current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 4tqd_A mol:protein length:291 Pyrrolysine--tRNA ligase, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .
# Score Template Links and tools%idFirst MGSSSSGLVPRGSHMASAPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLSFIQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNLLast
1 -119.0004tqd_A mol:protein length:291 Pyrrolysine--tRNA ligase  ali model  100  1MGSSSSGLVPRGSHMASAPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLSFIQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL 285
2 -115.0002e3c_A mol:protein length:291 Pyrrolysyl-tRNA synthetase  ali model follow..  98  1MGSSSSGLVPRGSHMASAPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSGSYYNGISTNL 285
3 -99.8005k1p_A mol:protein length:274 Pyrrolysine--tRNA ligase  ali model follow..  99  2..................PALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLAFAQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL 268
4 -94.7004q6g_A mol:protein length:267 Pyrrolysine--tRNA ligase  ali model follow..  97  1..................PALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMVAPNIFNYARKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFFQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCSVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL 267
5 -92.1004bw9_A mol:protein length:291 PYRROLYSINE--TRNA LIGASE  ali model follow..  98  1MGSSSSGLVPRGSHMASAPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLGNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVFGDTLDVMHGDLELSSAVVGPRPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL 285
6 -88.8003qtc_A mol:protein length:290 Pyrrolysyl-tRNA synthetase  ali model follow..  97  2....KGGLVPRGSHGASAPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLTPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLVFWQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVFGDTLDVMHGDLELSSALVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL 282
7 -84.2004cs2_A mol:protein length:274 PYRROLYSINE--TRNA LIGASE  ali model follow..  98  2..................PALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLANYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVFGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL 268
8 -81.3002zni_A mol:protein length:308 Pyrrolysyl-tRNA synthetase  ali model follow..  41  1MGSSSSGLVPRGSHMFLTRRDQYQRLKELNASGEQLEMGFSDRDRAFQGIEHQLMSQGKRHLEQLRTVKHRPALLELEEKLAKALHQQGFVQVVTPTIITKSALAKMTIGEDHPLFSQVFWLDGKKCLRPMLAPNLYTLWRELERLWDKPIRIFEIGTCYRKESQGAQHLNEFTMLNLTELGTPLEHQRLEDMARWVLEAAGIEFELVTESSVVYGDTVDVMKGDLELASGAMGPHFLDEKWEIFDPWVGLGFGLERLLMIREGTQHVQSMARSLSYLDGVRLNI 301
9 -58.1003l4g_A mol:protein length:508 Phenylalanyl-tRNA synthetase alpha chain  ali model follow..  16  200.GSWRDRPFKPYNFLAHGVLPDSGHLHPLLKVRSQFRQIFLEMG--FTEMTDNFIESSFWNFDALFQPQQHP-----ARDQHDTFFLRDPAEALQLPMDYVQRVKRTHSQSQGYKYNWKLDEARKNLLRTHTTSASARALYRLAQKPFTPVKYFSIDRVFRNETLDATHLAEFHQIEGVVADHGLTLGHLMGVLREFFTKLGITQLRFKPAYNPYTEPSMEVKKWVEVGNSGVFRPEMLLPMGLPENVIAWGLSLERPTMIKYGINNIRELVGHKVLQMVYDSPL 492
10 -56.7001b70_A mol:protein length:350 PHENYLALANYL-TRNA SYNTHETASE  ali model follow..  13  76.ALKEALERERVDVSLPGASLFSGGLHPITLMERELVEIFRALG--YQAVEGPEVESEFFNFDALNIPEHHP-----ARDMWDTFW--------------------LTGEGFRLEGPLGEEVEGRLLLRTHTSPMQVRYMVAH----TPPFRIVVPGRVFRFEQTDATHEAVFHQLEGLVVGEGIAMAHLKGAIYELAQALFGPDSRFQPVYFPFVEPGAQFGKWLELGGAGMVHPKVFQAVDAYRTGFAFGLGVERLAMLRYGIPDIRYFFGGRLKF....... 342
