current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 5d8e_A mol:protein length:115 SOSS complex subunit B1, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .
# Score Template Links and tools%idFirst MTTETFVKDIKPGLKNLNLIFIVLETGRVTKTKDGHEVRTCKVADKTGSINISVWDDVGNLIQPGDIIRMTKGYASVFKGCLTLYTGRGGDLQKIGEFCMVYSEVPNFSLast
1 -59.8005d8e_A mol:protein length:115 SOSS complex subunit B1  ali model  100  1MTTETFVKDIKPGLKNLNLIFIVLETGRVTKTKDGHEVRTCKVADKTGSINISVWDDVGNLIQPGDIIRMTKGYASVFKGCLTLYTGRGGDLQKIGEFCMVYSEVPNFS 109
2 -51.7001wjj_A mol:protein length:145 hypothetical protein F20O9.120  ali model follow..  24  14.PVFVKVEQLKPGTTGHTLTVKVIEANIVVPVSQPSRIVECLIGDETGCILFTARNDQVDLMKPGATVILRNSRIDMFKGTMRLGVDKWGRIEATGAASFTVKEDNNLS 134
3 -46.3002mna_A mol:protein length:117 Single-stranded DNA binding protein (SSB)  ali model follow..  20  3....EKVGNLKPNMESVNVTVRVLEASEARQINGVRTISEAIVGDETGRVKLTLWGKHAGSIKEGQVVKIENAWTTAFKGQVQLNAGSKTKIAEASEDG--FPESSQIP 108
4 -45.6001o7i_A mol:protein length:119 SINGLE STRANDED DNA BINDING PROTEIN  ali model follow..  20  3....EKVGNLKPNMESVNVTVRVLEASEARQINGVRTISEAIVGDETGRVKLTLWGKHAGSIKEGQVVKIENAWTTAFKGQVQLNAGSKTKIAEASEDGFPESSQ.... 106
5 -42.6002k75_A mol:protein length:106 uncharacterized protein Ta0387  ali model follow..  18  1.SDLVKIRDVSLSTPYVSVIGKITGIHKKEYESDGTSVYQGYIEDDTARIRISSFGKQ---LQDSDVVRIDNARVAQFNGYLSLSVGDSSRIESVNVNIPL........ 99
6 -42.1002kbn_A mol:protein length:109 Conserved protein  ali model follow..  16  3.PQLTKIVDIVENGQWANLKAKVIQLWEN---THESISQVGLLGDETGIIKFTIWKNAEPLLEQGESYLLRSVVVGEYNDRFQVQVNKNSSIEKLSEPIEVGLE..... 103
7 -39.9004owt_B mol:protein length:211 SOSS complex subunit B1  ali model follow..  99  1MTTETFVKDIKPGLKNLNLIFIVLETGRVTKTKDGHEVRTCKVADKTGSINISVWDDVGNLIQPGDIIRLTKGYASVFKGCLTLYTGRGGDLQKIGEFCMVYSEVPNFS 109
8 -37.7003dm3_A mol:protein length:105 Replication factor A  ali model follow..  18  2IKDTYNIGELSPGMT-ATFEGEVISALPIKEFGSIGKLKSFIVRDETGSIRVTLWDNLTDIVGRGDYVRVRGYIREGYYGGLECTANYVEILKKGEK............ 102
9 -35.6002k5v_A mol:protein length:104 Replication protein A  ali model follow..  19  3....YKISELMPNLS-GTINAEVVAAYPKKEFGTKGQLKSLFLKDDTGSIRGTLWNELADFVKKGDIAEV-SGYVKQGYSGLEISVDNIGIIEKSLE............ 98
10 -33.9003e0e_A mol:protein length:97 Replication protein A  ali model follow..  18  2...NYKISELMPNLS-GTINAEVVTAYPKKEFGTKGQLKSLFLKDDTGSIRGTLWNELADFVKKGDIAEV-SGYVKQGYSGLEISVDNIGIIEKS.............. 96
11 -33.4002k50_A mol:protein length:115 Replication factor A related protein  ali model follow..  14  6..RMDTISKLEEGAE-TPVTGRVMKISSPRTFGREGKLANVIIADDTGELRAVFWTENIKLFREGDVIRIKDVNIRGFGGRKEAHLMPRSTVEVLDPLE.......... 109
12 -28.7004jbm_A mol:protein length:193 Interferon-inducible protein AIM2  ali model follow..  18  95.RETPRISKLKIQPCGTIVNGLFK----VQKITEEKDRVLYGIHDKTGTMEVLVLGNPSKTCEEGDKIRLTFFEVSKNGVKIQLKSGPCSFFKVIKAA........... 188
13 -27.8002oq0_A mol:protein length:206 Gamma-interferon-inducible protein Ifi-16  ali model follow..  112.KETLKIDILHKQASGNIVYGVFMLHKK----TVNQKTTIYEIQDDRGKMDVVGTGQCHNICEEGDKLQLFCFRLRKKNQMSKLISEMHSFIQIKKK............ 204
14 -27.4003rn2_A mol:protein length:208 Interferon-inducible protein AIM2  ali model follow..  15  108.GETPKINTLQTQPLGTIVNGLFV----VQKVTEKKKNILFDLSDNTGKMEVLGVRNEDTMCKEGDKVRLTFFTLSKNGEKLQLTSGVHSTIKVIKA............ 200
