current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 4rmf_A mol:protein length:609 Aspartate--tRNA(Asp/Asn) ligase, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .  540    .  550    .  560    .  570    .  580    .  590    .  600
# Score Template Links and tools%idFirst MLRTHAAGSLRPADAGQTVTLAGWVARRRDHGGVIFIDLRDASGVSQVVFREGDVLAAAHRLRAEFCVAVTGVVEVRPEGNENPEIPTGQIEVNATELTVLGESAPLPFQLDEQAGEEARLKYRYLDLRREGPGNALRLRSKVNAAARSVLAEHDFVEIETPTLTRSTPEGARDFLVPARLQPGSFYALPQSPQLFKQLLMVAGMERYYQIARCYRDEDFRADRQPEFTQLDMEMSFVEADDVIAISEQVLKAVWATIGYDLPLPLPRISYEEAMRRFGSDKPDLRFGIELVECTEYFKDTTFRVFQAPYVGAVVMPGGASQPRRTLDGWQEFAKQRGHKGLAYVLVGEDGTLGGPVAKNLSDAERDGLVAHVGANPGDCIFFAAGPAKGARALLGATRIEIAKRLDLIDPNAWAFTWVVDFPMFEAADEATAAGDVAVGSGAWTAMHHAFTAPKPDSVDTFDSDPGNALSDAYDIVCNGNEIGGGSIRIHRRDIQERVFAMMGIDHDEAQEKFGFLLDAFSYGAPPHGGIAFGWDRITALLAGVDSIREVIAFPKSGGGVDPLTDAPAPITPQQRKESGIDAKPREDKPKEDAKSKAAAALELast
1 -202.0004rmf_A mol:protein length:609 Aspartate--tRNA(Asp/Asn) ligase  ali model  100  1MLRTHAAGSLRPADAGQTVTLAGWVARRRDHGGVIFIDLRDASGVSQVVFREGDVLAAAHRLRAEFCVAVTGVVEVRPEGNENPEIPTGQIEVNATELTVLGESAPLPFQLDEQAGEEARLKYRYLDLRREGPGNALRLRSKVNAAARSVLAEHDFVEIETPTLTRSTPEGARDFLVPARLQPGSFYALPQSPQLFKQLLMVAGMERYYQIARCYRDEDFRADRQPEFTQLDMEMSFVEADDVIAISEQVLKAVWATIGYDLPLPLPRISYEEAMRRFGSDKPDLRFGIELVECTEYFKDTTFRVFQAPYVGAVVMPGGASQPRRTLDGWQEFAKQRGHKGLAYVLVGEDGTLGGPVAKNLSDAERDGLVAHVGANPGDCIFFAAGPAKGARALLGATRIEIAKRLDLIDPNAWAFTWVVDFPMFEAADEATAAGDVAVGSGAWTAMHHAFTAPKPDSVDTFDSDPGNALSDAYDIVCNGNEIGGGSIRIHRRDIQERVFAMMGIDHDEAQEKFGFLLDAFSYGAPPHGGIAFGWDRITALLAGVDSIREVIAFPKSGGGVDPLTDAPAPITPQQRKESGIDAKPREDKPKEDAKSKAAAALE 603
2 -198.0004o2d_A mol:protein length:620 Aspartate--tRNA ligase  ali model follow..  99  17VLRTHAAGSLRPADAGQTVTLAGWVARRRDHGGVIFIDLRDASGVSQVVFREGDVLAAAHRLRAEFCVAVTGVVEVRPEGNENPEIPTGQIEVNATELTVLGESAPLPFQLDEQAGEEARLKYRYLDLRREGPGNALRLRSKVNAAARSVLAEHDFVEIETPTLTRSTPEGARDFLVPARLQPGSFYALPQSPQLFKQLLMVAGMERYYQIARCYRDEDFRADRQPEFTQLDMEMSFVEADDVIAISEQVLKAVWATIGYDLPLPLPRISYEEAMRRFGSDKPDLRFGIELVECTEYFKDTTFRVFQAPYVGAVVMPGGASQPRRTLDGWQEFAKQRGHKGLAYVLVGEDGTLGGPVAKNLSDAERDGLVAHVGANPGDCIFFAAGPAKGARALLGATRIEIAKRLDLIDPNAWAFTWVVDFPMFEAADEATAAGDVAVGSGAWTAMHHAFTAPKPDSVDTFDSDPGNALSDAYDIVCNGNEIGGGSIRIHRRDIQERVFAMMGIDHDEAQEKFGFLLDAFSYGAPPHGGIAFGWDRITALLAGVDSIREVIAFPKSGGGVDPLTDAPAPITPQQRKESGIDAKPREDKPKEDAKSKA..... 614
3 -194.0005w25_A mol:protein length:616 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  81  17VLRSHAAGLLREGDAGQQVTLAGWVARRRDHGGVIFIDLRDASGIAQVVFRDPEVLAQAHRLRAEFCVSVAGVVEIRPEGNANPEIATGEIEVNATSLTVLGECAPLPFQLDEPAGEELRLKYRYLDLRRDDPAAAIRLRSRVNAAARAVLARHDFVEIETPTITRSTPEGARDFLVPARLHPGSFYALPQSPQLFKQLLMVAGMERYYQIARCYRDEDFRADRQPEFTQLDMEMSFVDAEDIIAISEEVLTELWALIGYRIPTPIPRIGYAEAMRRFGTDKPDLRFGLELVECTDFFSDTTFRVFQAPYVGAVVMPGGASQPRRTLDGWQDWAKQRGHRGLAYVLVAEDGTLGGPVAKNLTEAERTGLADHVGAKPGDCIFFSAGPVKSSRALLGAARVEIANRLGLIDPDAWAFVWVVDPPLFEPADEATAAGEVAVGSGAWTAVHHAFTAPKPEWEDRIESDTGSVLADAYDIVCNGHEIGGGSVRIHRRDIQERVFAVMGLDKAEAEEKFGFLLEAFMFGAPPHGGIAFGWDRTTALLAGMDSIREVIAFPKTGGGVDPLTDAPAPITAQQRKESGIDAQPKRVQQA............ 610
4 -177.0001eqr_A mol:protein length:590 ASPARTYL-TRNA SYNTHETASE  ali model follow..  47  1.MRTEYCGQLRLSHVGQQVTLCGWVNRRRDLGSLIFIDMRDREGIVQVFFDPDDALKLASELRNEFCIQVTGTVRARDEKNINRDMATGEIEVLASSLTIINRADVLPLDSNHVNTEEARLKYRYLDLRRPEMAQRLKTRAKITSLVRRFMDDHGFLDIETPMLTKATPEGARDYLVPSRVHKGKFYALPQSPQLFKQLLMMSGFDRYYQIVKCFRDEDLRADRQPEFTQIDVETSFMTAPQVREVMEALVRHLWLEVKGVDLGDFPVMTFAEAERRYGSDKPDLRNPMELTDVADLLKSVEFAVFAGPAVAALRVPGGASLTRKQIDEYGNFVKIYGAKGLAYIKVNELEGINSPVAKFLNAEIIEDILDRTAAQDGDMIFFGADNKKIVADAMGALRLKVGKDLGLTDESKWAPLWVIDFPMFED-----------DGEGGLTAMHHPFTSPKDMTAAELKAAPENAVANAYDMVINGYEVGGGSVRIHNGDMQQTVFGILGINEEEQREKFGFLLDALKYGTPPHAGLAFGLDRLTMLLTGTDNIRDVIAFPKTTAAACLMTEAPSFANPTALAELSIQVVKKAENN............. 590
5 -176.0004ah6_A mol:protein length:617 ASPARTATE--TRNA LIGASE, MITOCHONDRIAL  ali model follow..  39  9VVRTNTCGELRSSHLGQEVTLCGWIQYRRQNT---FLVLRDFDGLVQVIIPQDSVKKILCEAPVESVVQVSGTVISRPAGQENPKMPTGEIEIKVKTAELLNACKKLPFEIFVKKTEALRLQYRYLDLRSFQMQYNLRLRSQMVMKMREYLCNLGFVDIETPTLFKRTPGGAKEFLVPSR-EPGKFYSLPQSPQQFKQLLMVGGLDRYFQVARCYRDEGSRPDRQPEFTQIDIEMSFVDQTGIQSLIEGLLQYSWPNDKDPVVVPFPTMTFAEVLATYGTDKPDTRFGMKIIDISDVFRNTEIGFLQDALSKPHGTEGAKYLKRKDIESIRNFAADHFNQEILPVFLNANRNWNSPVANFIMESQRLELIRLMETQEEDVVLLTAGEHNKACSLLGKLRLECARGVVLRDPTLFSFLWVVDFPLFLPKE---------ENPRELESAHHPFTAPHPSDIHLLYTEPKKARSQHYDLVLNGNEIGGGSIRIHNAELQRYILATLL---KEDVKMLSHLLQALDYGAPPHGGIALGLDRLICLVTGSPSIRDVIAFPKSFRGHDLMSNTPDSVPPEELKPYHIRVSKPTDSKAERAHV....... 607
6 -175.0004wj3_M mol:protein length:599 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  47  3MMRSHYCGQLNESLDGQEVTLCGWVHRRRDHGGVIFLDVRDREGLAQVVFDPDETFAKADRVRSEFVVKITGKVRLRPEGARNPNMASGSIEVLGYELEVLNQAETPPFPLYSDVGEETRLRYRFIDLRRPEMAAKLKLRARITSSIRRYLDDNGFLDVETPILGRPTPEGARDYLVPSRTYPGHFFALPQSPQLFKQLLMVAGFDRYYQIAKCFRDEDLRADRQPEFTQIDIETSFLDESDIIGITEKMVRQLFKEVLDVEFDEFPHMPFEEAMRRYGSDKPDLRIPLELVDVADQLKEVEFKVFSGPRVAALRVPGAASMPRSQIDDYTKFVGIYGAKGLAYIKVNEREGLQSPIVKFIPEANLNVILDRVGAVDGDIVFFGADKAKIVCDALGALRIKVGHDLKL-LTREWAPMWVVDFPMFEE------------NDDGSLSALHHPFTSPKCTPAELEANPGAALSRAYDMVLNGTELGGGSIRIHDKSMQQAVFRVLGIDEAEQEEKFGFLLDALKYGAPPHGGLAFGLDRLVMLMTGASSIREVIAFPKTQSAGDVMTQAPGSVDGKALRELHIRLREQPKAE............. 593
7 -172.0001efw_A mol:protein length:580 ASPARTYL-TRNA SYNTHETASE  ali model follow..  50  1MRRTHYAGSLRETHVGEEVVLEGWVNRRRDLGGLIFLDLRDREGLVQLVAHPASPYATAERVRPEWVVRAKGLVRLRPEP--NPRLATGRVEVELSALEVLAEAKTPPFPVEKEASEELRLKYRYLDLRRRRMQENLRLRHRVIKAIWDFLDREGFVQVETPFLTKSTPEGARDFLVPYRHEPGLFYALPQSPQLFKQMLMVAGLDRYFQIARCFRDEDLRADRQPDFTQLDLEMSFVEVEDVLELNERLMAHVFREALGELPLPFPRLSYEEAMERYGSDKPDLRFGLELKEVGPLFRQSGFRVFQEAESVK-ALALPKALSRKEVAELEEVAKRHKAQGLAWARVEEGG--FSGGVAKFLEPVREALLQATEARPGDTLLFVAGPRKVAATALGAVRLRAADLL-GLKREGFRFLWVVDFPLLE----------WDEEEEAWTYMHHPFTSPHPEDLPLLEKDPGRVRALAYDLVLNGVEVGGGSIRIHDPRLQARVFRLLGIGEEEQREKFGFFLEALEYGAPPHGGIAWGLDRLLALMTGSPSIREVIAFPKNKEGKDPLTGAPSPVPEEQLRELGLMVVRP................. 580