11 -53.2002rhq_A mol:protein length:294 Phenylalanyl-tRNA synthetase alpha chain  ali model follow..  12  26.....QLAEETIDVTLPSRQISIGSKHPLTRTVEEIEDLFLGLG--YEIVDGYEVEQDYYNFEALNLPKSHP-----ARDMQDSFY-----------------------------------ITDEILMRTHTSPVQARTMEKRNG--QGPVKIICPGKVYRRDSDDATHSHQFTQIEGLVVDKNIKMSDLKGTLELVAKKLFGAEIRLRPSYFPFTEPSVEVTGWIEILGAGMVHPNVLEMAGFDSNGFAFGMGPDRIAMLKYGIEDIRYFYTNDVRF....... 276
12 -52.3003pco_A mol:protein length:327 Phenylalanyl-tRNA synthetase, alpha subunit  ali model follow..  11  82.ALNARLAAETIDVSLPGRRIENGGLHPVTRTIDRIESFFGELG--FTVATGPEIEDDYHNFDALNIPGHHP-----ARADHDTFW-----------------------------------FDTTRLLRTQTSGVQIRTMKAQQ-----PPIRIIAPGRVYRNDYDQTHTPMFHQMEGLIVDTNISFTNLKGTLHDFLRNFFEEDLRFRPSYFPFTEPSAEVDKWLEVLGCGMVHPNVLRNVGIDPEGFAFGMGMERLTMLRYGVTDLRSFFENDLRF....... 322
13 -49.8004p71_C mol:protein length:338 Phenylalanine--tRNA ligase alpha subunit  ali model follow..  13  82.ALAARLAAERIDVTLPGRGQLSGGLHPVTRTLERIEQCFSRIG--YEVAEGPEVEDDYHNFEALNIPGHHP-----ARAMHDTFY-----------------------------------FNANMLLRTHTSPVQVRTMESQ----QPPIRIVCPGRVYRCD-SDLTHSPMFHQVEGLLVDEGVSFADLKGTIEEFLRAFFEKQLRFRPSFFPFTEPSAEVTGWLEVMGCGMVHPNVLRMSNIDPEGFAFGMGAERLAMLRYGVNDLRLFFDNDLRF....... 333
14 -49.3002du3_A mol:protein length:534 O-phosphoseryl-tRNA synthetase  ali model follow..  16  22.AGKEILAERSPNELYPRVGFSFGKEHPLFATIQRLREAYLSIG--FSEVVNPLIVEDVHVKKQFGREAAITKREVDSKPLQEIFHRYKKGEIDGDDLSY-LIAEVLDVDDITAVFKELKPISSTLTLRSHMTTGWFITLSHIADKLPLPIKLFSIDRCFRREGEDATRLYTYFSASCVLVDEELSVDDGKAVAEALLRQFGFENFRKDEKRSKYYIPDTQTDGWIEIATFGIYSPTALAEYDIPYPVMNLGLGVERLAMILYGYDDVRKMVYPQIHG....... 353
15 -48.5005x6c_A mol:protein length:553 O-phosphoserine--tRNA(Cys) ligase  ali model follow..  14  44.........KHIDNKYPRLKPVYGKPHPVMETIERLRQAYLRMG--FEEMINPVIVDEMEIYKQFGPEAMAKNLGIDIDEEKKERLREVLHLYKKGAIDGDDLVFEIAKALNVSEFKDLKPESTTLTLRSHMTSGWFITLSSLIKKRKLPLKLFSIDRCFRREQEDRSHLMSYHSASCVVVGEDVSVDDGKVVAEGLLAQFGFTKFKFDEKKSKYYTPETQTEEWIEVATFGVYSPIALAKYNIDVPVMNLGLGVERLAMIIYGYEDVRAMVYPQFYE....... 361
16 -38.0003bju_A mol:protein length:521 Lysyl-tRNA synthetase  ali model follow..  17  106......NKLRRGDIIGVQGNPGKTKKGELSIIPYEITLLSPCLPHLHFGLKDKETRYRQRYLDLILNDFVRQIRSKIITYIRSFLDELGFLEIETPMMNII-----PGGAVAKPFITYHNELDMNLYMR------IAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYAD--YHDLMEITEKMVSGMVKSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKAKPPTAGWGMGIDRVAMFLTDSNNIKEV.............. 499
17 -37.8005hgq_A mol:protein length:524 Lysine--tRNA ligase  ali model follow..  18  107.....HDRIKRGDIIGVNGYPARSKSGELSIIPYEIIQLTPCLPHTHFGLKNQETRYRMRYLDLIMNPDVKNTRSRMISFLRRYLDNLGFLEVETPMMNLI-----AGGATAKPFITHHNDLDMDLYLR------VAPELYLKMLVVGGIDRVYEIGRVFRNEGIDQTHNPEFTSCEFYMAYAD--YEDLMKITEDMLARMVYSIPGLTERFELFVVTKEIVNAYTELNDPLTQRLRFDEQAKQKPPTAGWGMGIDRLAMILTDSNNIKEV.............. 502
18 -37.4005eln_A mol:protein length:535 Lysine--tRNA ligase  ali model follow..  17  115.....HSEIRRGDVVGFTGFPGKSKRGELSLFSKSVVLLSPCYPTAISGLKDQEVRYRQRYLDLMLNEESRKLRSRAIKYIRNYFDRLGFLEVETPMLNMI-----YGGAAARPFITYHNELETQLYMR------IAPELYLKQLIVGGLDKVYEIGKNFRNEGIDLTHNPEFTAMEFYMAYAD--YYDLMDLTEELISGLVLEKPEMTERFELFVLGKELCNAYTELNEPLQQRKFFEQQADAKPPTGGWGLGIDRLIMFLADKNNIKEV.............. 507
19 -37.3001e1o_A mol:protein length:504 LYSYL-TRNA SYNTHETASE, HEAT INDUCIBLE  ali model follow..  18  113......KKWDLGDIIGARGTLFKTQTGELSIHCTELRLLTKALPDKFHGLQDQEVRYRQRYLDLIANDKSRQVRSKILAAIRQFMVARGFMEVETPMMQVI-----PGGASARPFITHHNALDLDMYLR------IAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYAD--YHDLIELTESLFRTLAQVNPEITDRFEFFIGGREIGNGFSELNDAEDQAERFQEQVNAKPPTAGLGIGIDRMIMLFTNSHTIRDV.............. 494
20 -37.2003a74_A mol:protein length:493 Lysyl-tRNA synthetase  ali model follow..  15  104......KISDLGDIVGVRGTMFKTKVGELSIKVSSYEFLTKALPEKYHGLKDIEQRYRQRYLDLIMNPESKKTRSLIIQSMRRYLDSHGYLEVETPMMHAV-----AGGAAARPFITHHNALDMTLYMR------IAIELHLKRLIVGGLEKVYEIGRVFRNEGISTRHNPEFTMLELYEAYAD--FRDIMKLTENLIAHIATDDPRFTDRFELFIVGREHANAFTELNDPIDQRQRFEEQLKERPPTGGLGIGVDRLVMLLTNSPSIRDV.............. 484