15 -25.5004l5t_A mol:protein length:203 Interferon-activable protein 202  ali model follow..  15  109.IEHLKICDLHLQTEE----RLVDGEFKVYRKSSGNNCICYGIWDDTGAMKVVVSGQLTSVCEIGNTIRLVCFELTSNADEWFLRATRYSYMEVIMP............ 201
16 -25.2001ynx_A mol:protein length:114 Replication factor-A protein 1  ali model follow..  12  2.RPIFAIEQLSPYQNVWTIKARVSYKGEIKTWHNQRKLFNVNFLDTSGEIRATAFNDFATKLQEGKVYYVSKAKLTNLTHPYELNLDRDTVIEECFDES.......... 113
17 -24.6001fgu_A mol:protein length:252 REPLICATION PROTEIN A 70 KDA DNA-BINDING SUBUNIT  ali model follow..  10  1MSKVVPIASLTPYQSKWTICARVTNKSQIRTWSNSRKLFSLELVDESGEIRATAFNEQVDKIEVNKVYYFSKGTLTAVKNDYEMTFNNETSVMPCEDDHHLPTVQFDFT 123
18 -22.3004jbj_A mol:protein length:198 Interferon-activable protein 202  ali model follow..  16  109.KETLKISKIKELDSGTLIYG----VFAVEKKKVNDKSITFKIKDNEDNIKVVWDKEQHNIYEKGDKLQLFSFHLRKGNGKPILHSGNHSFIK................ 197
19 -21.8004l5q_A mol:protein length:199 Interferon-activable protein 202  ali model follow..  16  109.KETLKISKIKELDSGTLIYGVFA----VEKKKVNDKSITFKIKDNEDNIKVVWDKEQHNIYEKGDKLQLFSFHLRKGNGKPILHSGNHSFIKG............... 198
20 -21.4004lnq_A mol:protein length:197 Interferon-activable protein 202  ali model follow..  16  105.KETLKISKIKELDSG----TLIYGVFAVEKKKVNDKSITFKIKDNEDNIKVVWDKEQHNIYEKGDKLQLFSFHLRKGNGKPILHSGNHSFIKGEK............. 196
21 -21.1001jmc_A mol:protein length:246 PROTEIN (REPLICATION PROTEIN A (RPA))  ali model follow..  6.SKVVPIASLTPYQSKWTICARVTNKSQIRTWSNSRKLFSLELVDESGEIRATAFNEQVDKIEVNKVYYFSKGTLTAVKNDYEMTFNNETSVMPCEDDHHLPTVQFDFT 127
22 -19.7004gnx_C mol:protein length:444 Putative uncharacterized protein  ali model follow..  10  2..PIYPIEGLSPYQNRWTIKARVTSKSDIRHWSNQRKLFSVNLLDDSGEIKATGFNDAVDRLQENHVYLISKARVSNLQNEYEITFENSTEIEECTDATDVPEVKYEFV 122
23 -18.1003kjo_A mol:protein length:299 Protection of telomeres protein 1  ali model follow..  15  10..IYTPLNQLKGGTI-VNVYGVVKFFKPPYLSKGTDYCSVVTIVDQTNVLTCLLFSGNYEALKNGDIVRFHRLKIQVYKKETQGITSSGFASLTFEGTLGAPIIPRTSS 120
24 -17.0001jb7_A mol:protein length:495 telomere-binding protein alpha subunit  ali model follow..  13  37..EYVELAKASLTSAQQHFYAVVIDATFPYKTNQERYICSLKIVDPTDYATLVLYAKRFEDLRAGDIIRVHRATLRLYNGQRQFNANVFYS.................. 143
25 -16.8006d6v_D mol:protein length:701 Telomerase-associated protein 82  ali model follow..  211.KQTLLISQLQVGKNRFKFEGRVVYKSSTFQNQQDSKYFFITAQDANNQEINLSFWQKVDQLKVGQYYYFIGGEVKQFKNDYQIIPKETLSANYVQP............ 321
26 -15.2001qzg_A mol:protein length:187 Protection of telomeres protein 1  ali model follow..  15  30..QSIRSSQELQKKNTVNLFGIVKDFTPSRQSLHGTKVTTVYLWDPT-GLQIHLFSKQGNDLQVGQPLLLHQITLRSYRDRTQGLSKDQFRYALWPDFS.......... 138
27 -12.6003kf6_A mol:protein length:159 Protein stn1  ali model follow..  10  48..............RWIQIVGYIAAIDIYEGK------HVLTVDDCSGMVLRVVFSKRAISMSPGNVVCVF-GKINSFRSEVELIAQSFEELRDPNDEWKAWQKRMRYK 143
28 -12.6004joi_A mol:protein length:166 CST complex subunit STN1  ali model follow..  18  37..............KQVDVLGTVIGVRERDAF------YSYGVDDSTGVINCICWKKLKTKIEIGDTIRVR-GSIRTYREEREIHATTYYKVD................ 138
29 -12.5004gnx_B mol:protein length:136 Putative uncharacterized protein  ali model follow..  15  37..............GQLTFVAVVRNI------SRNATNVAYSVEDGTGQIEVRQWSSKASEIRNNVYVRVL-GTLKSFQNRRSISSGHMRPVIDYNEVMFHRLEAVHAH 131