8 -118.0004up7_A mol:protein length:777 LYSINE--TRNA LIGASE  ali model follow..  18  30FNVSITVPEFIAQVSDDIVSVAGRVLSKRSSSSLMFIDLHDSQTKLQIMLNKSAY-ENKEDFVSLTKMIYRGDI--CGFTGHPTRTKTGELSLIPISGMILSPCLMLPSMHYGLGDQETRFRKRYLDLINPESVKNFVLRTKVVKAVRKYLDDKGFLEVETPILNIPGGATARPFITHHNQLDIQMY-MRIAPELYLKELVVGGINRVYEIGRLFRNEGIDQTHNPEFTTCEFYMAYADYNDIMKMTEELLGNMVKD-----------ITGGSTKLEIKDRLMDINNEEDIKMLEKFFKEPIPRPFNSAECSKVIEKHCTELNYYYDGNNEKAMKKLFADFVTEKKMVLDF--TAPFKRISYVHALEEKFGEKIPRPLDGPEALTFLKKQAIRFNAICAEPQTTARVM-------------------DKLFGDLIEVDLVQPTFVCDQPQLMSPLAKY-----HRSEPELTERFELFILKREIANAYTELNNPIVQRSNFEQQAKGDDEAQLVDEVFLDAIEHAFPPTGGWGLGIDRLAMLLADVDNIKEVILFPTMRPEDELEKKAREAKEDAMVAQELAATEEKGGKKVVKPKANKQQP.. 605
9 -90.1004j15_A mol:protein length:521 Aspartate--tRNA ligase, cytoplasmic  ali model follow..  23  61.....RVRDLTIQKADEVVWVRARVHTSRAKGKQCFLVLRQQQFNVQALVAVGDHASKAANINKESIVDVEGVVRKVNQK--IGSCTQQDVELHVQKIYVISLAERLPLQLDDTVNQDTRLDNRVIDLRTSTSQAVFRLQSGICHLFRETLINKGFVEIQTPKIISAASEGGANVFTVSYFKNNAY--LAQSPQLYKQMCICADFEKVFSIGPVFRAEDSNTHRHTEFVGLDIEMAFNYYHEVMEEIADTMVQIFKGLQERFQTEIQTVNKQFPCEPFKFLEPTLR--LEYCEALAMLREAGVEMGDEDDLSTPNEK----------------------------------------------------------------------------------------------------------------------LLGHLVKEKYDTDFYILDKYPLAVRPFPDPRNPKQSNSYDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEK----IKAYIDSFRFGAPPHAGGGIGLERVTMLFLGLHNVRQTSMFPRDPKRLTP........................................ 515
10 -89.2001b8a_A mol:protein length:438 PROTEIN (ASPARTYL-TRNA SYNTHETASE)  ali model follow..  28  1MYRTHYSSEITEELNGQKVKVAGWVWEVKDLGGIKFLWIRDRDGIVQITAPKKKVDPEIPKLRSEDVVAVEGVVNFTPKA-------KLGFEILPEKIVVLNRAEPLPLDPTGKVELDTRLNNRFMDLRRPEVMAIFKIRSSVFKAVRDFFHENGFIEIHTPKIIATATEGGTELFPMKYFEEDAF--LAESPQLYKEIMMASGLDRVYEIAPIFRAEEHNTTRHNEAWSIDSEMAFIDEEEVMSFLERLVAHAINYVREHPKLPFPRVSYDKALEILGDLGKEIPWGEDI------------------------------------------------------------------------------------------------------------------------------------------DTEGERLLGKYMMENENAPLYFLYQYPSEAKPFKYDNKPEICRAFDLEYRGVEISSGGQREHRHDILVEQIKEKGLNPES----FEFYLKAFRYGMPPHGGFGLGAERLIKQMLDLPNIREVILFPRDRRRLTP........................................ 438
11 -87.9001wyd_A mol:protein length:429 hypothetical aspartyl-tRNA synthetase  ali model follow..  29  1MYRSHFIADVTPEYDGKEVIWAGWVHLLRDLGGKKFIILRDKTGLGQVVVDKNSAFGISQELTQESVIQVRGIVKADKRA-------PRGIELHAEEITLLSKAKPLPLDVSGKVKADTRLRERVLDLRRQEMQAVIKIQSLALKAFRETLYKEGFIEIFTPKIIASATEGGAQLF--PVIYFGKEAFLAQSPQLYKE-LMAGVVERVFEVAPAWRAEESDTPFHAEFISMDVEMAFADYNDVMQLLEKILHNIVKTIKEEVKIPIKRLKYTEAIEILRSKGYNIKFGDDIGT----------------------------------------------------------------------------------------------------------------------------------------------PELRILNEELKEDLYFIVDWPSDARPFSKSENPELSESFDLIYKFLEIVSGSTRNHKREVLEEALKKKGLKPES----FEFFLKWFDYGMPPHAGFGMGLARLMVMLTGIQSVKEIVPFPRDKKRLTP........................................ 429
12 -86.9005eln_A mol:protein length:535 Lysine--tRNA ligase  ali model follow..  17  42..ISMSLPAYALKYKDTTLSLSGRVTSIRSSSKLIFYDIFCEEQKVQIIANTGEFSVSHSEIRRGDVVGFTGFP----------KSKRGELSLFSKSVVLLSPCYMLPTAISGLKDQEVRYRQRYLDLLNEESRKVFKLRSRAIKYIRNYFDRLGFLEVETPMLNMIYGGAAARPFITYHNELETQLYMRIAPELYLKQLIVGGLDKVYEIGKNFRNEGIDLTHNPEFTAMEFYMAYADYYDLMDLTEELISGLVLEIHGSL-----KIPYHPDGPEGKCIEIDFTTPWKRFSFVEEIESGL-----------------------------------------------------------------------------------------------EKLKRPLDSQENIDFMVEMCEKHEIELPHPRTAAKLLDKLAGHFVETKCTNPSFIIDHPQTMSPLAKREKPEMTERFELFVLGKELCNAYTELNEPLQQRKFFEQQADGDVEACPIDETFCLALEHGLPPTGGWGLGIDRLIMFLADKNNIKEVILFPAMRNVKQNAQHSNQHSG............................... 528
13 -86.7005hgq_A mol:protein length:524 Lysine--tRNA ligase  ali model follow..  17  35..VSISLADFIAKYNDIVQSVAGRVFSKRESGKLIFYDLHGEGTRLQVLANARFHSGDHDRIKRGDIIGVNGYP----------RSKSGELSIIPYEIIQLTPCLMLPHTHFGLKNQETRYRMRYLDLMNPDVKNRFVTRSRMISFLRRYLDNLGFLEVETPMMNLIAGGATAKPFITHHNDLDMDLYLRVAPELYLKMLVVGGIDRVYEIGRVFRNEGIDQTHNPEFTSCEFYMAYADYEDLMKITEDMLARMVYYMHGTYKIQYH----PNGIVENPVYEVDFTPPFRKVNIYDGLQEKL----------------------------------------------------------------------------------------------QFPPADTLDTDEANKFFDKLAVENNVECPAPRTTARLLDKLIGEFLEPTFISPTFLTGHPQIMSPLAKRSIPGLTERFELFVVTKEIVNAYTELNDPLTQRLRFDEQAKGDDEAQNIDENYCTALEYGLPPTAGWGMGIDRLAMILTDSNNIKEVLFFPAMRPDEKGTNVLDEGGNA.............................. 524
14 -86.1003bju_A mol:protein length:521 Lysyl-tRNA synthetase  ali model follow..  18  33..VDISLTDFIQKYTDITLKVAGRIHAKRASGKLIFYDLRGEGVKLQVMANSRNYKSEEEFIHINNKLRRGDII---GVQGNPGKTKKGELSIIPYEITLLSPCLMLPHLHFGLKDKETRYRQRYLDLLNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHNELDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKMVSGMVKHITGSY-----KVTYHPDGPEGQAYDVDFTPPFRRINMVEELEKAL----------------------------------------------------------------------------------------------KLPETNLFETEETRKILDDICVAKAVECPPPRTTARLLDKLVGEFLEVTCINPTFICDHPQIMSPLAKRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKGDDEAMFIDENFCTALEYGLPPTAGWGMGIDRVAMFLTDSNNIKEVLLFPAMKPEDK......................................... 510