21 -37.1001bbu_A mol:protein length:504 PROTEIN (LYSYL-TRNA SYNTHETASE)  ali model follow..  18  113......KKWDLGDILGAKGKLFKTKTGELSIHCTELRLLTKALPDKFHGLQDQEARYRQRYLDLISNDESRNVRSQILSGIRQFMVNRGFMEVETPMMQVI-----PGGAAARPFITHHNALDLDMYLR------IAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYAD--YKDLIELTESLFRTLAQVNPEITDRFEFFIGGREIGNGFSELNDAEDQAQRFLDQVAAKPPTAGLGIGIDRMVMLFTNSHTIRDV.............. 494
22 -36.8004ex5_A mol:protein length:529 Lysine--tRNA ligase  ali model follow..  17  128......KKWDLGDIVAARGVLFRTNKGELSVKCTQLRLLAKALPDKFHGLADQETRYRQRYVDLIVTPETRTARTKAIASIRKFMGDADFMEVETPMLHPI-----PGGAAAKPFVTHHNALDMEMFLR------IAPELYLKRLIVGGFERVFEINRNFRNEGVSPRHNPEFTMMEFYAAYTD--YRWLMDFTERLIRQAAVTVAGITERFELFITGREIANGFSELNDPEDQAARFKKQVEQKPPTGGCGIGIDRLVMLLTDSPTIRDV.............. 513
23 -36.1006aqh_A mol:protein length:508 Lysine--tRNA ligase  ali model follow..  16  111.....KTYVDIGDIVFVHGEVITSKRGELSVLADSWQMAAKALPVAHKEM-SEESRVRQRYVDLIVRDQARKQRIAVMRAIRSALERRGFLEVETPMLQTL-----AGGAAARPFVTHSNALDTELYLR------IAPELFLKRCLVGGFERVFELNRVFRNEGADSTHSPEFVMLETYQAYGT--YDDSAVVTRELIQEVADEAIGTRQVPLPDGTVYDLDGEWESIQ----MYPSLSEALGEEITPDTPAETLWAIA.......................... 352
24 -35.9005vl1_A mol:protein length:506 Lysine--tRNA ligase  ali model follow..  17  108.....KADVDIGDVVYVHGTVISSRRGELSVLADSWRMAAKALPVAHKEM-SEESRVRQRYVDLIVRPQAREQRIAVIRAVRNALERRGFLEVETPMLQTL-----AGGAAARPFVTHSNALDIDLYLR------IAPELFLKRCIVGGFDRVFELNRVFRNEGSDSTHSPEFSMLETYQTYGT--YDDSALITRELIQEVADEAIGTRQLSMPDGSVYDIDGEWATME----MYSSLSEALGEQITPETTVARLRDIA.......................... 349
25 -35.8006chd_A mol:protein length:597 Lysine--tRNA ligase  ali model follow..  17  174......NKLRRGDIIGVQGNPGKTKKGELSIIPYEITLLSPCLPHLHFGLKDKETRYRQRYLDLILNDFVRQIRSKIITYIRSFLDELGFLEIETPMMNII-----PGGAVAKPFITYHNELDMNLYMR------IAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYAD--YHDLMEITEKMVSGMV-SKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKAKPPTAGWGMGIDRVAMFLTDSNNIKEV.............. 567
26 -35.3003hri_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  18  2..................................AMGTLEAQTQGPGSMQMNMVETEPVQGCRDFPPETMR-LRKYLFDVFHSTARKFGFEEYDSPVLESEELYRKAGEEITEQMFNFITKGGHRVALRPEMTPSLARQLLAKGRSLLLPAKWYSIPQCWRYEAITRGRRREHYQWNMDIIGVKSVSSEVECAACTAMQSLGLSSKDVG----------------VKINSRKILQTVVE----------QAGVSADKFAPVCVIVDKMEKLPREEVVAQLAAIGL 228
27 -35.3004ycv_A mol:protein length:516 Lysine--tRNA ligase  ali model follow..  18  107......DKIRRGDIVGIVGFPGKSKKGELSIFPKETILLSACL-PMKYGLKDTEIRYRQRYLDLLINESSRHTRTKIINFLRNFLNERGFFEVETPMMNLI-----AGGANARPFITHHNDLDLDLYLR------IATELPLKMLIVGGIDKVYEIGKVFRNEGIDNTHNPEFTSCEFYWAYAD--YNDLIKWSEDFFSQLVYTKPGLTERLEMFICGKEVLNAYTELNDPFKQKECFKLQQKDRPPTGGLGLGIDRITMFLTNKNSIKDV.............. 498
28 -34.9003hrk_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  17  2..................................AMGTLEAQTQGPGSMQKNMVETEPVQGCRDFPPEAMR-CRRHLFDVFHATAKTFGFEEYDAPVLESEELYRKAGEEITEQMFNFITKGGHRVALRPEMTPSLARLLLGKGRSLLLPAKWYSIPQCWRYEAITRGRRREHYQWNMDIVGVKSVSAEVECAACWAMRSLGLS................................................................................. 173
29 -34.4003od1_A mol:protein length:400 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  15  2...............................................NAMSKPFMFEKPFGMRDTLPEWYK-TKKNICDQMTEEINLWGYDMIETPTLEYYETVGVVSAILDQQLFKLLDQQGNTLVLRPDMTAPIARLVASSLKDRAYPLRLAYQSNVYRAQQNEGGKPAEFEQLGVELIGDGTASADGEALMIAALKRAGLSEFKVA............................................................................ 164
