSQGTVCAGGRYDGLVEQLGGRATPAVGFAMGLERLVLLVQAVNPEFKADPVVDIYLVASGADTQSAAMALAERLRDGVKLMTNHGGGNFKKQFARADKWGARVAVVLGESEVANGTAVVKDLRSGEQTAVAQDSVAAHLRTLLG 431
5 -113.0004e51_A mol:protein length:467 Histidine--tRNA ligase  ali model follow..  39  22KLEKLTGVKGMNDILPQDAGLWEFFEATVKSLLRAYGYQNIRTPIVEHTPLFTRGIGEVTDIVEKEMYSFVDANGENLTLRPENTAAVVRAAIEHNM-LYDGPKRLWYIGPMFRHERPQRGRYRQFHQVGVEALGFAGPDADAEIVMMCQRLWEDLGLTGIKLEINSLGLAEERAAHRVELIKYLEQHADKLDDDAQRRLYTNPLRVLDTKNPALQEIVR--NAPKLIDFLGDVSRAHFEGLQRLLKANNVPFTINPRLVRGLDYYNLTVFEWVTDKLGAQGTVAAGGRYDPLIEQLGGKPTAACGWAMGIERILELLKEEHLVPE-QEGVDVYVVHQGDAAREQAFIVAERLRDTLHCSADGAGASFKSQMKRADASGAAFAVIFGEDEVTNGTASVKPLEKSVQQSVPVESLTEFLINAMV 453
6 -107.0003hrk_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  23  19NMVETEPVQGCRDFPPEAMRCRRHLFDVFHATAKTFGFEEYDAPVLESEELYIRKAGEE---ITEQMFNFITKGGHRVALRPEMTPSLARLLLGKGR-SLLLPAKWYSIPQCWRYEAITRGRRREHYQWNMDIVGVKSVSAEVELVCAACWAMRSLGLSDVGIKVNSRKVLQTVVEQAGVTSDKFAPVCVIVDKMEKIPREEVEAQLAVLVVDAITTTLSLKSIDEIAQRVGEEAVKELRQFFEQVEAYGYGVLFDASVVRGLAYYTGIVFEGFDRE-GKFRALCGGGRYDNLLTTYGSPPIPCAGFGFGDCVIVELLQEKRLLPDIPHVVDDVVIPFDESMRPHALAVLRRLRAGRSADIILDKKKVVQAFNYADRVGAVRAVLVAPEEWERGEVQVKMLREGTGKEEGGAERGFAVPL... 446
7 -105.0001wu7_A mol:protein length:434 Histidyl-tRNA synthetase  ali model follow..  25  2YRLQIEKIRGFRDFYPEDMDVEKFIFKTAEEAAEAFGFRRIDFPSLEYLDLYRIKSGEE---LLQQTYSFVDKGGREVTLIPEATPSTVRMVTSRK--DLQRPLRWYSFPKVWRYEEPQAGRYREHYQFNADIFGSDSPEADAEVIALASSILDRLGLQDYEIRINSRKIMSDPFSVFSIIDRYHKISREEFVDQRSAGIGEDGVSMIADLCSGTRGIDEMAR----ITGKSSEEIARMAAVEDLLASYGVKVRYDFSIVRGLSYYTGIVFEAYDRS-GQFRAILGGGRYDNLASLMSGESVPAVGFGMGDAVISLLLKRENVQIP-REKKSVYICRVGKINSSIMNEYSRKLRRGMNVTVEIMERGLSAQLKYASAIGADFAVIFGERDLERGVVTIRNMYTGSQENVGLDSVVEHLISQAT 426
8 -103.0003hri_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  23  19NMVETEPVQGCRDFPPETMRLRKYLFDVFHSTARKFGFEEYDSPVLESEELYIRKAGEE---ITEQMFNFITKGGHRVALRPEMTPSLARQLLAKGR-SLLLPAKWYSIPQCWRYEAITRGRRREHYQWNMDIIGVKSVSSEVELVCAACTAMQSLGLSDVGVKINSRKILQTVVEQAGVSADKFAPVCVIVDKMEKLPREEAAIGLESNVVDAITSTLSLKTIDEIAQRIGEEAVRELRDFITQIEAYGFGVIFDASVVRGLAYYTGIVFEGFDRD-GNFRALCGGGRYDNLLTTYGSPTVPCVGFGFGDCVIVELLNEKKLLPELHHVVDDLVIPFDETMRPHALSILRRLRAGRSADIVFDKKKVVQAFNYADRIGALRAVLVAPDEWARGEVRVKMLREGAGREEGANERGIVLPV... 446
9 -101.0003net_A mol:protein length:465 Histidyl-tRNA synthetase  ali model follow..  22  8DKINFSTPSGFPEFLPSEKRLELYLLDTIRRVYESYGFTPIETPAVERLEVLQAKGNQGDNIIQAEKDKSGDTGSEARALKFDQTVPLAAYIARHL-NDLTFPFARYQMDVVFRGERAKDGRFRQFRQCDIDVVGRESLLYDAQMPAIITEIFEAVNIGDFVIRINNLNISETQIKSCISIIDNLEKIGEAKVKLELEKEGINPEQTQKKIDGSVDDVLD--KLKHLSQTLPELGVSELETVITGVRNLGVPFCIDLAIARGLNYYTGTVYETTLIGHEALGSICSGGRYEELVGTFIGEKMPGVGISIGLTRLISRLLKAGILNTPPTPAQVVVVNMQDELMPTYLKVSQQLRAGLNVITNFEKRQLGKQFQAADKQGIRFCVIIGADEAAAQKSSLKDLQSGEQVEVALADLAEEIKRRLT 465
10 -99.1004g85_A mol:protein length:517 Histidine-tRNA ligase, cytoplasmic  ali model follow..  21  64.KFVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGEDS----KLIYDLKDQGGELLSLRYDLTVPFARYLAMNKL----TNIKRYHIAKVYRRDNPARGRYREFYQCDFDIAGNFDPMPDAECLKIMCEILSSLQIGDFLVKVNDRRILDGMFAICGVSDSKFRTICSSVDKLDKVSWEEVKNEMVGEKGLAPEVADRLQDPKLSQNKQALEGLGDLKLLFEYLTLFGIDISFDLSLARGLDYYTGVIYEAVLLQTPAQGSVAAGGRYDGLVGMFDPRKVPCVGLSIGVERIFSIVEQRLEALEETTETQVLVASAQKKLLEERLKLVSELWAGIKAELLYKNPKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRSVTSREEVDVRREDLVEEIKRRTG 514
11 -97.6004g84_A mol:protein length:464 Histidine--tRNA ligase, cytoplasmic  ali model follow..  21  10RQFVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGEDS----KLIYDLKDQGGELLSLRYDLTVPFARYLAMNKL----TNIKRYHIAKVYRRDNPTRGRYREFYQCDFDIAGNFDPMPDAECLKIMCEILSSLQIGDFLVKVNDRRILDGMFAICGVSDSKFRTICSSVDKLDKVSWEEVKNEMVGEKGLAPEVADRLQDPKLSQNKQALEGLGDLKLLFEYLTLFGIDISFDLSLARGLDYYTGVIYEAVLLQTPAQGSVAAGGRYDGLVGMFDPRKVPCVGLSIGVERIFSIVEQRLEALEEKTETQVLVASAQKKLLEERLKLVSELWAGIKAELLYKNPKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRSVTSREEVDVRREDLVEEIKRRTG 461
12 -86.6003od1_A mol:protein length:400 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  20  6KPFMFEKPFGMRDTLPEWYKTKKNICDQMTEEINLWGYDMIETPTLEYYETV----GVVSAILDQQLFKLLDQQGNTLVLRPDMTAPIARLVASS-LKDRAYPLRLAYQSNVYRAQQNEGGKPAEFEQLGVELIGDGTASADGEVIALMIAALKRAGLSEFKVAIGHVGYVNALLMDVVGNEQRADRLRRFLYEKNYVGYRKSRLMNLLSLRGGRAAIEEA--RGLIQTEKGKTALAEMTKLYEVLESYGASVKFDLTLVLHMSYYTGVVFEGYGNRLGV--PLCSGGRYDELLSKFHRP-AQATGFGVRIDLLVEALNGEII----SNGHEQTCILFSNERRFEAIELARKKRAGEAVVLQDLAGVTDVDAMSSNYQDVIYCIGTAGRGGEDA............................. 400
13 -77.6001z7m_A mol:protein length:344 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  19  12EKINYLLPEESAEMTLNQVKSLRQIEGRLRKLFSLKNYQEVMPPSFEYTQLYTALESNGKTFNQEKMFQFIKHEGQSITLRYDFTLPLVRLYSQIK---DSTSARYSYFGKIFRKEKRHKGRSTENYQIGIELFGESADKSELEILSLALQVIEQLGLNKTVFEIGSAKFFQRLCQLADGSTELLTELLLKLNAFIEKNNFSKELRGLLKEIFITNELSRL--ENLVTNTKDDVLISSFDQLKEFSEKLSMPIIIDLGMVPKMDYYTDLMFKAYSS--AANQPILSGGRYDQLLSNFQE-EAFAIGFCCHMDTILKALERQELEEDND............................................................................................... 338