15 -85.5003a74_A mol:protein length:493 Lysyl-tRNA synthetase  ali model follow..  20  33..RTHKAEELFELEQQIEVAVAGRIMTKRGMGKAGFAHIQDVTGQIQIYVRQDDVGEQFKISDLGDIVGVRGTM----------KTKVGELSIKVSSYEFLTKALPLPEKYHGLKDIEQRYRQRYLDLMNPESKKTFITRSLIIQSMRRYLDSHGYLEVETPMMHAVAGGAAARPFITHHNALDMTLYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGISTRHNPEFTMLELYEAYADFRDIMKLTENLIAHIATEVLGTTKIQYGEHLVDLTPEWRRLHMVDAIKEYVGVDFWRQMSDEEARELAKEH--------------------------------------------------------------------------------------------------------------GVEVAPHMTFGHIVNEFFEQKVEDKLIQPTFIYGHPVEISPLAKPDDPRFTDRFELFIVGREHANAFTELNDPIDQRQRFEEQLKGNDEAHEMDEDFLEALEYGMPPTGGLGIGVDRLVMLLTNSPSIRDVLLFPQMRH............................................ 492
16 -85.5001e1o_A mol:protein length:504 LYSYL-TRNA SYNTHETASE, HEAT INDUCIBLE  ali model follow..  20  41..RDHTSDQLHEESLNIEVSVAGRMMTRRIMGKASFVTLQDVGGRIQLYVARDSLPEGFKKWDLGDIIGARGTL----------KTQTGELSIHCTELRLLTKALPLPDKFHGLQDQEVRYRQRYLDLANDKSRQTFVVRSKILAAIRQFMVARGFMEVETPMMQVIPGGASARPFITHHNALDLDMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYHDLIELTESLFRTLAQEVLGTTKVTYGEHVFDFGKPFEKLTMREAIKKYRPETDMADLDNF-------------------------------------------------------------------------------------------------------------DAAKALAESIGITVEKSWGLGRIVTEIFDEVAEAHLIQPTFITEYPAEVSPLARDVNPEITDRFEFFIGGREIGNGFSELNDAEDQAERFQEQVNGDDEAMFYDEDYVTALEYGLPPTAGLGIGIDRMIMLFTNSHTIRDVILFPAMRPQK.......................................... 504
17 -84.9001asy_A mol:protein length:490 ASPARTYL-tRNA SYNTHETASE  ali model follow..  23  26..RVKFVDLDEAKDSDKEVLFRARVHNTRQQGALAFLTLRQQASLIQGLVKANNMVKWAGSLNLESIVLVRGIVKKVDEPIKSAT--VQNLEIHITKIYTISETEALPILLEDVVNLDTRLDYRVIDLRTVTNQAIFRIQAGVCELFREYLATKKFTEVHTPKLLGAPSEGGSSVFEVTYF--KGKAYLAQSPQFNKQQLIVADFERVYEIGPVFRAENSNTHRHTEFTGLDMEMAFEEYHEVLDTLSELFVFIFSELPKRFAHEIELVRKQYPVEEFKLPKDGKMVRLTYKEGIEMLRAAGKEIGDFEDLSTENEKFLGKL-------------------------------------------------------------------------------------VRDKYDTDFYILDKFP---------------------LEIRPFYTMPDPAN---------PKYSNSYDFFMRGEEILSGAQRIHDHALLQERMKAHGL--SPEDPGLKDYCDGFSYGCPPHAGGGIGLERVVMFYLDLKNIRRASLFPRDPKRLRP........................................ 490
18 -84.8001bbu_A mol:protein length:504 PROTEIN (LYSYL-TRNA SYNTHETASE)  ali model follow..  20  41..RDHTSDQLHAEALNIEVAVAGRMMTRRIMGKASFVTLQDVGGRIQLYVARDDLPEGFKKWDLGDILGAKGKL----------KTKTGELSIHCTELRLLTKALPLPDKFHGLQDQEARYRQRYLDLSNDESRNTFKVRSQILSGIRQFMVNRGFMEVETPMMQVIPGGAAARPFITHHNALDLDMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYKDLIELTESLFRTLAQDILGKTEVTYGDVTLDFGKPFEKLTMREAIKKYRPETDMADLDNF-------------------------------------------------------------------------------------------------------------DSAKAIAESIGIHVEKSWGLGRIVTEIFEEVAEAHLIQPTFITEYPAEVSPLARDVNPEITDRFEFFIGGREIGNGFSELNDAEDQAQRFLDQVAGDDEAMFYDEDYVTALEHGLPPTAGLGIGIDRMVMLFTNSHTIRDVILFPAMRPVK.......................................... 504
19 -84.5003m4p_A mol:protein length:456 Asparaginyl-tRNA synthetase, putative  ali model follow..  23  14.VETPIVCNIRDGLEGKLVTFKGWAYHIRKARKLIFVELRDGSGYCQCVIFGKELPEKVKLLTRECSLEITGRLNAYAGKNHPPEIADLNLEMQVTEWKVIGESIDLENIINKDSSIPQKMQNRHIVIRSEHTQQVLQLRSEIQWYFRKYYHDNHFTEIQPPTIVKTQCEGGSTLFKLQYFNEPAY--LTQSSQLYLE-SVIASLGKSFCMLSSYRAEQSRTVRHAEYLHLEAELPFISFEDLLNHLEDLVCTVIDNVMAVPTRPFKRMTYADAIKYCNDHGILNK------------------------------------------------------------------------------------------------------------------------------------------DKPFEYGEDISEKPERQMTDEIGCPIFMIHFPSKMKAFKVPGHPDLTESVDLLMPGVEIVGGSMRIWNYDELMGAYKANGLNPDP----YYWYTQQRKYGSCPHGGYGLGVERLVMWLLGEDHIRKVCLYPRYLERCEP........................................ 456
20 -84.5004ex5_A mol:protein length:529 Lysine--tRNA ligase  ali model follow..  22  57..PTHHAADLQTAYKSLEVAIAGRMMLKRVMGKASFATVQDGSGQIQFFVTPADVGAEFKKWDLGDIVAARGVL----------RTNKGELSVKCTQLRLLAKALPLPDKFHGLADQETRYRQRYVDLVTPETRTTFRARTKAIASIRKFMGDADFMEVETPMLHPIPGGAAAKPFVTHHNALDMEMFLRIAPELYLKRLIVGGFERVFEINRNFRNEGVSPRHNPEFTMMEFYAAYTDYRWLMDFTERLIRQAAVDALGTATIQ------------YQGRELDLAQPFHRLTITQAIQK---------------------------------------------------------------------------------------------YAPSYTDGQLSDDAFLRSELKRLGVDVTQPAFLNAGIGALQLALFEETAEAQLWEPTFIIDYPIEVSPLARDTVAGITERFELFITGREIANGFSELNDPEDQAARFKKQVEGDEEAMFFDADYIRALEYGMPPTGGCGIGIDRLVMLLTDSPTIRDVLLFPHLRRED.......................................... 523
21 -83.2004ycv_A mol:protein length:516 Lysine--tRNA ligase  ali model follow..  18  33..RTISIPEFIEKYEDTILNITGRIMRVSASGKLRFFDLVGDGEKIQVLANYSFHNHEKGNF--AECYDKIRRGDIVGIVGFPGKSKKGELSIFPKETILLSACLHMLPMKYGLKDTEIRYRQRYLDLINESSRHTFVTRTKIINFLRNFLNERGFFEVETPMMNLIAGGANARPFITHHNDLDLDLYLRIATELPLKMLIVGGIDKVYEIGKVFRNEGIDNTHNPEFTSCEFYWAYADYNDLIKWSEDFFSQLVYHLFGTY-----KISYNKDGPENQPIEIDFTPPYPKVSIVEEIEKVT-----------------------------------------------------------------------------------------------TILEQPFDSNETIEKMINIIKEHKIELPNPPTAAKLLDQLASHFIENKYNDKPFIVEHPQIMSPLAKRTKPGLTERLEMFICGKEVLNAYTELNDPFKQKECFKLQQKGDTEAAQLDSAFCTSLEYGLPPTGGLGLGIDRITMFLTNKNSIKDVILFPTMRPAN.......................................... 508
22 -82.8001x54_A mol:protein length:434 Asparaginyl-tRNA synthetase  ali model follow..  25  1MIEKVYCQEVKPELDGKKVRLAGWVYTNMRVGKKIFLWIRDSTGIVQAVVAKNVVGEEAKKLGRESSVIVEGIV-------KADERAPGGAEVHVEKLEVIQAVSEFPIPEPEQASPELLLDYRHLHIRTPKASAIMKVKETLIMAAREWLLKDGWHEVFPPILVTGAVEGGATLF--KLKYFDKYAYLSQSAQLYLEAA-IFGLEKVWSLTPSFRAEKSRTRRHTEFWHLELEAAWMDLWDIMKVEEELVSYMVQRTLELTEPPFPRISYDEAIDILQSKGVNVEWGDDLGADEERVLTE-----------------------------------------------------------------------------------------------------------------------------------------------EFDRPFFVYGYPKHIKAFEDPNDPRKVLASDMLAGYGEIIGGSQREDDYDKLLNRILEEGMDPKD----YEWYLDLRRYGSVPHSGFGLGVERLVAWVLKLDHIRWAALFPRTPARLYP........................................ 434