30 -32.9001wu7_A mol:protein length:434 Histidyl-tRNA synthetase  ali model follow..  14  2...................................................YRLQIEKIRGFRDFYPEDMD-VEKFIFKTAEEAAEAFGFRRIDFPSLEYLDLYIKSGEELLQQTYSFVDKGGREVTLIPEATPSTVRMVTSR-KDLQRPLRWYSFPKVWRYEEPQAGRYREHYQFNADIFGSDSPEADAEALASSILDRLGLQDIYE-----------------IRINSRKIMEEIIG------------GMTSSDPFSVFSIIDRYHKISREEFVDQLRSAGI 207
31 -32.8002el9_A mol:protein length:431 Histidyl-tRNA synthetase  ali model follow..  15  4...............................................YQDPMAKNIQAIRGMNDYLPGETA-IWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTKEMYTFEDRNGDSLTLRPEGTAGCVRAGIEHGLLYNQEQRLWYIGPMFRHERPQKGRYRQFHQLGCEVFGLQGPDIDAEMLTARWWRALGISEHVTLENRTVFEWVTNSLGSQGTVCAGGRYDGLVEQLGGRATPAVGFAMGLERLVLLVQAVN................... 327
32 -32.2004rdx_A mol:protein length:423 Histidine--tRNA ligase  ali model follow..  18  1...................................................GPMTARAVRGTKDLFGKELR-MHQRIVATARKVLEAAGALELVTPIFEETQVFEKGVGAATKEMFTFQDRGGRSLTLRPEGTAAMVRYLEHGMKVWPQPVRLWMAGPMFRAERPQKGRYRQFHQVNYEALGSENPILDAEVLLYECLKELGLRRLKVKLSSTAFEVHHEEIGAQSALGGGGRYDGLSELLGGPRVPGVGFAFGVERVALALEAEG................... 322
33 -32.1004e51_A mol:protein length:467 Histidine--tRNA ligase  ali model follow..  13  1..............................MAMGTLEAQTQGPGSMTEQKRKLEKLTGVKGMNDILPQDAG-LWEFFEATVKSLLRAYGYQNIRTPIVEHTPLFTRGIGEVTDIVEKEMYSFGENLTLRPENTAAVVRAAIEHNMLYDGPKRLWYIGPMFRHERPQRGRYRQFHQVGVEALGFAGPDADAEMMCQRLWEDLGLTGIKLEINSTVFEWVTDKLGAQGTVAAGGRYDPLIEQLGGKPTAACGWAMGIERILELLKEEHLVPEQEGVDVYV....... 353
34 -32.1003a5y_A mol:protein length:345 Putative lysyl-tRNA synthetase  ali model follow..  17  2................................................GSSSSGLVPRGSHMSETAS-PNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLVPFETRFVGPGHSQGMNLWLMTSPEYHMKRLL------VAGCGPVFQLCRSFRNEEMGRYHNPEFTMLEWYRPHYDMYMNEVDDLLQQVLAQISTEDHRVAERFEVYYKGIELANGFHELTDAREQQQRFEQDNRKRPDCSGVALGVDRLVMLALGAETLAEV.............. 331
35 -32.0003rac_A mol:protein length:373 Histidine-tRNA ligase  ali model follow..  13  1.................................SNAMNGTRSAWGARAWEAVRGFADRPPGMQDGYPDFAK-RRRAVETRLLSFVEDAGYEPVTSGLFEYVDTLRARSPESSRDWIRLFDGGGDAVALRPEMTPSIARMAAPRVAAGRTPIRWCYCERVYRRTSWASGKAAESTQVGIERIGEEASVMDVLRLLHEASAAAGVRHHR------------------IVVSHARLVP-RLLDALGISAS...................................... 204
36 -31.8001qe0_A mol:protein length:420 Histidine--tRNA ligase  ali model follow..  17  1......................................................MIKIPRGTQDILPEDSK-KWRYIENQLDELMTFYNYKEIRTPIFESTDLFARGVGDSTKEMYTFKDKGDRSITLRPEGTAAVVRSYIEHKGNPNQPIKLYYNGPMFRYERKQKGRYRQFNQFGVEAIGAENPSVDAEAMVMHIYQSFGLKHLKLVINFELMMDNPNYDGAITTLCGGGRYNGLLELLDGPSETGIGFALSIERLLLALEEEG................... 321
37 -31.7004up7_A mol:protein length:777 LYSINE--TRNA LIGASE  ali model follow..  17  104......KMIYRGDICGFTGHPTRTKTGELSLIPISGMILSPCLPSMHYGLGDQETRFRKRYLDLIVNPESVKLRTKVVKAVRKYLDDKGFLEVETPILNTI-----PGGATARPFITHHNQLDIQMYMR------IAPELYLKELVVGGINRVYEIGRLFRNEGIDQTHNPEFTTCEFYMAYAD--YNDIMKMTEELLGNMVKDITGGSTKLEIKDRLMDINNEEDIKMLEKFFKEP................................................ 327
38 -31.1003net_A mol:protein length:465 Histidyl-tRNA synthetase  ali model follow..  12  7..................................................NDKINFSTPSGFPEFLPSEKR-LELYLLDTIRRVYESYGFTPIETPAVERLEVLQAKGNQGDNEKDKSGDTGSEARALKFDQTVPLAAYIARHLNDLTFPFARYQMDVVFRGERAKDGRFRQFRQCDIDVVGRELYDAQMPAIITEIFEAVNIGDFV------------------IRINNRKVLTGFFQ----------SLNISETQIKSCISIIDNLEKIGEAKVKLELEKEGI 231
39 -31.0004g85_A mol:protein length:517 Histidine-tRNA ligase, cytoplasmic  ali model follow..  16  18....LEELVKLQGERVRGLKQQKASAELIEEEVAKLLKLKAQLGP--DESKQKFVLKTPKGTRDYSPRQMA-VREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAMNKLT---NIKRYHIAKVYRRDNPARGRYREFYQCDFDIAGNFDPMAECLKIMCEILSSLQIGDFLVKVN.......................................................................... 223