30 -12.5003nbh_B mol:protein length:147 RecQ-mediated genome instability protein 2  ali model follow..  14  56..............AAVWMQGRVVMADRG----------EARLRDPSGDFSVRGLERGRPCLVPGKYVMVM-GVVQACSPEPCLQAVKMTDLS................ 126
31 -12.4003f2b_A mol:protein length:1041 DNA-directed DNA polymerase III alpha chain  ali model follow..  12  5.EPVRRLETIVEEERRVVVQGYVFDA-EVSELKSGRTLLTMKITDYTNSILVKMFAELMSGVKKGMWVKVRGVQNDTFVRDLVIIANDLNEIAANERQDTAPEGEKRVE 118
32 -12.2003mxn_B mol:protein length:150 RecQ-mediated genome instability protein 2  ali model follow..  14  59..............AAVWMQGRVVMADRG----------EARLRDPSGDFSVRGLERGRPCLVPGKYVMVM-GVVQACSPEPCLQAVKMTDLS................ 129
33 -12.2002pi2_A mol:protein length:270 Replication protein A 32 kDa subunit  ali model follow..  10  49....CTISQLLSATSQVTIVGIIRHA------EKAPTNIVYKIDDMTAAPMDVRQSSENTVVPPETYVKVA-GHLRSFQNKKSLVAFKIMPLEDMNE............ 154
34 -11.8004hid_A mol:protein length:143 Protection of telomeres protein 1  ali model follow..  19  3.DSFSLLSQITPHQ--CSFYAQVIKTWY------SDKNFTLYVTDYTENIRCILWDEHDNYIKEGDYVVMKNVRTKIDHGYLECILHGDSSIEKVDSEEPELNE..... 132
35 -11.6003kf8_A mol:protein length:220 Protein stn1  ali model follow..  86..............NQINIFGKIVYEQEKEFNGVEESYVILVISDFIGIDSKIRVGLTLDKKNYGKIVELE-GEIYNWYDSINVSKKPDRELK................ 175
36 -10.3001nnx_A mol:protein length:109 Protein ygiW  ali model follow..  15  23.GSVTTVESAKSLRDDVTLRGNIVERISDD---------LYVFKDASGTINVDIDHKRWNTVTPKDTVEIQ-GEVDKDWNSVEIDVKQIRKVN................ 108
37 -9.9204gs3_A mol:protein length:107 Single-stranded DNA-binding protein  ali model follow..  4......MAGNFLENNTVTLVGKVFTPLEFSHELYGEKFFNFILEETKDYLPITISNRLFEGLEVGTRVKIEG..................................... 76
38 -9.7503u58_A mol:protein length:213 Tetrahymena Teb1 AB  ali model follow..  16  9.KQTLLISQLQVGKNRFSFKGRVVYKSSTFQNQQDSKYFFITAQDANNEINLSFWDQSYQTLKVGQYYYFIGGEVKQFKNNLELKF....................... 99
39 -9.7001x54_A mol:protein length:434 Asparaginyl-tRNA synthetase  ali model follow..  13  1MIEKVYCQEVKPELDGKKVRLA----GWVYTNMRVGKKIFLWIRDSTGIVQAVV--EKAKKLGRESSVIVEGIVKAD-PGGAEVHVEKLEVIQAVSE............ 103
40 -9.3801b8a_A mol:protein length:438 PROTEIN (ASPARTYL-TRNA SYNTHETASE)  ali model follow..  15  1MYRTHYSSEITEELNGQKVKVA----GWVWEVKDLGGIKFLWIRDRDGIVQITA--KLIPKLRSEDVVAVEGVVNFTPKAKLGFEI....................... 90
41 -9.1401wyd_A mol:protein length:429 hypothetical aspartyl-tRNA synthetase  ali model follow..  17  1MYRSHFIADVTPEYDGKEVIWA----GWVHLLRDLGGKKFIILRDKTGLGQVVVDKNSSQELTQESVIQVRGIVKAD-PRGIELHAEEITLLSKAKA............ 100
42 -9.0306bwy_A mol:protein length:361 Protection of telomeres protein 1, DNA dC->dU-editing enzyme APOBEC-3G fusion  ali model follow..  14  25..QSIRSSQELQKKNTVNLFGIVKDFTPSRQSLHGTKVTTVYLWDPTIGLQIHLFSKQGNDLQVGQPLLLHQITLRSYRDRTQGLSKDQFRYALWPD............ 131

FFAS is supported by the NIH grant R01-GM087218-01
1 2 9 7 3 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Zhi D, Krishna SS, Cao H, Pevzner P, Godzik A. Representing and comparing protein structures as paths in three-dimensionalspace. BMC Bioinformatics. 2006 Oct 20;7:460.