14 -76.7003rac_A mol:protein length:373 Histidine-tRNA ligase  ali model follow..  22  20.RGFADRPPGMQDGYPDFAKRRRAVETRLLSFVEDAGYEPVTSGLFEYVDTLLRARSPESS---RDWIRLFDGGGDAVALRPEMTPSIARMAAPR-VAAGRTPIRWCYCERVYRRTSWASGKAAESTQVGIERIGEEASVVDMDVLRLLHEASAAAGVRHHRIVVSHARLVPRLLDALGISASLSRAFLACLTSGNYVQFRELWQLHAAKDVDLLANLLTWSPAERDAAKRVRDAWRYLCRLAEALHDSGLAVTFDLALHRELDYYTGLVFEMFAPGVGA--PIAQGGRYDELLAQFGA-GAPAVGFAFEVERVMAVLEAQEEGEGE................................................................................................ 372
15 -73.7006FTT Entity 1(prereleased)  ali follow..  17  3......LPDGVADVLFEDAHKQEVLRHQLTQQLITHGYQLVSPPMIEFTESLLSGASED---LKRQTFKIIDQTGRLMGIRADITPQILRIDAHH---GGDGIARYCYAGDVIHTLPSGLFGSRTPLQLGAEIFGCESIAADIELIDVLFSMINSLDMSALHVDLGHVTIFKRLAELAALSASDTEQLMQLYANKNLPELKGSDFYTLARFGHDIANLLGRLSENAQQDTKIVTAIDELQRLKAHLQVQWCAVSIDVTELSGYHYHTGIVFNGYIN--SETQPLVRGGRFDGMKSNQLNQPRQATGFSMDVSRLLAHTQLDAPFI--VLIDYDAFNNLDSAQRQLLLQQVASLRQGYRVTMPLTAEDMPVGLTHADNQWRLHAV....................................... 388
16 -73.7005m8h_A mol:protein length:388 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  17  3......LPDGVADVLFEDAHKQEVLRHQLTQQLITHGYQLVSPPMIEFTESLLSGASED---LKRQTFKIIDQTGRLMGIRADITPQILRIDAHH---GGDGIARYCYAGDVIHTLPSGLFGSRTPLQLGAEIFGCESIAADIELIDVLFSMINSLDMSALHVDLGHVTIFKRLAELAALSASDTEQLMQLYANKNLPELKGSDFYTLARFGHDIANLLGRLSENAQQDTKIVTAIDELQRLKAHLQVQWCAVSIDVTELSGYHYHTGIVFNGYIN--SETQPLVRGGRFDGMKSNQLNQPRQATGFSMDVSRLLAHTQLDAPFI--VLIDYDAFNNLDSAQRQLLLQQVASLRQGYRVTMPLTAEDMPVGLTHADNQWRLHAV....................................... 388
17 -59.3001usy_A mol:protein length:275 ATP PHOSPHORIBOSYLTRANSFERASE REGULATORY SUBUNIT  ali model follow..  19  2............DFLDFE------KVFSFYSKATKKGFSPFFVPALEKAEEP-------------AGNFFLDRKGNLFSIREDFTKTVLNHRKRY---SPDSQIKVWYADFVYRYSGSD---LVAEYQLGLEKVPRNSLDDSLEVLEIIVESASEFFEGPVIVEIGHTGVYEDHEKVLNLIDTKNLAEIEFLSHMKKIDLSRVEKIIEDSIYRRSPEHLKTMDLPL-------SVREDLLSASSFLQEKTVSVEIDLTLARTIEEYCGLIFTIYDTSSSR--LVAAGGEYTVNGE-------KGVGGSIFLEGK............................................................................................................. 273
18 -48.1004cs2_A mol:protein length:274 PYRROLYSINE--TRNA LIGASE  ali model follow..  15  35SELLSRRKKDLQQIYAEERENLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIF----RVDKNFCLRPMLAPNLANYLRKLD-RALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTRENLESI--ITDFLNHLGI-DFKIVGDSCMVFGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGALERLLKVKHDFKNIKRAARSESYYNGISTN.......................................................................................................................................................................................... 267
19 -47.1002lw7_A mol:protein length:170 Histidine--tRNA ligase, cytoplasmic  ali model follow..  16  3...................................................................................................................................................................................................................................................................................RAALEELVKLQGERVRGLKQQKASAELIELGPDESKQKFVLKTPKALEEKIRTTETQVLVASAQKKLLEERLKLVSELQAGIKAELLYKKNKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRSVTSREEVDVRREDLVEEIKRRTG 164
20 -43.9003qtc_A mol:protein length:290 Pyrrolysyl-tRNA synthetase  ali model follow..  17  49SELLSRRKKDLQQIYAEERENLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIF----RVDKNFCLRPMLTPNLYNYLRKLD-RALPDPIKIFEIGPCYRKESDGKEHLEEFTMLVFWQMGSGCTRENLESI--ITDFLNHLGI-DFKIVGDSCMVFGDTLDVMHGDLELSSALVGPIPLDREWGID-KPWIGAGFGLERLLKVKHDF-----------KNIKRAARSESYYNGISTNL.......................................................................................................................................................................... 282
21 -40.8005k1p_A mol:protein length:274 Pyrrolysine--tRNA ligase  ali model follow..  14  35SELLSRRKKDLQQIYAEERENLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRV----DKNFCLRPMLAPNLYNYLRKL-DRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLAFAQMGSGCTRENLESI--ITDFLNHLGIDF-KIVGDSCMVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDKERLLKVKHDFKNIKRAARS.......................................................................................................................................................................................................... 257
22 -40.4004bw9_A mol:protein length:291 PYRROLYSINE--TRNA LIGASE  ali model follow..  17  52SELLSRRKKDLQQIYAEERNYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDT----ELSKQIFRVDKNFCLRPMLAPNLGNYLRKL-DRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTRENLESI--ITDFLNHLGI-DFKIVGDSCMVFGDTLDVMHGDLELSSAVVGPRPLDREWGIDKPWI.......................................................................................................................................................................................................................... 249