40 -30.9003g1z_A mol:protein length:326 Putative lysyl-tRNA synthetase  ali model follow..  18  15....................................................................PNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLFPFETRFVGPGHSQGINLYLMTSPEYHMKRLL------AAGCGPVFQLCRSFRNEEMGRHHNPEFTMLEWYRPHYDMYMNEVDDLLQQVLAQISTEDHRVAERFEVYYKGIELANGFHELTDAREQQQRFEQDNRKRPDCSGVALGVDRLVMLALGAESLADV.............. 318
41 -30.5005e3i_A mol:protein length:438 Histidine--tRNA ligase  ali model follow..  15  2...................................................AMSSIVAIKGFNDVLPTQTA-AWRRLEQHLASLMDAYGYQQIRLPIVEQTGLFKRAIGDATKEMYTFFDKGNESLTLRPEGTAGCVRALVEHNLLRGATPRVWYMGPMFRYEKPQKGRYRQFHQFGVETFGVATPDIDAEMLTARLWKRMGVDHMV.............................................................................. 164
42 -30.4004g84_A mol:protein length:464 Histidine--tRNA ligase, cytoplasmic  ali model follow..  18  6...............................................FELRRQFVLKTPKGTRDYSPRQMA-VREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAMNKLT---NIKRYHIAKVYRRDNPTRGRYREFYQCDFDIAGNFDPMAECLKIMCEILSSLQIGDFLVKVN.......................................................................... 170
43 -29.5001z7m_A mol:protein length:344 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  12  1........................................MRGSGSIEGRMEKINYLLPEESAEMTLNQVKS-LRQIEGRLRKLFSLKNYQEVMPPSFEYTQLYTALESNGKEKMFQFIKHEGQSITLRYDFTLPLVRLYSQIKD--STSARYSYFGKIFRKEKRHKGRSTENYQIGIELFGESADKSELESLALQVIEQLGLNKTVFE............................................................................ 172
44 -29.3003cmq_A mol:protein length:415 Phenylalanyl-tRNA synthetase, mitochondrial  ali model follow..  13  1................................MAAECATQRAPGSVVELLGKSYPQDDHSNLTRKLHNQQHHPLWLIKERVKEHFYKQYVGRFGTPLFSVYDNLSPVVTTWQNPADHPSRKKGDNYYLNRTHMLRAHTSAHQWDLLHAGLDAFLVVGDVYRRDQIDSQHYPIFHQLEAVRLAVKLVEFDLKQTLTRLMAHLFGDELEIRDCYFPFTHPINFHGEWLEVLGCGVMEQQLVNSAGAQDRGWAFGLGLERLAMILYDIPDIRLFWCEDERF....... 303
45 -27.7006FTT Entity 1(prereleased)  ali follow..  10  5...........................................................DGVADVLFEDAHK-QEVLRHQLTQQLITHGYQLVSPPMIEFTESLSGASEDLKRQTFKIIDQLTRLMGIRADITPQILRIDAHHGG--DGIARYCYAGDVIHTLPSGLFGSRTPLQLGAEIFGCESIAADIEDVLFSMINSLDMSAVLH-----------------VDLGHVTIFK-RLAELAALSASDTE--PELKQVCQVLPMGSDFYTL.............. 208
46 -27.7005m8h_A mol:protein length:388 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  10  5...........................................................DGVADVLFEDAHK-QEVLRHQLTQQLITHGYQLVSPPMIEFTESLSGASEDLKRQTFKIIDQLTRLMGIRADITPQILRIDAHHGG--DGIARYCYAGDVIHTLPSGLFGSRTPLQLGAEIFGCESIAADIEDVLFSMINSLDMSAVLH-----------------VDLGHVTIFK-RLAELAALSASDTE--PELKQVCQVLPMGSDFYTL.............. 208
47 -27.3003ig2_A mol:protein length:213 Phenylalanyl-tRNA synthetase beta chain  ali model follow..  17  1....................................................................SNADKSNKLQNLVAEQLVGCGFNEILNNSLTRAAYYDGLESYPSKNLVMLLNPLSADLCMRQTLLFGGLESIAHNANRKNADLKFFEFGNCYHFDAEKKNPEKEDYHLGLWVTGENTSVYELKAYVENIFKRLGLDLHSLVVGNLS-TALTVNTKGGKRLATFGVVTKKMLKAFDVDNEVYYADLNWKELM.......................... 213
48 -26.8003ica_A mol:protein length:213 Phenylalanyl-tRNA synthetase beta chain  ali model follow..  17  4.......................................................................DRRYKWQTVVSEQLVGAGFNEILNNSLTAGSYYEGLKSHPREMAVELMNPLSQELCMRQTLLFGGLETLSHNLRRKHLSLYLFEWGKCYRFHAAKRTDETEDDRLGIWICGEPTSVFELKAVVEQVLCRVGIETGAYTLKTA--SAMEVKTRSGKLLGTFGTVSTELIKRFEIEQPVYFAELLWDALM.......................... 213