23 -82.6006aqh_A mol:protein length:508 Lysine--tRNA ligase  ali model follow..  23  41..RTHTLLEIRQARTGEIVGVTGRVVFARNSGKLCFATLQEGDGQLQAMISLAEVGQEKTYVDIGDIVFVHGEV----------TSKRGELSVLADSWQMAAKALPLPVAHKEM-SEESRVRQRYVDLVRDQARKVARQRIAVMRAIRSALERRGFLEVETPMLQTLAGGAAARPFVTHSNALDTELYLRIAPELFLKRCLVGGFERVFELNRVFRNEGADSTHSPEFVMLETYQAYGTYDDSAVVTRELIQEVADEAIGTRQ-----------VPLPDGTVYDLDGEWESIQMYPSLSE------------------------------------------------------------------------------------------------ALGEEITPDTPAETLWAIADRLGLDIPRDRGYGHGKLVEELWEHTVGAKLWAPTFVKDFPVETTPLTRRSIPGVTEKWDLYVRRIELATGYSELTDPIIQRERFEAQARGDDEAMALDEDFLAALEYGMPPSTGTGMGIDRLMMTLTGL-SIRETVLFPIVKP............................................ 501
24 -82.1005vl1_A mol:protein length:506 Lysine--tRNA ligase  ali model follow..  21  38..RTHTLAEIRASATEDIVGVAGRVVFARNTGKLCFATLQDGDGQLQAMISLDEVGREKADVDIGDVVYVHGTV----------SSRRGELSVLADSWRMAAKALPLPVAHKEM-SEESRVRQRYVDLVRPQAREVARQRIAVIRAVRNALERRGFLEVETPMLQTLAGGAAARPFVTHSNALDIDLYLRIAPELFLKRCIVGGFDRVFELNRVFRNEGSDSTHSPEFSMLETYQTYGTYDDSALITRELIQEVADEAIGDIDGEWATMEMYSSLSEAGEQITPETTVARLRDIASGLDVEIDN-------------------------------------------------------------------------------------------------------------------------SVFGHGKLVEELWEHAVGNKLTAPTFVKDFPVETTPLTRRSIPGVTEKWDLYVRGVELATGYSELNDPVVQRDRFADQARGDDEAMQLDEDFLTALEYGMPPCTGTGMGIDRLLMCLTGL-SIRETVLFPIVRPHSN......................................... 500
25 -81.8006chd_A mol:protein length:597 Lysine--tRNA ligase  ali model follow..  18  101..VDISLTDFIQKYTDITLKVAGRIHAKRASGKLIFYDLRGEGVKLQVMANSRNYKSENNKLRRGDIIGVQGNP----------KTKKGELSIIPYEITLLSPCLMLPHLHFGLKDKETRYRQRYLDLLNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHNELDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKMVSGMVKHITGSY-----KVTYHPDGPEGQAYDVDFTPPFRRINMVEELEKAL----------------------------------------------------------------------------------------------KLPETNLFETEETRKILDDICVAKAVECPPPRTTARLLDKLVGEFLEVTCINPTFICDHPQIMSPLAKRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKGDDEAMFIDENFCTALEYGLPPTAGWGMGIDRVAMFLTDSNNIKEVLLFPAMKPEDKKENVATTDTLESTTVGTSV...................... 597
26 -80.7005xix_A mol:protein length:472 Asparagine--tRNA ligase, cytoplasmic  ali model follow..  23  39...........EGYRGQRVKVFGWVHRLRRQGKLMFLVLRDGTGYLQCVLADELCQYNGVLLSTESSVAVYGMLNLTPKG----KQAPGGHELSCDFWELIGLAAGGADNLIEESDVDVQLNNRHMMIRGENMSKILKARSMVTRCFRDHFFDRGYYEVTPPTLVQTQVEGGATLFKLDYFGEEAF--LTQSSQLYLE-TCLPALGDVFCIAQSYRAEQSRTRRHAEYTHVEAECPFLTFDDLLNRLEDLVCDVVDRILKSPKRPFKRMNYSDAIVWLKEHDVKKEDGTFY-----------------------------------------------------------------------------------------------------------------------------------------EFGEDIPEAPERLMTDTINEPILLCRFPVEIKSFRCPEDSRLTESVDVLMNVGEIVGGSMRIFDSEEILAGYKREGIDPTP----YYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRDVCLYPRFVQ............................................ 462
27 -79.8001n9w_A mol:protein length:422 aspartyl-tRNA synthetase 2  ali model follow..  29  9...........KAHVGQEVELLGFLHWRRDLGRIQFLLLRDRSGVVQVVTGGL------KLPLPESALRVRGLV-------VENAKAPGGLEVQAKEVEVLSPAEPTPVEIEWRANPDTLLEYRYVTLRGEKARAPLKVQAALVRGFRRYLDRQDFTEIFTPKVVRAGAEGGSGLFGVDYFEKRAY--LAQSPQLYKQ-IMVGVFERVYEVAPVWRMEEHHTSRHNEYLSLDVEMGFIDEEDLMRLEEALLAEMLEEALNTFPQDIPRLTHAEAKRILKEELGYP-------------------------------------------------------------------------------------------------------------------------------------------VGQDLSEEAERLLGEYAKERWGSDWLFVTRYPRSVRPFYTYPEDGTTRSFDLLFRGLEITSGGQRIHRYEELLESLKAKGMDPEA----FHGYLEVFKYGMPPHGGFAIGAERLTQKLLGLPNVRYARAFPRDRHRLTP........................................ 422
28 -79.6002xti_A mol:protein length:437 ASPARAGINYL-TRNA SYNTHETASE, CYTOPLASMIC, PUTATIVE  ali model follow..  25  9...........VKHRNERVCIKGWIHRMRRQGKLMFFILRDGTGFLQVLLMDKLCQYDALTVNTECTVEIYGAIKEVPEG----KEAPNGHELIADFWKIIGNAPPIDNVLNEEASVDKMLDNRHLVIRGENAAALLRLRAAATRAMREHFYNAGYVEVAPPTLVQTQVEGGSTLFNLDYFGEQSF--LTQSSQLYLETC-IPTLGDVFCIAQSYRAEKSRTRRHAEYAHVEAECPFITLDDLMEKIEELVCDTVDRLLADPERPFLRMEYKDAIKWLQEHNVENEFG-----------------------------------------------------------------------------------------------------------------------------------------NTFTYGEDIAEAAERFMTDTINKPILLNRFPSEIKAFRDAKDNTLTESVDLLMPGVEIVGGSMRIWKFDELSKAFKNVEIDPKP----YYWYLDQRLYGTCPHGGYGLGLERFICWLTNTNHIRDVCLYPRFVG............................................ 433
29 -78.8003i7f_A mol:protein length:548 Aspartyl-tRNA synthetase  ali model follow..  20  47GLKYTEIEELVPAMAEKTVTIRARVQAVRGKGNMVFLFLRKGIYTCQALVMKSETISKCQKISAESICDITGIV--KAVEKPIEKATQQDVEIHVTSIAVVSLAEKASAQKYVKVSQDTRLDNRMLDLRTVTNIAIFRIQSACCGLFREFLTSQKFVEIHTPKLIGCSSEGGSNIFEVKYFDRKAY--LAQSPQLYKQMAIMGDFRKVFEVGPVFRAENSNTRRHTEFEGLDIEMEIVNYHECIDVMEKLFTFIFDEIPKRIYRPFLRLTYKEAIEMLRASGETIGDYDDFTTPQE------------------------------------------------------------------------------------------------------------------------------------------VKLGELIKAKYNTDFYILDKFPAAIRPFPDIDDPNYSNSYDVFVRGQEITSGAQRIHDPEFLMKRCIEKGVDPAT----LKDYIESFRFGSWPHAGCGIGLERITMLYLGIPNIRKVTLFPRDPIRLNP........................................ 548
30 -63.5003a5y_A mol:protein length:345 Putative lysyl-tRNA synthetase  ali model follow..  18  2................................................................................................................GSSSSGLVPRGSHMSEQPSASIPNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIETRFVGPGHSQGMNLWLMTSPEYHMKRLLVAGCGPVFQLCRSFRNEEMGRYHNPEFTMLEWYRPHYDMYRLMNEVDDLLQQVLDC------PAAESLSYQQAFLRY----------------------------------------EIDPLSADKTQLREVAAKLDLSNVADTEEDRDTLLQLLFTFGV-------------------------------------------------------------------------------EPNIGKEKPTFVYHFPASQASLAQTEDHRVAERFEVYYKGIELANGFHELTDAREQQQRFEQDNRRGLPQHPIDQNLIEALKVGMPDCSGVALGVDRLVMLALGAETLAEVIAFSVDRA............................................ 339