23 -36.5002e3c_A mol:protein length:291 Pyrrolysyl-tRNA synthetase  ali model follow..  19  52SELLSRRKKDLQQIYAEEREYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDT----ELSKQIFRVDKNFCLRPMLAPNLYN-YLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTRENLE--SIITDFLNHLGIDFKIVGDSC................................................................................................................................................................................................................................................................ 212
24 -35.1004q6g_A mol:protein length:267 Pyrrolysine--tRNA ligase  ali model follow..  18  34SELLSRRKKDLQQIYAEERENLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRV----DKNFCLRPMVAPNIFN-YARKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFFQMGSGCTRENLE--SIITDFLNHLGID........................................................................................................................................................................................................................................................................ 186
25 -32.3004tqd_A mol:protein length:291 Pyrrolysine--tRNA ligase  ali model follow..  18  52SELLSRRKKDLQQIYAEEREYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDND----TELSKQIFRVDKNFCLRPMLAPNLYN-YLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLSFIQMGSGCTRENLE--SIITDFLNHLGIDFKIVGDSC-----------------------------------------------------------------------------------------------------MVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFK..................................................................................................... 266
26 -29.1002zni_A mol:protein length:308 Pyrrolysyl-tRNA synthetase  ali model follow..  17  81...............VKHRPALLELEEKLAKALHQQGFVQVVTPTIITKSALAKMTIGED----HPLFSQVFWLDGKKCLRPMLAPNLYTLWRELE-RLWDKPIRIFEIGTCYRKESQGAQHLNEFTMLNLTELGTPLEERHQRLEDMARWVLEAAGIREFELVTESSVVYGDTVDVMK.................................................................................................................................................................................................................................................... 239
27 -28.7002i4l_A mol:protein length:458 Proline-tRNA ligase  ali model follow..  15  48.....QEAAGIYAWLPLGHRVLKKIEQIVREEQNRAGAIELLMPTLQLADLWRES--GRYDAYGPEMLRIADRHKRELLYGPTNEEMITEIFRAYIKSYKSLPLNLYHIQWKFRDERPRFGRGREFLMKDAYSFDVDEAGARKKMFVAYLRTFARMGLKAIPMRAETGPIGGDLSHEFIVLAETGESGVYIDRDVLNLPVPDENVDYDGDLTPIIKQWTSVYAATEDVHEPARYESEVPEANRLNTRGIEVGQIFYFG-----TKYSDSMKANVTGPDGTDAPIHGG-------------------YGVGVSRLLGAIIEACIWPEAVAPFRVTILNLKAATDAACDQLYRELSAGVDVLYDDTDQRAGAKFATADLIGIPWQIHVGPRGLAEGKVELKRRSDGARENLALADVVARLT.... 452
28 -25.8002j3l_A mol:protein length:572 PROLYL-TRNA SYNTHETASE  ali model follow..  15  34.....QVAAGIYSYLPLANRVLEKLKTIMREEFEKIDAVEMLMPALLPAELWKES--GRYETYGPNLYRLKDRNDRDYILGPTHEETFTELIRDEINSYKRLPLNLYQIQTKYRDERSRSGRGREFIMKDGYSFHADEASLDQDYEKAYSRIFERCGLEFRAIIGDG-GAMGGKDSKEFMAISEIGEDTICYSTESDYAANLEMATVRGDHDVNDVKLKNFLGADFLDEATEEDARRVLGAGFGSIGPVNVSEDVVLAFTKGIEI--GHIFKL-------------GTRYSDVLDENGREKSVIMGYGIGVSRLLSAIVEQNNWPTGIAPFDLHVVQMNEYQTKLSQEVEAMMTEGYEVLVDDRNERAGVKFADADLIGCPIRITVG-KKAVDGVVEVKIKRTGEMLEVRKEELESTLSILMN 566
29 -23.9005ucm_A mol:protein length:579 Proline--tRNA ligase  ali model follow..  17  36.....RLASGLYTWLPMGLRVLRKVETIVREEMNAAGALEVLMPAVQPAELWQES--GRWEQYGPELLRLKDRHEREFCVGPTHEEVITDLARNELNSYKQLPINFYQIQTKFRDERPRFGRGREFIMKDAYSFHLSQDSLQQGMYQAYSKIFSRLGLDFRPVQADN-GSIGGSGSHEFHVLANSGEDDIVFSDSSIEKAEAVPRESARGSATEDMRLVDTPNTKTIAALVDGFQLPIEKTIKTLVVHGAEEGTLVALIVRG-DLPLPEVADLRNVVEGDPSPDGKGTKYSEVLSEQGKPVNLIMGYGIGVSRVVAAAIEQNLWPSALAPFQIALVPLKESVKQATDKLYAELTAEVLLDDRDKKTSPGVKFADMELIGIPHRIVISDRGLSEGVLEYKGRRDSESQNLPIGELMSFITEKLS 572
30 -23.2004k86_A mol:protein length:535 Proline--tRNA ligase  ali model follow..  14  53EMIEYHDISGCYILRPWAYAIWEAIKDFFDAEIKKLGVENCYFPMFVSQSALEKE--KTHVADFAPEVAWVTRSGEPIAIRPTSETVMYPAYAKWVQSHRDLPIKLNQWCNVVRWEKHPQPRTREFLWQEGHSAFATMEEAAEEILDLYAQVYEELLAIPVVKGRKTEKEKFAGGDYTTTIEAFISASGRAIQGGTSHHLGQNFSKMFE------------------IVFEDPKIPGEKQFAYQN-------------------------------SWGLTTRTIGV-----MTMVHGDNM--GLVLPPRVACVQVVIIPCGITNALSEEDK-------EALIAKCNDYRRRLLSNIRVRAD-DNYSPGWKFNHWELKGVPIRLEVGPRDMKSCQFVAVRRDTGEKLTVAENEAETKLQAILE 423
31 -22.8004hvc_A mol:protein length:519 Bifunctional glutamate/proline--tRNA ligase  ali model follow..  14  37EMIEYHDISGCYILRPWAYAIWEAIKDFFDAEIKKLGVENCYFPMFVSQSALEKE-KTHVADFAPEVAWVTRSGAEPIAIRPTSETVMYPAYAKWVQSHRDLPIKLNQWCNVVRWEKHPQPRTREFLWQEGHSAFATMEEAAEEILDLYAQVYEELLAIPVVKGRKTEKEKFAGGDYTTTIEAFISASGRAIQGGTSHHLGQNFSKMFE------------------IVFEDPKIPGEKQFAYQN-------------------------------SWGLTTRTIG------MTMVHGDNMGLVLPPRVACVQVVIIPCGITNALSEEDK---------EALIAKCNDYRRRLLSNIRVRAD-DNYSPGWKFNHWELKGVPIRLEVGPRDMKSCQFVAVRRDTGEKLTVAENEAETKLQAILE 407