49 -26.8004j15_A mol:protein length:521 Aspartate--tRNA ligase, cytoplasmic  ali model follow..  17  120......ANINKESIVDVEGVVRKVNQQDVELHVQKIYVISLAEPEEGRATVNQDTRLDNRVIDLRTSTAVFRLQSGICHLFRETLINKGFVEIQTPKIISAA-----SEGGANVFTVSYF--KNNAYLA------QSPQLYKQMCICADFEKVFSIGPVFRAEDSNTRHLTEFVGLDIEMAFNY-HYHEVMEEIADTMVQIFKGYTMPDPRNPKQSNSYDMFMRGEEILSGAQRIHDPQLHHGIDPPHAGGGIGLERVTMLFLGLHNVRQT.............. 503
50 -26.8003p8t_A mol:protein length:294 AsnS-like asparaginyl-tRNA synthetase related protein  ali model follow..  23  16.......................................................................DIQTKILDYMTKFFTDRGFKWLLPIMLSPITDPLWPDPAGEGIRPAEVDVYGVRMRL------THSMILHKQLAIAMGLEKIFVLSPNIRLESRRKRHSYEFTQLDFEIEGAK--MKDVMRLIEELIYGLFRKAEEWTGREFPRARHFKVYDGYGEVSSGGEREWEYEKRAGKLKPSAGAGIGVERLVRFIVGAKHIAEV.............. 281
51 -26.2001nnh_A mol:protein length:294 asparaginyl-tRNA synthetase-related peptide  ali model follow..  22  16.......................................................................DIQTKILEYMTDFFVKEGFKWLLPVIISPITDPLWPDPAGEGMEPAEVEIYGVKMRL------THSMILHKQLAIAMGLKKIFVLSPNIRLESRQKRHAYEFTQLDFEVERAK--MEDIMRLIERLVYGLFRKAEEWTGREFPKTKRFEVFEGYGEVASGGEREWEYEKKAGKLKPSAGAGIGVERLVRFIVGAKHIAEV.............. 281
52 -26.2001asy_A mol:protein length:490 ASPARTYL-tRNA SYNTHETASE  ali model follow..  15  113....KSATVQNLEIHITKIYTISETPEALPILLEDASRSEAEAEAAGLPVVNLDTRLDYRVIDLRTVTAIFRIQAGVCELFREYLATKKFTEVHTPKLLGAP-----SEGGSSVFE--VTYFKGKAYLA------QSPQFNKQQLIVADFERVYEIGPVFRAENSNTRHMTEFTGLDMEMAFEE-HYHEVLDTLSELFVFIFSEYTMPDPANPKYSNSYDFFMRGEEILSGAQRIHDHAKAHGLSPPHAGGGIGLERVVMFYLDLKNIRRA.............. 478
53 -25.8001efw_A mol:protein length:580 ASPARTYL-TRNA SYNTHETASE  ali model follow..  17  72..........KGLVRLRPEPNPRLATGRVEVELSALEVLAEAKTPPFEKEASEELRLKYRYLDLRRRRENLRLRHRVIKAIWDFLDREGFVQVETPFL-----TKSTPEGARDFLVPYRHEPGLFYALP------QSPQLFKQMLMVAGLDRYFQIARCFRDEDLRADRQPDFTQLDLEMSFVE--VEDVLELNERLMAHV.................................................................................... 261
54 -25.2001usy_A mol:protein length:275 ATP PHOSPHORIBOSYLTRANSFERASE REGULATORY SUBUNIT  ali model follow..  16  6..........................................................................FEKVFSFYSKATKKGFSPFFVPALEKAEEPA---------GNFFLDRKGNLFSIREDFTKTVLNHRKRYSP--DSQIKVWYADFVYRYSG---SDLVAEYQLGLEKVPRNSLDDSLEEIIVESASEFFEGPVIVEIGHTGVYEDL.................................................................. 138
55 -25.2001n9w_A mol:protein length:422 aspartyl-tRNA synthetase 2  ali model follow..  15  49....GLKLPLPESALRVRGLVVENAKGGLEVQAKEVEVLSPALEPKEEWRANPDTLLEYRYVTLRGEKAPLKVQAALVRGFRRYLDRQDFTEIFTPKVVR-------AGAEGGSGLFGVDYFEKRAYLA--QSPQLYKQI-----MVGVFERVYEVAPVWRMEHHTSRHLNEYLSLDVEMGFIA-DEEDLMRLEEALLAEMSVRPFYTYPEEDGTTRSFDLLFRGLEITSGGQRIHRYEKAKGMDPEAFGFAIGAERLTQKLLGLPNVRYA.............. 410
56 -25.0004rmf_A mol:protein length:609 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  16  69......AVTGVVEVRPEGNENPEIPTGQIEVNATELTVLGESLPFQLDEQAGEEARLKYRYLDLRREGNALRLRSKVNAAARSVLAEHDFVEIETPTL-----TRSTPEGARDFLVPARLQPGSFYALP------QSPQLFKQLLMVAGMERYYQIARCYRDEDFRADRQPEFTQLDMEMSFVE--ADDVIAISEQVLKAV-----------------WATIGYDLPLPLPRISYEEAMRRFGSDKPDLRFGIELVECT.......................... 295
57 -24.8001x54_A mol:protein length:434 Asparaginyl-tRNA synthetase  ali model follow..  18  64......KKLGRESSVIVEGIVKADEPGGAEVHVEKLEVIQAVSEPENPEQASPELLLDYRHLHIRTPKAIMKVKETLIMAAREWLLKDGWHEVFPPILVT-------GAVEGGATLFKLKYFDKYAYLSQSAQLYLEAAIFGLE-------KVWSLTPSFRAEKSRTRHLTEFWHLELEAAWMD--LWDIMKVEEELVSYMVQRTLELRKKRISYDEAIDILQGYGEIIGGSQREDDYDLEEGMDVPHSGFGLGVERLVAWVLKLDHIRWA.............. 422