31 -62.7003p8t_A mol:protein length:294 AsnS-like asparaginyl-tRNA synthetase related protein  ali model follow..  19  2...........................................................................................................................NAVEIISRDIYKAIDIQTKILDYMTKFFTDRGFKWLLPIMLSPITPDPAGEGIRPAEVD-GVRMRLTHSMILHKQLAIAMGLEKIFVLSPNIRLESRRKDHSYEFTQLDFEIEGAKMKDVMRLIEELIYGLFRKAEEPRARHFKVYDYKDILEEFGSDEKASM--------------------------------------------------------------------------------------------------------------------------------------------------------------EMEEPFWIVNIPREFYDREENG-VWKNYDLILPYGYGEVSSGGEREWEYEKIVAKIRAAGLKEDS----FRPYLEIARAGLKPSAGAGIGVERLVRFIVGAKHIAEVQPFPRVPGIPAVI....................................... 294
32 -59.9003g1z_A mol:protein length:326 Putative lysyl-tRNA synthetase  ali model follow..  19  9................................................................................................................................QPSASIPNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIETRFVGPGHSQGINLYLMTSPEYHMKRLLAAGCGPVFQLCRSFRNEEMGRHHNPEFTMLEWYRPHYDMYRLMNEVDDLLQQVLDCQPAESLSYQQAFQRHLEIDPLSADKTQLREAAAKLDLSNIADTEEDRDTLLQLLFTMGV----------------------------------------------------------------------------------------------------------------------------EPHIGKEKPTFIYHFPASQASLAQTEDHRVAERFEVYYKGIELANGFHELTDAREQQQRFEQDNRRGLPQQPIDQNLLDALAAGLPDCSGVALGVDRLVMLALGAESLADVIAFTVDRA............................................ 326
33 -59.1001nnh_A mol:protein length:294 asparaginyl-tRNA synthetase-related peptide  ali model follow..  18  2...........................................................................................................................NAVEIISREISPTLDIQTKILEYMTDFFVKEGFKWLLPVIISPITPDPAGEGMEPAEVE-GVKMRLTHSMILHKQLAIAMGLKKIFVLSPNIRLESRQKDHAYEFTQLDFEVERAKMEDIMRLIERLVYGLFRKAEEPKTKRFEVFEYSEVLEEFGSDEKASQ--------------------------------------------------------------------------------------------------------------------------------------------------------------EMEEPFWIINIPREFYDREVDG-FWRNYDLILPYGYGEVASGGEREWEYEKIVAKIRKAGLNEDS----FRPYLEIAKAGLKPSAGAGIGVERLVRFIVGAKHIAEVQPFPRIPGIPAVI....................................... 294
34 -44.90011as_A mol:protein length:330 ASPARAGINE SYNTHETASE  ali model follow..  14  1....................................................................................................................................MKTAYIAKQRQISFVKSHFSRQGLIEVQAPILSRVGDGTQDNLSVKVKALPDAQFEVVHSLAKWKRQTLFSAGEGLYTHMKALRDEDRLSPLH-YVDQWDWERVMGDGERQFSTLKSTVEAIWAGIKATLPDQIHFVHSQELLSRYPDLDAKGRERAIAKDLGAVFLVGIGGKLSDG---------------------------------------------------------------------------------------------------------------------------------HRHDVRAPDYDDWSTPSELGHAGLNGD----ILVWNPVLEDAFELSSMGIRVDADTLKHQLALT----GDEDRLELEWHQALLRGEMPQTIGGGIGQSRLTMLLLQLPHIGQVQAWPAAVR............................................ 323
35 -44.1004lns_A mol:protein length:351 Asparagine synthetase a  ali model follow..  13  4..........................................................................................................................DGYSSYV-LLQEQILTVKRSFSEALEKEL---NLVEVRAPILFRVGDGTQDNLSVPVKAIPNASFEVVHSLAKWKRRTLFAPGHGLYTHMTALRDDVLDNIHSVVVDQWDWEMVMKDDQRNLAFLKEVVCKVYAAIRKTELAVCEKYKQKPILPE----------------------------------------------------------------------TIQFVHAEHLLLAYPNLTAKEREREIAREYGAVFLIGIGAVLSSGDRHDARAPDYDDWTS----------------------------PVEASQVVFPRTSKPIPTMNSLSSLKGLNGD---ILLYNPTLDDSLEVSSMGIRVNAEALRHQ----ISLTGDDSLLKSEWHQQLLNGEFPQTVGGGIGQSRMVMFMLRKKHIGEVQCWPEEIRKKHNLL...................................... 351
36 -41.9005gro_A mol:protein length:115 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  40  6.MRSHFCTEISEKDVGKIVKVAGWCNTYRDHGGVVFIDLRDKSGLVQLVCDPSKAYEKALEVRSEFVLVAKGKVRLRGAGLENPKLKTGKIEIVLEELIIENKS................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 109
37 -38.5004gn5_A mol:protein length:113 OBody AM3L15  ali model follow..  25  4.KKTHWTAEITPNLHGSEVVVAGWVAHLGDYGRVKIVKVSDREGGAAVPVYLEHLFKVFAELSREDVVVIKGIVEAGWPVAL-----DTGVEIFPSEIWILNKAKPLPID............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 113
38 -36.2004gn3_B mol:protein length:113 OBody AM1L10  ali model follow..  25  8.KKTHWTAEITPNLHGTEVVVAGWVASLGDYGRVKIVKVSDREGGAAVSVYLEHLFKVFAELSREDVVVIKGIVEASKA---AADMHNG-VEIFPSEIWILNKAK.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 113
39 -35.9004gn4_B mol:protein length:108 OBody AM2EP06  ali model follow..  24  5.KKTHWTAEITPNLHGSEVVVAGWVAHLGDYGRVKIVKVSDREGGAAVPVYLEHLFKVFAELSREDVVVIKGIVEASEQYGS-----ATGVEIFPSEIWILNKA................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 108
40 -35.8004gla_C mol:protein length:109 OBody NL8  ali model follow..  24  6.KKTHWTAEITPNLHGTEVVVAGWVASLGDYGRVKIVKVSDREGGAAVPVYLEHLFKVFAELSREDVVVIKGIVEASK-------GVGRGVEIFPSEIWILNKAKA................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 109
41 -35.6002zni_A mol:protein length:308 Pyrrolysyl-tRNA synthetase  ali model follow..  15  4........................................................SSSGLVPRGSHMFLTRRDPPLSSFTKVQYQRLKELNASGEQLEMGFSDASRDRAFQGIEHQLMSQGKRHLELRTVKHRPAL---LELEEKLAKALHQQGFVQVVTPTILAKMTIGEDHPLFSQVFWLDGKKCLRLAPNLYTLWRLWDKPIRIFEIGTCYRKESQGAQHLNEFTMLNLTELGTPLEERHQRLEDMARWVLEAAG------IREFELVTESSVVYGDTVDVM............................................................................................................................................................................................................................................................................................................................. 238