32 -22.7001nj8_A mol:protein length:459 Proline-tRNA Synthetase  ali model follow..  13  25.....YPIKGCGVYLPYGFKIRRYTFEIIRNLLDESGHDEALFPMLIPEDLLAKEIKGFEDEVYWVTHGGKTQLDVKLALRPTSETPIYYMMKLWVKVHTDLPIKIYQIVNTFRYEKHTRPLIRLMTFKEAHTAHSTKEEAENQAISIYKKFFDTLGIPYLISKRPE-----------------------------------------------------------------WDKFPGAEYTMAFDTIFPDGRTMQIATVHNLGQNFSKTFEIIFETPTGDKDYAYQTCYGISDRVIA--------------SIIAIHGDEKILPPIVAPIQVVIVPLIFKGKEDIVEIYEKLKGKFRVHIDDRDIRPGRKFNDWEIKGVPLRIEVGPKDIENKKITLFRRDTMEKFQVDETQLMEVVEKTLN 380
33 -22.7005xif_A mol:protein length:500 Prolyl-tRNA synthetase (ProRS)  ali model follow..  14  26..IEYYDISGCYIMRPWAFHIWEKVQRFFDDEIKKMGVENSYFPMFVSRHKLEKEKDH--EGFSPEVAWVTHYGDSPIAIRPTSETIMYPAYAKWIRSHRDLPLKLNQWCSVVRWEKQPTPRTREFLWQEGHTAHATEEEAWELILELYRRWYEECLAVPVIKGEKS-------------------------------------------------------------EGEKFAGGKKTTTVEAFIPENGRGIQAATSHLLGTNF--AKMFEIEFEDEEGHKRLVHQTSW-----------------GCTTRSLGVMIMTHGVIPPRVASVQVVIIPILGEILGKCRELKTMLEKDIRVRID-SNYTPGWKYNHWEVKGVPLRLELGPKDLAKGTARVVRRDTGEAYQISWADLAPKLLELME 388
34 -22.7004ncx_A mol:protein length:506 Proline--tRNA ligase  ali model follow..  12  28ELIEYYDISGCYILRPAAYYIWECVQAFFNKEIKKLNVENSYFPLFVTKNKLEKEKNH--EGFSPEVAWVTKYGDSEIAIRPTSETIMYSVFPKWIRSYRDLPLKLNQWNTVVRWEKQPTPRTREFLWQEGHTAHKNEEEAVKLILDLYRRWYEEYLAVPIIKGIKSEGEKFGGANFTSTAEAFISENGRAIQAATSHY---------------------------------------------------------------LGTNFAKMFKIEFEDENEVKQYVHQTSW-----------------GCTTRSIGIMIMTHGVLPPNVSKYKVVIVPIFNAIHSYCKDIEKILKNQINCVYD-ASYSPGYKFNHWELRGIPIRIEVGPKDLQNNSCVIVRRDNNEKCNVKKESVLLETQQMLV 392
35 -22.3005f9y_A mol:protein length:511 Aminoacyl-tRNA synthetase  ali model follow..  12  32EMIEYYDISGCYILRPWSYFIWETIQSVFDQKIKQHDVQNAYFPIFVTQKKLETEKDH--EGFSPEVAWVTKSGKSDIAIRPTSETIMYPYFAKWIRSHRDLPLKINQWTSIVRWEKHPTPRTREFLWQEGHTAHSTRKEAL-EMVDIILNEYASIYEDLLATPV----VKGTKSENEKFPGGDITKSIEGFIPEIGRAVQAATSHLLGQNFSK-------------------------------------------------------MFGVEFEDEKGNKEYAHQTSWGLTTRAIGV--IMTHGDNKGL-----------VLPPKVAPVQVIIIPIIEEQKKICNEVECILKKGVRVKID-SNYTPGWKYNHWEVKGVCLRFEVGPRDIEKRSVRVVVRDNMEKMDIPISELESKIPKLLE 396
36 -22.2005xip_A mol:protein length:498 Prolyl-tRNA synthetase, putative  ali model follow..  12  25ELVEYYDISGCYIIRPWAYRIWEAVQKFFDDGIKRLGVENCYFPMFVSQAKLEKEKDH--EGFKPEVAWVTHYGDSELAIRPTSETIMYPAYAKWIRSHRDLPLKLNQWNNVVRWEKQPTPRTREFLWQEGHTAHATEEEAYTLILELYRQWYEDYLAVPVIKGEKSENE-------------------------------------------------------------KFAGGKKTTTIEGIIPDTGRGIQAATSHLLGQNF--SRMFSIEFEDEKGAKQLVHQTSW-----------------GCTTRSLGVMIMTHGVLPPRVVAVQAVIIPIIMEIVAKCRELERLLNAGVRVKVD-TNYTPGWKFNDWELKGVPLRLEIGPRDVESCQTRVVRRDTSEARNVPWAEAASTIPAMLE 389
37 -21.7004hwo_A mol:protein length:411 Threonine--tRNA ligase  ali model follow..  18  22........PGMVFWHNDGWTIFRELEVFVRSKLKEYQYQEVKGPFMMDRVLWEKT--GHWDNYKDAMFTTSSE-NREYCIKPMNCPGHVQIFNQGLKSYRDLPLRMAEFGSCHRNEPSGS-RVRGFTQDDAHIFCTEEQIRDNGCIRLVYDMYSTFGFEKIVVKLSTRPE-------------------------------------------------KRIGSDEMWDRAE-------ADLAVALEENNIPFEYQL----GEGAFYGPKIEFTLYDCLDRAWQCGTVQLDSYVGEDNERKVPVMAILGSMERFIGILTEEGFFPTWLAPVQVVIMNITDSQSEYVNELTQKLSNGIRVKADLRNEKIGFKIREHTLRRVPYMLVCGDKEVESGKVAVRTRRGKDLGSMDVNEVIEKLQQEIR 394
38 -21.5003ial_A mol:protein length:518 Prolyl-tRNA synthetase  ali model follow..  13  36.....YPVKGCVVFRPYGFFMENAIMRLCEEEYAKVGISQILFPTVIPESFLKKESDH--KGFEAECFWVEQPLEERLALRPTSETAIYSMFSKWVRSYKDLPLKIHQTCTIFRHEKNTKPRVREIHWNEAHCCHATAEDAVSQYWKVIDTIFSDELCFKGQKLRRVCWDRFPGADYSEVSDVVMPCGRVL--------------------------------------------------------QTAGIHNLGQRFSSTFDI-----------------------LYANKANESVHPYLTCAGISTRVLACALSIHGDSVLPPLIAPIHVVIIPIGQQVLGKVNEIADTLKSKLGLRVSIDDDSMGDKLYYYELKGVPLRIEVGQRDLANGQCIVVPRDVGKDQKIPITEVMKVSSHTTE 401
39 -21.4001h4q_A mol:protein length:477 PROLYL-TRNA SYNTHETASE  ali model follow..  15  26ELADYGPVRGTIVVRPYGYAIWENIQQVLDRMFKETGHQNAYFPLFIPMSFLRKEAEH--EGFSPELAVVTHAGEEPLAVRPTSETVIGYMWSKWIRSWRDLPQLLNQWGNVVRWEMRTRPRTSEFLWQEGHTAHATREEAEEEMLSIYARLAREYAAIPVIEGLKTEKEKFAGAVYTTTIEALMKDGKA----------------------------------------------------------------LQAGTSHYLGENFARAFDIKFQDRDLQVKYVHTTSWGLSWRFIG--------------AIIMTHGDDRVLPPRLAPIQVVIVPIYERVLEAAQGLRQALLAGLRVHLD-DQHTPGYKFHEWELKGVPFRVELGPKDLEGGQAVLASRLGGKE-TLPLAALPEALPGKLD 386
40 -21.2004p3n_A mol:protein length:415 Threonine--tRNA ligase, cytoplasmic  ali model follow..  14  27.........GSCFFLPKGAYIYNALIEFIRSEYRKRGFQEVVTPNIFNSRLWMTS--GHWQHYSENMFSF-EVEKELFALKPMNCPGHCLMFDHRPRSWRELPLRLADFGVLHRNELSGA-RVRRFQQDDAHIFCAMEQIEDKGCLDFLRTVYSVFGFSFKLNLSTRPEKFLGDIEVWDQAEKQLENSLNEFGEKWELNSGDGAF------------------GPKIDIQIKDAIGRYHQ-----CATIQLDFQLPIRF--NLTYVSHDGDDKKRPVIVHRAILGS------------------------VERMIAILTENGKWPFWLSPRQVMVVPVGPTCDEYAQKVRQQFHDKFMADIDLDGCTLNKKIRNAQLAQYNFILVVGEKEKISGTVNIRTRDNKVHGERTISETIERLQQLKE 399