58 -24.7001b8a_A mol:protein length:438 PROTEIN (ASPARTYL-TRNA SYNTHETASE)  ali model follow..  18  64......PKLRSEDVVAVEGVVNFTPKAKIVVLNRAETPLPLDPTGKVKAELDTRLNNRFMDLRRPEVMAIFKIRSSVFKAVRDFFHENGFIEIHTPKIIATA-----TEGGTELFPMKYF--EEDAFLA------ESPQLYKEIMMASGLDRVYEIAPIFRAEEHNTRHLNEAWSIDSEMAFIE-DEEEVMSFLERLVAHAINYYIMKYDNKPEICRAFDLEYRGVEISSGGQREHRHDKEKGLNPESFGFGLGAERLIKQMLDLPNIREV.............. 426
59 -24.7004o2d_A mol:protein length:620 Aspartate--tRNA ligase  ali model follow..  16  85......AVTGVVEVRPEGNENPEIPTGQIEVNATELTVLGESLPFQLDEQAGEEARLKYRYLDLRREGNALRLRSKVNAAARSVLAEHDFVEIETPTL-----TRSTPEGARDFLVPARLQPGSFYALP--QSPQLFKQL----LMVAGMERYYQIARCYRDEDFRADRQPEFTQLDMEMSFVE--ADDVIAISEQVLKAV-----------------WATIGYDLPLPLPRISYEEAMRRFGSDKPDLRFGIELVECTEYFKDTT................... 318
60 -24.6001wyd_A mol:protein length:429 hypothetical aspartyl-tRNA synthetase  ali model follow..  16  61......QELTQESVIQVRGIVKADKRAPITLLSKAKAPLPLDVSGKVKADIDTRLRERVLDLRRQEMQAVIKIQSLALKAFRETLYKEGFIEIFTPKIIASAT---EGGAQLFPVIYF----GKEAFLA--QSPQLYKEL-----MAGVVERVFEVAPAWRAEESDTPHLAEFISMDVEMAFAD--YNDVMQLLEKILHNIVKTYTKSKSENPELSESFDLIYKFLEIVSGSTRNHKREKKKGLKPESFGFGMGLARLMVMLTGIQSVKEI.............. 417
61 -24.6005w25_A mol:protein length:616 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  16  79......HRLRAEFCVSVAGVVEEIATGEIEVNATSLTVLGECLPFQLDEPAGEELRLKYRYLDLRRDDAAIRLRSRVNAAARAVLARHDFVEIETPTI-----TRSTPEGARDFLVPARLHPGSFYALP--QSPQLFKQL----LMVAGMERYYQIARCYRDEDFRADRQPEFTQLDMEMSFVD--AEDIIAISEEVLTEL-----------------WALIGYRIPTPIPRIGYAEAMRRFGTDKPDLRFGLELVECT.......................... 314
62 -24.6004wj3_M mol:protein length:599 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  15  64......DRVRSEFVVKITGKVRLRPSGSIEVLGYELEVLNQAETPPFYSDVGEETRLRYRFIDLRRPEAKLKLRARITSSIRRYLDDNGFLDVETPIL-----GRPTPEGARDYLVPSRTYPGHFFALP------QSPQLFKQLLMVAGFDRYYQIAKCFRDEDLRADRQPEFTQIDIETSFLD--ESDIIGITEKMVRQL-----------------FKEVLDVEFDEFPHMPFEEAMRRYGSDKPDLRIPLELVDVA.......................... 301
63 -24.1001eqr_A mol:protein length:590 ASPARTYL-TRNA SYNTHETASE  ali model follow..  16  61......SELRNEFCIQVTGTVRARATGEIEVLASSLTIINRALPLDSNHVNTEEARLKYRYLDLRRPEQRLKTRAKITSLVRRFMDDHGFLDIETPML-----TKATPEGARDYLVPSRVHKGKFYALP------QSPQLFKQLLMMSGFDRYYQIVKCFRDEDLRADRQPEFTQIDVETSFMT--APQVREVMEALVRHL.................................................................................... 255
64 -23.7003m4p_A mol:protein length:456 Asparaginyl-tRNA synthetase, putative  ali model follow..  16  77......KLLTRECSLEITGRLNAYAILNLEMQVTEWKVIGESLENIINKDSSIPQKMQNRHIVIRSEHQVLQLRSEIQWYFRKYYHDNHFTEIQPPTIVKTQ-----CEGGSTLFKLQYFNEPAYLTQSSQL---------YLESVIASLGKSFCMLSSYRAEQSRTVHLAEYLHLEAELPFIS--FEDLLNHLEDLVCTVIDNVMAVHGDRMTYADAIKYCND--EIVGGSMRIWNYDKANGLNPDPYGYGLGVERLVMWLLGEDHIRKV.............. 444
65 -23.4003i7f_A mol:protein length:548 Aspartyl-tRNA synthetase  ali model follow..  16  181.........VDEKIAKFLKDNEGKDLTKRPLKDEYAKLLKEKASAQKYVKVSQDTRLDNRMLDLRTVIAIFRIQSACCGLFREFLTSQKFVEIHTPKLIGCS-----SEGGSNIFEVKYF--DRKAYLA------QSPQLYKQMAIMGDFRKVFEVGPVFRAENSNTRHLTEFEGLDIEMEIVE-NYHECIDVMEKLFTFIFDEYTMPDIDDPNYSNSYDVFVRGQEITSGAQRIHDPEIEKGVDWPHAGCGIGLERITMLYLGIPNIRKV.............. 536
66 -23.4004h2w_A mol:protein length:346 Amino acid--[acyl-carrier-protein] ligase 1  ali model follow..  16  1.............MGSSSSGLVPRGSHMNIAVLPNSPDTAPQIADPLDHLADKLFHSMGSDGVYARTALYESIVERLAALITS-HREAGTEALRFPPVMSRAQLEKSGSRFDAGGDWTTSLSPADLVLSPAACYPVYPIAASRGPLPKGGLRFDVAADCFRRESKHLDRLQSFRMREYVCIGTPDDVERWMVRAQAIARDLGLTFRVDYASDPFFGRPLRSEEQPTACMSFNYHREHFGTTWGIQDA--CVAFGMDRLAVA........................ 304
