current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 4zhe_A mol:protein length:209 ASPR2 protein, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .
# Score Template Links and tools%idFirst MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEEKVHAGEWDEVEKYLSGFTKVDDNRYSMKIFFEIRKQKYLEALDRHDRAKAVDILVKDLKVFSTFNEELYKEITQLLTLENFRENEQLSKYGDTKSARSIMLIELKKLIEANPLFREKLVFPTLKASRLRTLINQSLNWQHQLCKNPRPNPDIKTLFTDHTCTPPNGLast
1 -88.3004zhe_A mol:protein length:209 ASPR2 protein  ali model  100  1MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEEKVHAGEWDEVEKYLSGFTKVDDNRYSMKIFFEIRKQKYLEALDRHDRAKAVDILVKDLKVFSTFNEELYKEITQLLTLENFRENEQLSKYGDTKSARSIMLIELKKLIEANPLFREKLVFPTLKASRLRTLINQSLNWQHQLCKNPRPNPDIKTLFTDHTCTPPNG 209
2 -87.4005jgc_A mol:protein length:209 Protein TPR1  ali model follow..  98  1MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEEKVHAGEWDEVEKYLSGFTKVDDNRYSMKIFFEIRKQKYLEALDRHDRAKAVDILVKDLKVFSTFNEEAYKEITQLLTLENFRENEQASKYGDTKSARSIMLIELKKLIEANPLFREKLVFPTLKASRLRTLINQSANWQHQLCKNPRPNPDAKTLFTDHTCTPPNG 209
3 -73.2005nqs_A mol:protein length:210 Protein TOPLESS  ali model follow..  92  21MGSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDEVEKYLSGFTKVDDNRYSMKIFFEIRKQKYLEALDKHDRPKAVDILVKDLKVFSTFNEELFKEITQLLTLENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPTLRNSRLRTLINQSLNWQHQ......................... 204
4 -57.1005en6_A mol:protein length:184 SMU-1  ali model follow..  19  7IEIESSDVIRLIEQFLKESNLHRTLAILQEETNVSLNIDGFCNEITSGNWDNVLKTVQSLKL------PAKKLIDLYEHVIIELVELRELATARLVARQTDPMILLKQIDPDRFARLESLINRPYFDGQEVYGDSKEKRRSVIAQTLSSEVH------------VVAPSRLLSLLGQSLKWQLHQGLLP.................... 182
5 -36.8005o9z_L mol:protein length:513 WD40 repeat-containing protein SMU1  ali model follow..  20  3IEIESSDVIRLIMQYLKENSLHRALATLQEETTVSLNIESFVADINSGHWDTVLQAIQSLKL------PDKTLIDLYEQVVLELIELRELGAARSLLRQTMIMLKQTQPERYIHLENLLARSYFDPREAYPDGSSKEKRRAAIAQALAGEV-------------VVPPSRLMALLGQALKWQQHQGLLPP................... 180
6 -14.9002xtc_A mol:protein length:90 F-BOX-LIKE/WD REPEAT-CONTAINING PROTEIN TBL1X  ali model follow..  14  1MSITSDEVNFLVYRYLQESGFSHSAFTFGIESHISQSNIALISILQKGLQYVEAEISINEDGTVFDGRPIE-SLSLIDAVMPD.............................................................................................................................. 90
7 -11.2001uuj_A mol:protein length:88 PLATELET-ACTIVATING FACTOR ACETYLHYDROLASE IB ALPHA SUBUNIT  ali model follow..  14  7.QRQRDELNRAIADYLRSNGYEEAYSVFKKEAELDMELDKKYAGLLEKKWTSVIRL......................................................................................................................................................... 63
8 -7.7502qko_A mol:protein length:215 Possible transcriptional regulator, TetR family protein  ali model follow..  11  21.PERRAALVNAAIEVLAREGARGTFRAVDVEANVPKGTASNRDDLFDQVGKRIHERLGPDPSVVEESGRKPQNLELAIEYMQGLFGRITRDRTGYLALQELRLEAVRRPELRTTLTRTISENLKRDIGFHLDSGLPGRSTVLMLYLAMNALIVEHLTLPGVLEGVDTERLVADLVTRAV.............................. 204
9 -7.3702nx4_A mol:protein length:194 Transcriptional regulator, TetR family protein  ali model follow..  10  9.DERRRSITAAAWRLIAARGIEANMRDIATEAGYTNGALS-KDEILRTSYEHISEAT--------------------DRRIAEALGDATGLDALRILCREVMPINEEQLLEARIAASLWPRAMYDEQMAATNRRTMDNWREQMAIFLEQAREEGSVGDIDVTIVV---EQLLNMMM................................. 165
10 -7.1702r5s_A mol:protein length:176 Uncharacterized protein VP0806  ali model follow..  7.....EQLLKQVSELLQQGEHAQALNVIQTQSRGDVKLAKADCLLETKQFELAQELLATIPLEYQDNSYKSLIAKL------ELHQQAAESPELKRLEQELAANPDNFELACELAVQYNQVGRDEEA-KVNLGAQDGEVKKTFMDILSALGQGNAIASK--------RRQLYSIL.................................. 175

FFAS is supported by the NIH grant R01-GM087218-01
1 3 0 5 6 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Tolerating some redundancy significantly speeds up clustering of large protein databases. Bioinformatics. 2002 Jan;18(1):77-82.