41 -21.1001nyq_A mol:protein length:645 threonyl-tRNA synthetase 1  ali model follow..  15  261........AGLPLWLPNGATIRREIERYIVDKEVSMGYDHVYTPVLANVDLYKTS-GHWDHYQEDMFPPMQLDETESMVLRPMNCPHHMMIYANKPHSYRELPIRIAELGTMHRYEASGA-RVRGMTLNDSHIFVRPDQIKEKRVVNMIIDVYKDFGFEDYSFRLS-------------------------------YRDPEDKEKYFDDDDMWNKA----------------------NMLKEAADELGLSYEEAI----GEAAFYGPKLDVQVKTAMGKEETLSTAQLDTYIGQDGEHHRPVVGVVSTMERFVAFLTEEGAFPTWLAPKQVQIIPVNVDLHDYARQLQDELKSGVRVSIDDRNEKMGYKIREAQMQKIPYQIVVGDKEVENNQVNVRQYGSQDQETVEKDEFIWNLVDEIR 640
42 -21.0005xil_A mol:protein length:512 Putative prolyl-tRNA synthetase  ali model follow..  14  27..IEYYDVSGCYIIRPWAYYVWKCVQRFLGGKIEKLGVEDCYFPMFVSRSCLEREKDH--EGFAPEVAWVTRAGDTEVAVRPTSETVMYPYYAKWIRSHRDLPVRLNMWNNVIRWESHPTPRTREFLWQEGHCAWAKAEECAKEILECYASVYEQLLAVPVVRGRKTEKEKFAGGDYTTTVETFIEAVGRGCQGATSHNLGQNFGKMFD------------------IRFQDPENNE--QTLIPWQNSWGL-----------STRVIGVMIMVHGDNRGM------------------------------------------VMPPRVASTQVIIIPVGQELLASCWRLESELCEGVRARCD-DNYSPGWRFNHWEVKGVPLRVELGPRELAERSLAVAVRHSGARHSVAWDAQTPAAVAAL. 394
43 -20.7004hwt_A mol:protein length:413 Threonine--tRNA ligase, cytoplasmic  ali model follow..  17  23.........GSCFFLPKGAYIYNALIEFIRSEYRKRGFQEVVTPNIFNSRLWMTS--GHWQHYSENMFSF-EVEKELFALKPMNCPGHCLMFDHRPRSWRELPLRLADFGVLHRNELSGA-RVRRFQQDDAHIFCAMEQIEDKGCLDFLRTVYSVFGFSF------------------------------------KLNLSTRPEKFLGDIEVWDQA----------------------KQLENSLNEFGEKWELNS----GDGAFYGPKIDIQIKDAIGRYHQCATIQLDQLPIRFNLTYVSHDG---SVERMIAILTENGKWPFWLSPRQVMVVPVGPTCDEYAQKVRQQFHDKFMADIDLDGCTLNKKIRNAQLAQYNFILVVGEKEKISGTVNIRTRDNKVHGERTISETIERLQQLKE 395
44 -20.7001nj1_A mol:protein length:501 Proline-tRNA Synthetase  ali model follow..  16  52.....YPVKGMHVWMPHGFMIRKNTLKILRRILDR-DHEEVLFPLLVPEDELAKEAIH--KGFEDEVYWVTSKLQRKLALRPTSETVMYPMFALWVRSHTDLPMRFYQVVNTFRYETKHT-VREITTFKEAHTIHATASEAEEQAVEIYKEFFNSLGIPYLITR-----------------------------------------------------------RPPWDKFPGSEYTVAFDTLMPDGKTLQIGTVHN------LGQTFARTFEIKFETPEGDHEYVHQTCY-GLSDRVIASVIAIHGDESGL-----------CLPPDVAAHQVVIVPIAEEVMEACRELRSRLEAGFRVHLDDRDIRAGRKYYEWEMRGVPLRVEIGPRDLEKGAAVISRRDTGEKVTADLQGIEETLRELMK 407
45 -20.4001b76_A mol:protein length:442 Glycine--tRNA ligase  ali model follow..  15  29........QGVYDYGPLGVELKNNLKQAWWRVYERDDMEGLDASVLTHRLVLHYS-PRYFNMMFQDLRGPRGGRGLLAYLRPETAQGIFVNFKN-DATSRKLGFGIAQIGKAFRNEITPRNRVREFEQMEIEYFVRPGEDEYRYWVEERLKWWQEMGLSRENLVPY---------------------------QQPPESSAHYAKATVDILYRFPHGSLELEGIAQRTDF----------DLGSHTKDQEALGITARVLRNEHSTQRLAYRDPETGKWFVPYVIEPSAGVDRGVLALLAEAFTREELPNGEERIVLKLKPQ-------APIKVAVIPLRPEITEYAKRLKARLLAGLGRVLYEDTGNIGKAYRRHDEVGTPFAVTVDYDTIGQSTVTVRDRDTMEQIRLHVDELEGFLRERLR 441
46 -19.5003a31_A mol:protein length:471 Probable threonyl-tRNA synthetase 1  ali model follow..  13  39........AGVPLFSLGGGPIRYALAEVLAKFHARRGYYVVETPIIASTELFKVS--GHIEFYRNNMYLFDIE-GHEFAVKPMNCPYLFLNEVAKHRSKLPLPFKVFEFGRVHRYEPSGS-RVRGFTQDDAHIIVPGGRVIDFEEMKLVLERLFKLGVSSETFKVR----------------------LSMSDKSLIGKEFMGSKEEWEGAEEALREAASRINEKYGIDIVELEGEAAF-IMMVEESGVSKEWQMGT-----FDFNLPRRFRLYDVVREE-----------------FGIEEVYIALLGSIERFLGVYLEHGRMPFTLAPIQFAVIAVKTGGEDLASSIAKGLLDGFRVAVKGSKTGLSSDVRHIESTAKPAVVFIGAKEVREKVLDVRVFDLESMKRRRLAIAYGDAADAVE 440
47 -19.2001qf6_A mol:protein length:642 THREONYL-TRNA SYNTHETASE  ali model follow..  18  262.........GMVFWHNDGWTIFRELEVFVRSKLKEYQYQEVKGPFMMDRVLWEKT--GHWDNYKDAMFTT-SSENREYCIKPMNCPGHVQIFNQGLKSYRDLPLRMAEFGSCHRNEPSGS-RVRGFTQDDAHIFCTEEQIRDNGCIRLVYDMYSTFGFEKIVVKLSTRPE-------------------------------------------------KRIGSDEMWDRAE-------ADLAVALEENNIPFEYQL----GEGAFYGPKIEFTLYDCLDRAWQCGTVQLDSYVGEDNERKVPVMAILGSMERFIGILTEEGFFPTWLAPVQVVIMNITDSQSEYVNELTQKLSNGIRVKADLRNEKIGFKIREHTLRRVPYMLVCGDKEVESGKVAVRTRRGKDLGSMDVNEVIEKLQQEIR 633
48 -18.7003ugq_A mol:protein length:460 Threonyl-tRNA synthetase, mitochondrial  ali model follow..  11  45.....PLSPGSMFFLPNGAKIFNKLIEFMKLQQKKFGFNEVVTPLIYKKTLWEKS--GHWENYADDMFKVEDEEKEEYGLKPMNCPGHCLIFGKKDRSYNELPLRFSDFSPLHRNEASGA-RLRKFHQDDGHIFCTPSQVKSFNSLKLIDIVYNKIFPFVKGGSGAESNY--------------------------FINFSTRPDHFIGDLKVWNHA----------------------QVLKEILEESGKPWKLNP----GDGAFYGPKLDIMVTDHLRKTHQVATIQLDKFKDQDNSYKRPIMATFGSIERFMALLIDSGRWPFWLNPYQAVIIPVNTKNVQQLDMCTALQKWHFNVDLDIRNEPVGYRIKSAILKNYSYLIIVGDEEVQLQKYNIRERDNRKSFKLTMSQIWEKFIELEK 451
49 -18.2001ati_A mol:protein length:505 GLYCYL-TRNA SYNTHETASE  ali model follow..  16  123...............ENLHALVQAMMQAPERAGGAMTAAGVLDPASGEPGDWTPP--RYFNMMFQDLRGPRGGRGLLAYLRPETAQGIFVNFKN-DATSRKLGFGIAQIGKAFRNETPRNFRVREFEQMEIEYFVRPGEDEYRYWVEERLKWWQEMGLSRENLVPY---------------------------QQPPESSAHYAKATVDILYRFPHGSLELEGIAQRTDF----------DLGSHTKDQEALGITARVLRNEHSTQRLAYRDPETGKWFVPYVIEPSAGVDRGVLALLAEAFTREELPNGEERIVLKLK---PQLAPIKVAVIPLVKNRPEITEYAKRLKARLLAGLGRVLYEDTGNIGKAYRRHDEVGTPFAVTVDYDTIGQSTVTVRDRDTMEQIRLHVDELEGFLRERLR 504