67 -23.1005xix_A mol:protein length:472 Asparagine--tRNA ligase, cytoplasmic  ali model follow..  18  83CQCYNGVLLSTESSVAVYGMLNLTPKGKHELSCDFWELIGLAPAGGADNLIDVQLNNRHMMIRGENMSKILKARSMVTRCFRDHFFDRGYYEVTPPTLVQTQ-----VEGGATLFKLDYFGEEAFLTQSSQL---------YLETCLPALGDVFCIAQSYRAEQSRTRHLAEYTHVEAECPFLT--FDDLLNRLEDLVCDVVDRILKSPAGRMNYSDAIVWLKE--EIVGGSMRIFDSEKREGIDPTPYGYGLGLERFLTWILNRYHIRDV.............. 454
68 -22.8004ah6_A mol:protein length:617 ASPARTATE--TRNA LIGASE, MITOCHONDRIAL  ali model follow..  15  69......CEAPVESVVQVSGTVIKMPTGEIEIKVKTAELLNACKKLPFFVKKTEALRLQYRYLDLRSFQYNLRLRSQMVMKMREYLCNLGFVDIETPTL------FKRTPGGAKEFLVPSREPGKFYSLP------QSPQQFKQLLMVGGLDRYFQVARCYRDEGSRPDRQPEFTQIDIEMSFVD--QTGIQSLIEGLLQYS.................................................................................... 265
69 -22.7003mey_A mol:protein length:346 Bll0957 protein  ali model follow..  16  1.............MGSSSSGLVPRGSHMNIAVLPNSPDTAPQIADPLDHLADKLFHSMGSDGVYARTALYESIVERLAALITS-HREAGTEALRFPPVMSRAQLEKSGSRFDAGGDWTTSLSPADLVLSPAACYPVYPIAASRGPLPKGGLRFDVAADCFRRESKHLDRLQSFRMREYVCIGTPDDVERWMVRAQAIARDLGLTFRVDYASDPFFGRPLRSEEQPTACMSFNYHREHFGTTWGIQDA--CVAFGMDRLAVA........................ 304
70 -22.5002xti_A mol:protein length:437 ASPARAGINYL-TRNA SYNTHETASE, CYTOPLASMIC, PUTATIVE  ali model follow..  14  53CQTYDALTVNTECTVEIYGAIKEVPEGKEAPNGHELIADFWKIDNVLNEEASVDKMLDNRHLVIRGENALLRLRAAATRAMREHFYNAGYVEVAPPTLVQTQ-----VEGGSTLFNLDYF--GEQSFLTQSSQLYLETCIPTLG-------DVFCIAQSYRAESRTRRHLAEYAHVEAECPFIT--LDDLMEKIEELVCDTVDRYMQRDAKDNTLTESVDLLMPGVEIVGGSMRIWKFDKNVEIDPKPYGYGLGLERFICWLTNTNHIRDV.............. 425
71 -21.5003l4g_B mol:protein length:589 Phenylalanyl-tRNA synthetase beta chain  ali model follow..  13  355.........................RADIIHACDIVEDAAIAYG--YNNIQMTLPKTYTIA--------NQFPLNKLTELLRHDMAAAGFTEALTFALCSQEDIADK-DISATKAVHISNPKTAEFVARTTLLPGLLKTIAANRKM-PLPLKLFEISDIVIKDSNTDVGAKNYRHLCAVYYNKNPGFEIIHGLLDRIMQLLDVPPGEDKGGYVI-GRCAEIFARGQSVGKLGVLHPDVITKFELTMPCSSLEINIGPFL.......................... 589
72 -19.5004lns_A mol:protein length:351 Asparagine synthetase a  ali model follow..  10  11....................................................................LLQEQILTVKRSFSEALEKENLVEVRAPILFRVGDGTQDNLSGFEKAVQVPVKAIPNASFEVVHSLAKWKRRTLANYKFAPGHGLYTHMTALRVDVLDNIHSVVVDQWDWEMVDDQRNLAFLKEVVCKVYAAIRKTELAVCEKYKQKPILPPTLDDSLEVSSMGI-AEALRHQISLTPQTVGGGIGQSRMVMFMLRKKHIGEVQCS........... 338
73 -18.80011as_A mol:protein length:330 ASPARAGINE SYNTHETASE  ali model follow..  12  7....................................................................AKQRQISFVKSHFSRQLEERGLIEVQAPILSRVGDGTQDNLSGAEKAVQVKVKALPDAQFEVVHSLAKWKRQTLGQHDFSAGEGLYTHMKALRPDELSPLHSVYVDQWDWERVDGERQFSTLKSTVEAIWAGIKATEAAVSEEF--ILVWNPVLEDAFELSSMGVDADTLKHQLALTPQTIGGGIGQSRLTMLLLQLPHIGQVQAG........... 316
74 -18.5002cim_A mol:protein length:522 SERYL-TRNA SYNTHETASE  ali model follow..  16  222.......................................................................PQSARIFRTFEKIVLEEGYREMIFPKLVTWEVWMKSGTHEVPTKLIKEKIAEPIGGMCYAQCPPFWMYVAGETLPNEEPVKVFDRGTSHRYESHGIERVDEFHRIEIVWIGTKEEVLKLHDRYMHIFNDILDENTVGTTDYEACLPYRGPDGEWLEFQNVSINGDKYPKGFNVKLQ--CSGVGLERWAAV........................ 486
75 -17.4002i4l_A mol:protein length:458 Proline-tRNA ligase  ali model follow..  13  2.............GSSSSGLVPRGSHMRLSRFLPILKENPKEAEIVSHRLMLRMLRQEAAGIYAWLPLGHR-VLKKIEQIVREEQNRAGAIELLMPTLQLADLWRESGDAYGPEMLRIADRHKRELLYGPTNEEMITEIFRAYIKSYKSPLNLYHIQWKFRDEQRPRFRGREFLMKDAYSFDVDEAGARMFVAYLRTFARMGLKAIPMRAET......................................................................... 213

FFAS is supported by the NIH grant R01-GM087218-01
1 2 6 4 9 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Godzik A. Fragnostic: walking through protein structure space. Nucleic Acids Res. 2005 Jul 1;33(Web Server issue):W249-51.