42 -35.3004glv_B mol:protein length:107 OBody AM3L09  ali model follow..  24  4.KKTHWTAEITPNLHGSEVVVAGWVAHLGDYGRVKIVKVSDREGGAAVPVYLEHLFKVFAELSREDVVVIKGIVEATTVTRW-----DTGVEIFPSEIWILNKA................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 107
43 -26.4004bw9_A mol:protein length:291 PYRROLYSINE--TRNA LIGASE  ali model follow..  12  3................................................................SSSSGLVPRGSHMASAPALTKSQTDRLEVLLNPKDEISLNS--GKPFRELESELLSRRKKDLQQIYAE--ERENYLGKLEREITRFFVDRGFLEIKSPILIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLGNYLLPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQ--MGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVFGDTLDVMHGDLEL.............................................................................................................................................................................................................................................................................................................................. 228
44 -25.9002e3c_A mol:protein length:291 Pyrrolysyl-tRNA synthetase  ali model follow..  15  13..........................................................................SHMASAPALTKSQTDRLEVLLNPKDEISLN--SGKPFRELESELLSRRKKDLQQIYAE--ERENYLGKLEREITRFFVDRGFLEIKSPILIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLLPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCENLESIITDFLNHLLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFK............................................................................................................................................................................................................................................................................................................. 266
45 -25.0004tqd_A mol:protein length:291 Pyrrolysine--tRNA ligase  ali model follow..  16  7....................................................................GLVPRGSHMASAPALTKSQTDRLEVLLNPKDEISLN--SGKPFRELESELLSRRKKDLQQIYAE--ERENYLGKLEREITRFFVDRGFLEIKSPILIERMGIDNDTELSKQIFRVDKNFCLRLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLSFIQMGSGRENLESIITDFLNHLLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLL.................................................................................................................................................................................................................................................................................................................... 259
46 -21.7003qtc_A mol:protein length:290 Pyrrolysyl-tRNA synthetase  ali model follow..  17  4....................................................................GLVPRGSHGASAPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKK----DLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIERMGIDNDTELSKQIFRVDKNFCLRLTPNLYNYLRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLVFWQMGSGRENLESIITDFLNHL............................................................................................................................................................................................................................................................................................................................................................. 198
47 -21.4005k1p_A mol:protein length:274 Pyrrolysine--tRNA ligase  ali model follow..  18  3...........................................................................................ALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKK-EERENYLGKLEREITRFFVDRGFLEIKSPILIERMGIDNDTELSKQIFRVDKNFCLRLAPNLYNYLRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLAFAQMGSGRENLESIITDFLNHLLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKV.................................................................................................................................................................................................................................................................................................................. 244
48 -20.8004q6g_A mol:protein length:267 Pyrrolysine--tRNA ligase  ali model follow..  17  4...................................................................................TKSQTDRLEVLLNPKDEISLNS------KPFRELESELLSRRKKLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIERMGIDNDTELSKQIFRVDKNFCLRVAPNIFNYARKLDR--KIFEIGPCYRKESDGKEHLEEFTMLNFFQMGSGRENLESIITDFLNHLLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKV.................................................................................................................................................................................................................................................................................................................. 243
49 -19.6004cs2_A mol:protein length:274 PYRROLYSINE--TRNA LIGASE  ali model follow..  17  3...........................................................................................ALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKK-EERENYLGKLEREITRFFVDRGFLEIKSPILIERMGIDNDTELSKQIFRVDKNFCLRLAPNLANYLRKLD---KIFEIGPCYRKESDGKEHLEEFTMLNFCQSGCTRENLESIITDFLNHL............................................................................................................................................................................................................................................................................................................................................................. 184