50 -14.2001v95_A mol:protein length:130 Nuclear receptor coactivator 5  ali model follow..  11  4.....................................................................................................................................................................................................................................................................................................................................GSSGPVDCSVIVVNKQTKDYAESVGRKVRDGMVVDLIFTEVSLSQALEDVSRGGSPFAIVITQQHQIHRSCTVNIMFGTPQENMPQADAMVLVARNYE 106
51 -14.2001nnh_A mol:protein length:294 asparaginyl-tRNA synthetase-related peptide  ali model follow..  13  1....MNAVEIISREISPTLDIQTKILEYMTDFFVKEGFKWLLPVIISPITDPLWPDPAGEGMEPAEVEIYGVKMRLTHSMILHKQLAIAMGL------------KIFVLSPNIRLESRQKDDGREFTQLDFEVERAK------DIMRLIERLVYGLKAEEWTGREFPKTKRFEVFEYSEVLEEFGSDEKASQEMEEPFWIINIPREFYDREVDGFWRNYDLILPYGYGEVASGGEREWYEKIVAKIRKAGLN-------EDSFRPYLEIA------------------KA--------GKLKPSAGAGIGVERLVRFI......................................................................................................... 272
52 -14.1003p8t_A mol:protein length:294 AsnS-like asparaginyl-tRNA synthetase related protein  ali model follow..  15  1....MNAVEIISRDIYKAIDIQTKILDYMTKFFTDRGFKWLLPIMLSPITDPLWPDPAGEGIRPAEVDVYGVRMRLTHSMILHKQLAIAMGL------------KIFVLSPNIRLESRRKDDGREFTQLDFEIEGAK------DVMRLIEELIYGLKAEEWTGREFPRARHFKVYDYKDILEEFGSDEKASMEMEEPFWIVNIPREFYDREENGVWKNYDLILPYGYGEVSSGGEREWYEKIVAKIRAAGLK-------EDSFRPYLEIA------------------RA--------GKLKPSAGAGIGVERLVRFI......................................................................................................... 272
53 -13.5003g1z_A mol:protein length:326 Putative lysyl-tRNA synthetase  ali model follow..  15  15................PNLLKRAAIMAEIRRFFADRGVLEVETPCMSQA-----VTDIHLFPFETRFVGPGHSQGINLYLMTSPEYHMKRLLAAG---------PVFQLCRSFRNEEMGRHHNPEFTMLEWYRPHYDMYRLMNEVDDLLQQVLDCQPAESLSYQ-------------QAFQRHLEIDPLSADKTQLREAAAKLDLSNIADTEEDRDTLLQLLFTMGVEPHIGKEKPTFIYHFPASQASLAQISTEDHRVAERFEVYYKGI-ELANGFHELTDAREQQQRFQNLLDALAAGLPDCSGVALGVDRLVMLALGAE..................................................................................................... 313
54 -13.4002pme_A mol:protein length:693 Glycyl-tRNA synthetase  ali model follow..  15  90.......VSGLYDFGPVGCALKNNIIQTWRQHFQEEQILEIDCTMLTPEPVLKTSVDKFADFMESVLAQLDNYGQQELALRPETAQGIFLNFKR-EFNQGKLPFAAAQIGNSFRNESPRSGRVREFTMAEIEHFVDPSEKDHPKFIGRIYLYLTKVGISPDKLRFRQHMENEMAHYACDCWDAESKTSYGWIEIVGCADRSCYDLSCHARATKVPLVAEKPLKEPKTVNVVQFEPSKGAIGKAYKKDAKLVMEYLAIC----DECYITEMEMLLNEKGEFTIETEG-LTKDFQKTLYVEEVVPNV--SFGLGRIMYTVFEHTFHVREGDEQRTFFLSQNQEFMPFVKELSEALTRGVSHKVDDSSGSIGRRYARTDEIGVAFGVTIDFDTVNKTTATLRDRDSMRQIRAEISELPSIVQDLAN 657
55 -12.7003a5y_A mol:protein length:345 Putative lysyl-tRNA synthetase  ali model follow..  15  28................PNLLKRAAIMAEIRRFFADRGVLEVETPCMSQA-----VTDIHLVPFETRFVGPGHSQGMNLWLMTSPEYHMKRLLVAG---------PVFQLCRSFRNEEMGRYHNPEFTMLEWYRPHYDMYRLMNEVDDLLQQVLDCPAAESLS--------------YQQAFLRYLEDPLSADKTQLREVAAKLDLSNVADTEEDRDTLLQLLFTFGVEPNIGKEKPTFVYHFPASQASLAQISTEDHRVAERFEVYYKGI-ELANGFHELTDAREQQQRFQNLIEALKVGMPDCSGVALGVDRLVMLALGAE..................................................................................................... 326
56 -11.5001n9w_A mol:protein length:422 aspartyl-tRNA synthetase 2  ali model follow..  15  108.LLEYRYVTLRGEKARAPLKVQAALVRGFRRYLDRQDFTEIFTPKVVRAGAEGGSGLFGVDYFEKRAY---------LAQSPQLYKQIMVGVFE----------RVYEVAPVWRMEEHHTSRHNEYLSLDVEMGFIADEE---DLMRLEEALLAEM-------------LEEALNTAGDEIRLLGATWPSFPQDIPRLTHAEAKRILKEELGYPVGQDLSEEAERLLGEYAKERWGSDWLFVTRY------PRSVRPFYTYPEEDGTTRSFDLLFRG----LEITSGGQFHGYLEVFKYGMPPHGGFAIGAERLTQKL......................................................................................................... 401
57 -11.4005xix_A mol:protein length:472 Asparagine--tRNA ligase, cytoplasmic  ali model follow..  14  147.QLNNRHMMIRGENMSKILKARSMVTRCFRDHFFDRGYYEVTPPTLVQTQVEGGATLFKLDYFGEEAF---------LTQSSQLYLETCLPALG----------DVFCIAQSYRAEQSRTRRHAEYTHVEAECPFLT------DLLNRLEDLVCDV-LKSPAGSIVHELNPNFQPPKRPFKRMNYSDAIVWLKEHDVKKEDGTFYE--DIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCP-----------DSRLTESVDVLMPNVGE-----------IVGGSMYYWYTDQRKYGTCPHGGYGLGLERFLTWI......................................................................................................... 445
58 -11.4003m4p_A mol:protein length:456 Asparaginyl-tRNA synthetase, putative  ali model follow..  13  139.KMQNRHIVIRSEHTQQVLQLRSEIQWYFRKYYHDNHFTEIQPPTIVKTQCEGGSTLFKLQYFNEPAY---------LTQSSQLYLESVIASLG----------KSFCMLSSYRAEQSRTVRHAEYLHLEAELPFIS------DLLNHLEDLVCTV-MAVHGDKIRKMNPHLKLPTRPFKRMTY-ADAIKYCNDHGILNKDKPFEYGEDISEKPERQMTDEIGCPIFMIHFPSKMKAFYMSKVP-----------HPDLTESVDLLMPGVGE-----------IVGGSMYYWYTQQRKYGSCPHGGYGLGVERLVMWL......................................................................................................... 435
59 -11.2001asy_A mol:protein length:490 ASPARTYL-tRNA SYNTHETASE  ali model follow..  15  181..................FRIQAGVCELFREYLATKKFTEVHTPKLLGAPSEGGSSVFEVTYFKGKAY---------LAQSPQF---NKQQLIVADFE------RVYEIGPVFRAENSNTHRHTEFTGLDMEMAFEEHYHEVLDTLSELFVFIFSELPKRFAHEIELVRKQYPVEEFKLPKDG-YKEGIEMLRAAGKEIGDFEDLSTENEKFLGKLVRDKYDTDFYILDKFPLEIRPFYTMPDPANPKYSNSYDF---FMRGEEILSGAQHALLQERMKAHGLSPEDPGLKDYCDGFSYGCPPHAGGGIGLERVVMFY......................................................................................................... 469
60 -11.1002xti_A mol:protein length:437 ASPARAGINYL-TRNA SYNTHETASE, CYTOPLASMIC, PUTATIVE  ali model follow..  14  117.MLDNRHLVIRGENAAALLRLRAAATRAMREHFYNAGYVEVAPPTLVQTQVEGGSTLFNLDYFGEQSF---------LTQSSQLYLETCIPTLG----------DVFCIAQSYRAEKSRTRRHAEYAHVEAECPFIT------DLMEKIEELVCDTADEEAKKLLEHINPKFQPPERPFLRMEYKDAIKWLQEHNVENEFGNTFTYGEDIAEAAERFMTDTINKPILLNRFPSEIKAFYMQRDA-----------DNTLTESVDLLMPGVGE-----------IVGGSMYYWYLDQRLYGTCPHGGYGLGLERFICWL......................................................................................................... 416
61 -10.9004j15_A mol:protein length:521 Aspartate--tRNA ligase, cytoplasmic  ali model follow..  14  210..................FRLQSGICHLFRETLINKGFVEIQTPKIISAASEGGANVFTVSYFKNNAY---------LAQSPQL---YKQMCICADFE------KVFSIGPVFRAEDSNTHRH-EFVGLDIEMAFNYH-----EVMEEIADTMVQI-QERFQTEIQTVNKQFPCEPFKFLEPTLRLEYCEALAMLREAGVEMGDEDDLSTPNEK-----------LLGHLVKEKYDTDFYILDKYPLAVRPFYTMNPKQSNSYDMFMR-------------EEILSGAQIKAYIDSFRFGAPPHAGGGIGLERVTMLF......................................................................................................... 494
62 -10.9003i7f_A mol:protein length:548 Aspartyl-tRNA synthetase  ali model follow..  12  227.RLDNRMLDLRTVTNIAIFRIQSACCGLFREFLTSQKFVEIHTPKLIGCSSEGGSNIFEVKYFDRKAY---------LAQSPQL---YKQMAIMGDFR------KVFEVGPVFRAENSNTRRHTEFEGLDIEMEIVEN-----ECIDVMEKLFTFI-----------FDEIPKRFPDELKVIRKQYPFEDLIYRPFLRLTYKEAIEMLRASGETIGD-FTTPQEVKLGELIKAKYNTDFYILDKFPAAIRPFYTMDPNYSNSYDVFVR-------------QEITSGAQLKDYIESFRFGSWPHAGCGIGLERITMLY......................................................................................................... 527
63 -10.8004ztu_B mol:protein length:472 DNA polymerase subunit gamma-2, mitochondrial  ali model follow..  10  71.........CHPGFGPLGVELRKNLAAE-EQVFPVDALHHKPGPLLPSAETLREILQDKELSKEQLVAFLENVLKTSGKLRENLLHGALEHYVNLDLVNKRLPYGLAQIGVCFHPVFDTKQSIGEKTEASLVWFTPPRTSNQDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGR---------------KGNKLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNV--------------VPCVLSVNG--DLD---RGMLAYLYDSFQLTENSFTRKK--------------------NLHRKVLKLHPC-------APIKVALDVGTLELRQVCQGLFNELLENWPGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYIS 456
64 -10.7002g4c_A mol:protein length:474 DNA polymerase gamma subunit 2  ali model follow..  10  77........GCHPGFGPLGVELRKNLAAEWWTVVFREQVFPVDALHHKPGPLLPGDLQDKELSKEQLVTFLENVLKTSGKLRENLLHGALEHYVN-DLVNKRLPYGLAQIGVCFHPVFDTKQSIGEKTEASLVWFTPPRTSNQDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNK-----------------------------LYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNG--DLDRGMLAYLYDSFQLTENSFTRKKNLHRKVL-------------------KLHPCLAPIKVALDVGRGPT-------LELRQVCQGLFNELLENWPGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYIS 463
65 -10.7001b8a_A mol:protein length:438 PROTEIN (ASPARTYL-TRNA SYNTHETASE)  ali model follow..  15  120.RLNNRFMDLRRPEVMAIFKIRSSVFKAVRDFFHENGFIEIHTPKIIATATEGGTELFPMKYFEEDAF---------LAESPQL---YKEIMMASGLD------RVYEIAPIFRAEEHNTTRHNEAWSIDSEMAFIEDEE---EVMSFLERLVAHAELDILNFELEEPKLPFPRVSYDKAL-EILGDLGKEIPWGEDIDTEGERLLGKYMMENENAPLYFLYQYPSEAKPFYIMKYDNKPEICRAFD-----------EYRGVEISSGGQREHRHDILVEQIKEKG-ESFEFYLKAFRYGMPPHGGFGLGAERLIKQM......................................................................................................... 417
66 -10.6005c51_B mol:protein length:485 DNA polymerase subunit gamma-2, mitochondrial  ali model follow..  94........GCHPGFGPLGVELRKNLAAEWWTVVFREQVFPVDALHHKPGPLLPGDLQDKELSKEQLVAFLENVLKTSGKLRENLLHGALEHYVN-DLVNKRLPYGLAQIGVCFHPVFDTK-SIGEKTEASLVWFTPPRTSNQDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGR---------------KGNKLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHGRDGRK-------------------NVVPCVLSVNGDLDRGMLAYLYDSFQLTENSFTRKK--------------------NLHRKVLKLHPC-------APIKVALDVGTLELRQVCQGLFNELLENWPGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYIS 480
67 -10.4001x54_A mol:protein length:434 Asparaginyl-tRNA synthetase  ali model follow..  16  135..................MKVKETLIMAAREWLLKDGWHEVFPPILVTGAVEGGATLFKLKYFDKYAY---------LSQSAQLYLEAAIFGLE----------KVWSLTPSFRAEKSRTRRHTEFWHLELEAAWMD------DIMKVEEELVSYMVQRTLELRKKEIEMFRDDLTTLKNTEPPFPRISYDEAIDILQSKGVNVEWGDDLGADEERVLTEEFDRPFFVYGYPKHIKAFYMKEDP--NDPRKVLASDMLAPEGYGEIIGGSQREDDYDKLLNRILEEGKDYEWYLDLRRYGSVPHSGFGLGVERLVAWV......................................................................................................... 413