50 -14.5002j3l_A mol:protein length:572 PROLYL-TRNA SYNTHETASE  ali model follow..  13  1...........................................................................MKQSKMLIPTLREVPNDAEVLSHQILLRAGYIRQVAAGI--------YSYLPL-------ANRVLEKLKTIMREEFEKIDAVEMLMPALLPAE-ETYGPNLYRLKDRNDRDYILGPTHEETFTELIRDEINSYYQIQTKYRDE-----RGREFIMKDGYSFHADEASLDQSYRD-YEKAYSRIFERCGLEFRAII-GDGGAMGGKDSKEFMAISEIGEDTICYSTESDYAANLEMATSLYTPKKSHETQLDLEKIATPEVGTIAEVANFFEVEPQRIIKSVLFIADEEPVMVLVRGDHDVNDVKLKNFLGADFLDEATEEDARRVLGAGFGSIGPVNVSEDVKIYADLAVQDLANAIVGANEDGYHLTNVNPDRDFQPISYEDLRFVQEGDPSPDGNGVLAFTKGIEIG-------------HIFK---LGTRYSDAMGATVLDENGREKSVIMGYGIGVSRLLSAIVEQNADERGINWPTG---------APFDLH-AMMTEAGYEVLVDDRNERAGVKFADAD... 520
51 -13.8005ucm_A mol:protein length:579 Proline--tRNA ligase  ali model follow..  12  1.........................................................................MAMRTSQYLLSTLKETPADAVVISHQLLLRAGMIRRLASGL--------YTWLPM-------GLRVLRKVETIVREEMNAAGALEVLMPAVQPAE-EQYGPELLRLKDRHEREFCVGPTHEEVITDLARNELNSYYQIQTKFRDE-----RGREFIMKDAYSFHLSQDSLQQTYDGM-YQAYSKIFSRLGLDFRPVQ-ADNGSIGGSGSHEFHVLANSGEDDIVFSDSSDYAANIEKAEAVPRESARGSATEDMRLVDTPNTKTIAALVDGFQLPIEKTIKTLVGAEEGTLVALIVRGDHELNEIKAANQPLVASPLVFASEAEIRAAIGAGPGSLGPVNLPIACIVDRSVALMSDFAAGANIEDKHYFGVNWERD-LPLPEVADLRNVVEGDPSPDGKGTLVIKRGIEVG-------------HIFQ---LGTKYSEAMKLSVLSEQGKPVNLIMGYGIGVSRVVAAAIEQNHDERGILWPSALAPFQIALVPLKYETESELTAAGFEVLLDDRDKKTSPGVKFADME. 525
52 -12.2003hri_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  15  1....................................................................................................MAMGTLEAQTQGPGSMQMNMVETEPVQGCRDFPPETMRLRKYLFDVFHSTARKFGFEEYDSPLYIRKAGEEITEQMFNFITKGGHRVALPEMTPSLARQLLAKGRSKWYSIPQCWRYEAITRGRRREHYQWNMDISVSSEVELVCAACTAMQSLGLSSKDVGVKINSRKILQTVVEQAGVSADKFAPVCVIVDKME-------------------------------------------------KLPREEVVAQLAAIGLESNVVDAITSTLSLKTIDEIAQRIGEEHEAVRELRDFITQIEAY------------------------------------------------------DWVIFDASVVRGLAYEGFDRDGNFGGG--------------------------RYDNLLTTYGSPTAPCVGFGFGDCVIVELLNEKKLLPDDLVIPFDETMRPHALSI-----LRRLRDAGRSADIVFDKKKVVQAFNYADR.. 403
53 -11.8003net_A mol:protein length:465 Histidyl-tRNA synthetase  ali model follow..  13  1...............................................................................................................SNAMAKNDKINFSTPSGFPEFLPSEKRLELYLLDTIRRVYESYGFTPIETPALEPILPPNRQAEKDKSGDTGSEARALFDQTVPLAAYIARHLNDARYQMDVVFRGERAKDGRFRQFRQCDIDVSLLYDAQMPAIITEIFEAV--NIGDFVIRINNRKVLTGFFQSLNISETQIKSCISIIDNLEKIGEAKVK----------------------------------------------------------LELEKEGINPEQTQKIIDFVKIDGSVDDVLDKLKHLSQTLPESEQFNLG----------------------------------------VSELETVITGVRNLGVPDKRFCIDLIARGLNYYTGT-----------VYETTLIGHEALGSRYEELVGTFIGEKMPGVGISIGLTRLISRLLKAGILNQVVVVNMQDELMPTYLKV-----SQQLRQAGLNVITNFEKRQLGKQFQAADK.. 419
54 -11.5003hrk_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  15  1....................................................................................................MAMGTLEAQTQGPGSMQKNMVETEPVQGCRDFPPEAMRCRRHLFDVFHATAKTFGFEEYDAPLYIRKAGEEITEQMFNFITKGGHRVALPEMTPSLARLLLGKGRSKWYSIPQCWRYEAITRGRRREHYQWNMDISVSAEVELVCAACWAMRSL------------------------GLSSKDVGIKVNSRKVLQTVVEQAGVTSDKFAPVCVIVDKMEKIPREEVEAQLA-------------------------VLGLEPTVVDAITTTLSLKSIDEIAQRVGEEHEAVKELRQFFEQVEAY------------------------------------------------------DWVLFDASVVRGLAYEGFDREGKFGGG--------------------------RYDNLLTTYGSPTPPCAGFGFGDCVIVELLQEKRLLPDDVVIPFDESMRPHALAV-----LRRLRDAGRSADIILDKKKVVQAFNYADR.. 403
55 -11.3004g85_A mol:protein length:517 Histidine-tRNA ligase, cytoplasmic  ali model follow..  12  17....................................................................ALEELVKLQGERVRGLKQQKASAELIEEEVAKLLKLKAQLGPDESKQKFVLKTPKGTRDY----SPRQMAVREKVFDVIIRCFKRHGAEVIDTPVTLMGKYGEDSKLIYDLKDQGGELLSLYDLTVPFARYLAMNKLTKRYHIAKVYRRDAMTRGRYREFYQCDFDIPMIPDAECLKIMCEILSSL------------------------QIGDFLVKV-------------NDRRILDGMFAICGVSDSKFRTICSSVDKLDKVSWEEVKNEMVGEKGLAPEVADRIGDYVQQHGGVSLVEQLLQDPKLSQNKQALEGLGDLKLLFEYLTLFGIDDKISFDLSLARGLDYYTGVIYEAVLLQTPAQAGEEPLG-------------------------------------GSVAAGG--------------------------RYDGLVGMFDPKGRPCVGLSIGVERIFSIVEQDAGIKAELLYKKNPKLLNQLQYCEEAIGEQELKDGVIKLRSVTSREEVDVRREDLVE.. 507
56 -10.8001nnx_A mol:protein length:109 Protein ygiW  ali model follow..  18  24..SVTTVESAKSLRDDTWVTLRGNIVERISDDLYVF---KDASGTINVDIDHKRWNGV--TVTPKDTVEIQGEV----------DKDWNSVEIDVKQIRKVNP.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 109
57 -10.6001wu7_A mol:protein length:434 Histidyl-tRNA synthetase  ali model follow..  13  3.......................................................................................................................RLQIEKIRGFRDFYPEDMDVEKFIFKTAEEAAEAFGFRRIDFPSLRIKSGEELLQQTYSFVDKGGREVTLPEATPSTVRMVTSRKD-RWYSFPKVWRYEEPQAGRYREHYQFNADISPEADAEVIALASSILDRL--GLQDIYEIRINSRKIMEEIIGGMTSSDPFSVFSIIDRYHKISREEFVDQLRSAGIGEDGV--------SMIADLCSGTRGIDEMARITGKSSEEIARMAAVEDLLASYGVKNVRYDFSIVRG------------------------------------------------------------------------YT------------------GIVFEAYDRSGQFGGG--------------------------RYDNLASLMSGESVPAVGFGMGDAVISLLLKRPREKKSVYICRVGKINSSIMNEY-----SRKLRERGMNVTVEIMERGLSAQLKYASA.. 380
58 -10.6004g84_A mol:protein length:464 Histidine--tRNA ligase, cytoplasmic  ali model follow..  11  4................................................................................................................SEFELRRQFVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFLMGKYGEDSKLIYDLKDQGGELLSLYDLTVPFARYLAMNKLTKRYHIAKVYRRDAMTRGRYREFYQCDFDIPMIPDAECLKIMCEILSSL--------------------------QIGDFLVKVNDRRILDGMFAICGVSDSKFRTICSSVDKLDKVSWEEVKNEMVGEKGLAPEVADRIGDYVQQHGGVSLVEQLLQDPKLSQNKQALEGLGDLKLLFEYLTLFGIDDKISFDLSLARGLDY------------------------------------------YTGVIYEAVLLQTPAQAGEEPLGVGSVA-----AGG--------------------------RYDGLVGMFDPKGRPCVGLSIGVERIFSIVEQDAGIKAELLYKKNPKLLNQLQYCEEAIGEQELKDGVIKLRSVTSREEVDVRREDLVE.. 454