68 -10.3003ikl_A mol:protein length:459 DNA polymerase subunit gamma-2, mitochondrial  ali model follow..  12  108......................................KNLAAEWWTSVVVFREQVFPVDALHHKPGPLLPGDSAFRGGLRENLLHGALEHYVN-DLVNKRLPYGLAQIGVCFHPVFDTK-SIGEKTEASLVWFTPPRTSNQDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNK-----------------------------LYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNG--DLD---RGMLAYLYDSFQLTENSFTRKK--------------------NLHRKVLKLHPC-------APIKVALDVGTLELRQVCQGLFNELLENWPGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYIS 448
69 -10.3001wyd_A mol:protein length:429 hypothetical aspartyl-tRNA synthetase  ali model follow..  13  134..................IKIQSLALKAFRETLYKEGFIEIFTPKIIASATEGGAQLFPVIYFGKEAF---------LAQSPQLYKELMAGVVE----------RVFEVAPAWRAEESDTPFHAEFISMDVEMAFAD------DVMQLLEKILHNIEEGKEELKILNYEPPEVKIPIKRLKYTEAIEILRSKGYNIKFGDDIGTPELRILNEELKEDLYFIVDWPSDARPFYTKSKSENPELSESFD-----------IYKFLEIVSGSTRNHKREVLEEALKKKGLKSFEFFLKWFDYGMPPHAGFGMGLARLMVML......................................................................................................... 408
70 -10.3003l4g_A mol:protein length:508 Phenylalanyl-tRNA synthetase alpha chain  ali model follow..  16  230........................VRSQFRQIFLEMGFTEMPTPARDQHDTFFLRDPAEALQLPMDYYNWKLDEARKNLLRTHTTSASARALYRLAQKKPFTPVKYFSIDRVFRNETLDATHLAEFHQ--IEGVVADHGLTLGHLMGVLREFFTKLGITQLRFK-------------------------------------------------------------------------------------------------AYNPYTEPSMEVFSYGLKKWVEVGNSGVFREMLLPMGPENVSVIAWGLSLERPTMIK......................................................................................................... 468
71 -10.3001g5h_A mol:protein length:454 MITOCHONDRIAL DNA POLYMERASE ACCESSORY SUBUNIT  ali model follow..  10  56............RFGPLGVELRKNLASQWWSSMVVFREQVFAVDSLHQEPGSSQPRDSAFRLVSPESIRLENLLKTSGKLRATLLHGALEHYVNLDLVNRKLPFGLAQIGVCFHPVSNSNQRVGEKTEASLVWFTPTRTSSQDFWLRHRLLWWRKFAMSPSNFSSADCQDELGRKGSK-----------------------------LYYSFPWGKEPIETLWNLGDQELLHTYPGNVSTIQGRDGRKNVVPCVLSVSG--DVDLGTLAYLYDSFQLAENSFARKKSLQRKVL-------------------KLHPCLAPIKVALDVGKGPT-------VELRQVCQGLLNELLENWPGYSETVHSSLEQLHSKYDEMSVLFSVLVTETTLENGLIQLRSRDTTMKEMMHISKLRDFLVKYLA 438
72 -10.2001b70_A mol:protein length:350 PHENYLALANYL-TRNA SYNTHETASE  ali model follow..  20  104......................TLMERELVEIFRALGYQAVEGPEVESEFFNFDALNIPEHHPARDMGPLGEEVEGRLLLRTHTSPMQVRY-----MVAHTPPFRIVVPGRVFRFEQTDATHEAVFHQ--LEGLVVGEGIAMAHLKGAIYELAQALFGPDSKVRFQ................................................................................................................................................................................................................................................................. 254
73 -10.1002cim_A mol:protein length:522 SERYL-TRNA SYNTHETASE  ali model follow..  12  207GWLKRGSSRGQWIHGPQSARIFRTFEKIVLELLEPLGYREMIFPKLVTWEVWMKSQTRDPDYWEEVADYYKVTHEPIGGMCYAQCPPFWMYVAGETLPNEEIPVKVFDRGTSHRYESGGI-RVDEFHRIEIVWIGTKEEVLKCELHDRYMHIFNDILDIEWRKARVT---------------PWFMAQEGLLGLAEENTVGTTDYEACLPYRGPDGEWLEFQNVSINGDKYPKG------------------------------------FNVKLQSGDELWSGCSG---------------------VGLERWAAVF......................................................................................................... 487
74 -10.0004rmf_A mol:protein length:609 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  14  120.RLKYRYLDLRREGPGNALRLRSKVNAAARSVLAEHDFVEIETPTLTRS---------TPEGARDFLVPARLQPGSFYAL-PQSPQLFKQLLMVAGME------RYYQIARCYRDEDFRADRQPEFTQLDMEM----SFVEADDVIAISEQVLKAV-GYDLPLPLPRISYEEAMRRFGSDKPDFFAAGPAKGARALLGATRIEIAKRLDLIDPNAWAFTWVVDFPMFEAADEATAAGDVAVGSGAWTAMHHAFTAPDTFDSDPGNALSDAYDIVCNGN----EIGGGSKFGFLLDAFSYGAPPHGGIAFGWDRITALLAGV------DSIREVIAFPKSGGGVDPLTDAPAPITPQQRKESGIDAKPREDKPKEDAKSK............................................ 597
75 -9.9803qne_A mol:protein length:485 Seryl-tRNA synthetase, cytoplasmic  ali model follow..  16  180.............LRNYGVFLNQALINYGLSFLSSKGYVPLQAPVMMNKEVMA-KTAQLSQFDEELYKVIDGEDEKYLIATSEQPISAYHAGEWFESPAEQLPVRYAGYSSCFRREAGSHGRVHAFEKIEQFVLTEPEKSWEERMIGCSEEFYQSLGLPYRVVGIVS................................................................................................................................................................................................................................................................ 341

FFAS is supported by the NIH grant R01-GM087218-01
1 2 6 5 0 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Godzik A. Fragnostic: walking through protein structure space. Nucleic Acids Res. 2005 Jul 1;33(Web Server issue):W249-51.