59 -10.4004e51_A mol:protein length:467 Histidine--tRNA ligase  ali model follow..  12  1.................................................................................................MAMGTLEAQTQGPGSMTEQKRKLEKLTGVKGMNDILPQDAGLWEFFEATVKSLLRAYGYQNIRTPIVEHTP--GEVTDIVEKEMYSGENLTLPENTAAVVRAAIEHNMLRLWYIGPMFRHERPQRGRYRQFHQVGVEAGPDADAEIVMMCQRLWEDLIKLEINSLGLAEERAAHRVELIKYLEQHAD-----------------------------------------------------------------------KLDDDAQRRLYTNPLRVLDTKNPALQEIVRNAPKLIDFLGDVSRAHFEGLQRLLKANNVPF----------------------------------------------TINPRLVRGLDYKLGAQGTVAAGG--------------------------RYDPLIEQLGGKPTAACGWAMGIERILELLKEEHLVPDVYVVHQGDAAREQAFIVAERLRDTGLD---VILHCSADGAGASFKSQMKRADA 400
60 -10.2003rac_A mol:protein length:373 Histidine-tRNA ligase  ali model follow..  15  1.......................................................................................................SNAMNGTRSAWGARAWEAVRGFADR-QDGYPDFAKRRRAVETRLLSFVEDAGYEPVTSGTLLRARSPESSRDWIRLFDGGGDAVALR--PEMTPSIARMAAPRRWCYCERVYRRTDDPASLSWESTQVGIERSVDVDMDVLRLLHEASAAA--------------------------GVRHHRIVVSHARLVPRLLDA------------------LGISASLSRAFLACLTSGNYVQFRELWQLHAAKDVDLLANLLTWSPAERDAAKRSREASDRELEALLRDAVDPRAAADVRDAWRYLCRLAE----------------------------------------ALHDSGLASDVVTFDLALHRELDYGLVFEGAPIAQGG-------------------------RYDELLAQFGAGAPA--GFAFEVERVMAVLEAQEEGEG..................................................... 371
61 -10.0004rdx_A mol:protein length:423 Histidine--tRNA ligase  ali model follow..  14  2.......................................................................................................................PMTARAVRGTKDLFGKELRMHQRIVATARKVLEAAGALELVTPIFEETATDIVRKEMFTFQDRGGRSLTLPEGTAAMVRAYLEHGMKRLWMAGPMFRAERPQKGRYRQFHQVNYEANPILDAEAVVLLYECLKEL----LRRLKVKLSSVGDPEDRARYNAYLRE-------------------------------------------------------------------------------------------------VLSPHREALSEDSKERLELNPMRILDSKSERDQALLKELGVRPMLDFLGEEARAHLKEVERHLERLSVPYELE-----PALVRGLDYYVRTAFEVHHEEIALGGGG-------------------------RYDGLSELLGGPRVPGVGFAFGVERVALALEAEEKGPDLYLIPLTEEAVAEAFYLAEALRPRLRAEYALAPRKPAKGLEEALKRG...... 379
62 -9.8002el9_A mol:protein length:431 Histidyl-tRNA synthetase  ali model follow..  12  4..................................................................................................................YQDPMAKNIQAIRGMNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTVTDVVEKEMYTFEDRNGDSLTLPEGTAGCVRAGIEHGLLRLWYIGPMFRHERPQKGRYRQFHQLGCEVGPDIDAELIMLTARWWRAL--GISEHVTLELNSIGSLEARANYRDALVAF-----------------------------------------------------------------EQHKEKLDEDCKRRMYTNPLRVLDSKNPEVQALLNDAPALGDYLDEESREHFAGLCKLLESAGIAY----------------------------------------------TVNQRLVRGLDYSLGSQGTVCAGG--------------------------RYDGLVEQLGGRATPAVGFAMGLERLVLLVQAVDPVVDIYLVASGADTQSAAMALAERLRDELP---GVKLMTNHGGGNFKKQFARADK.. 385
63 -9.8003od1_A mol:protein length:400 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  13  17.................................................................................................................................RDTLPEWYKTKKNICDQMTEEINLWGYDMIETPTLVGVVSAILDQQLFKLLDQQGNTLVLR--PDMTAPIARLVASSRLAYQSNVYRAQQNEGGKPAEFEQLGVEL--IGDGTASADGEVIALMI------------------AALKRAGLSEFKVAIGHV----------------------------------NALLMDVVGNEQRADRLRRFLYEKNYVGYREHVKSLNLSTIDKSRLMNLLSLRGGRAAIEEARGLIQTEKGKTALAEMTKLYEVLESYGASEYVKFDLT--------------------------------------LVLHMSYYTGVVFEGYGNGVPLCSGG-------------------------RYDELLSKFHRPAQA--GFGVRIDLLVEALNGEIISNGCILFSNERRFEAIEL-------ARKKRANGEAVVLQDLAGVTDVDAMSSNYQD 385
64 -9.1501qe0_A mol:protein length:420 Histidine--tRNA ligase  ali model follow..  10  9.................................................................................................................................QDILPEDSKKWRYIENQLDELMTFYNYKEIRTPIFESTSTDVVQKEMYTFKDKGDRSITLPEGTAAVVRSYIEHKM-KLYYNGPMFRYERKQKGRYRQFNQFGVEANPSVDAEVLAMVMHIYQSF----LKHLKLVINSVGDMASRKEYNEALVKH-----------------------------------------------------------------EPVIHEFCSDCQSRLHTDPMRILDCKVDRDKEAIKTAPRITDFLNEESKAYYEQVKAYLDDLGIPYT---------------------------------EDPNLVRGLDYYTHTAFELMMDNPNYDGAITTLCGGG-------------------------RYNGLLELLDGPSETGIGFALSIERLLLALEEEEENLDLFIVTMGDQADRYAVKL------NHLRHNGIKADKDYLQRKIKGQMKQADR.. 377
65 -9.1301z7m_A mol:protein length:344 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  10  1..............................................................................................................MRGSGSIEGRMEKINYLLSAEMTLNQVKSLRQIEGRLRKLFSLKNYQEVMPPSFESNGKTFNQEKMFQFIKHEGQSITLR--YDFTLPLVRLYS--RYSYFGKIFRKEKRHKGRSTENYQIGIELADKSELEILSLALQVIEQL-------------------GLNKTVFEIGSAKFFQRLCQLADGSTELLTELLLK-------------------------------------------KDLSGLNAFIEKNNFSKELRGLLKEIFITNELSRLENLVTNTKDDVLISSFDQLKEFSEKLSMIKPIIIDLG--------------------------------------MVPKMDYYTDLMFKAYSSAANLSGG--------------------------RYDQLLSNFQEEAFA--GFCCHMDTILKALERQELEED..................................................... 336

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 7 0 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Osterman A, Overbeek R, Godzik A. Automatic detection of subsystem/pathway variants in genome analysis. Bioinformatics. 2005 Jun 1;21 Suppl 1:i478-i486.