current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 5e3i_A mol:protein length:438 Histidine--tRNA ligase, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430
# Score Template Links and tools%idFirst MAMSSIVAIKGFNDVLPTQTAAWRRLEQHLASLMDAYGYQQIRLPIVEQTGLFKRAIGDATDIVEKEMYTFFDKGNPPESLTLRPEGTAGCVRALVEHNLLRGATPRVWYMGPMFRYEKPQKGRYRQFHQFGVETFGVATPDIDAELIMLTARLWKRMGVDHMVQLELNTLGETDERTEYRNALVAFLNEHKDALDEDSQRRLTTNPLRILDSKIESTQKILENAPKLHDFLKEDSLSHFQQLQDYLTAAGIKFVINQKLVRGLDYYNKTVFEWTTTALGSQGTVCAGGRYDGLVGQLKGKADQSVPAVGFAMGMERLLLLLEQVEQAEIVRDCEAFLVAEPAYQSKALVLAEQLRDQLEAANSNIRIKTGSQGSMKSQMKKADQAGAVYAIILGEREWEAQQLAVKELATAEQSQVALAELVPFLIEKFTKLast
1 -141.0005e3i_A mol:protein length:438 Histidine--tRNA ligase  ali model  100  1MAMSSIVAIKGFNDVLPTQTAAWRRLEQHLASLMDAYGYQQIRLPIVEQTGLFKRAIGDATDIVEKEMYTFFDKGNPPESLTLRPEGTAGCVRALVEHNLLRGATPRVWYMGPMFRYEKPQKGRYRQFHQFGVETFGVATPDIDAELIMLTARLWKRMGVDHMVQLELNTLGETDERTEYRNALVAFLNEHKDALDEDSQRRLTTNPLRILDSKIESTQKILENAPKLHDFLKEDSLSHFQQLQDYLTAAGIKFVINQKLVRGLDYYNKTVFEWTTTALGSQGTVCAGGRYDGLVGQLKGKADQSVPAVGFAMGMERLLLLLEQVEQAEIVRDCEAFLVAEPAYQSKALVLAEQLRDQLEAANSNIRIKTGSQGSMKSQMKKADQAGAVYAIILGEREWEAQQLAVKELATAEQSQVALAELVPFLIEKFTK 432
2 -126.0001qe0_A mol:protein length:420 Histidine--tRNA ligase  ali model follow..  39  2.....IKIPRGTQDILPEDSKKWRYIENQLDELMTFYNYKEIRTPIFESTDLFARGVGDSTDVVQKEMYTFKDKGD--RSITLRPEGTAAVVRSYIEHKMNPNQPIKLYYNGPMFRYERKQKGRYRQFNQFGVEAIGAENPSVDAEVLAMVMHIYQSFGLKH-LKLVINSVGDMASRKEYNEALVKHFEPVIHEFCSDCQSRLHTDPMRILDCKVDRDKEAIKTAPRITDFLNEESKAYYEQVKAYLDDLGIPYTEDPNLVRGLDYYTHTAFELMMDNPNAITTLCGGGRYNGLLELLDGP---SETGIGFALSIERLLLALEEEGIELEENLDLFIVTMGDQADRYAVKLLNHLRHNGIKADKDYL-----QRKIKGQMKQADRLGAKFTIVIGDQELENNKIDVKNMTTGESETIELDALVEYFKK.... 420
3 -121.0004rdx_A mol:protein length:423 Histidine--tRNA ligase  ali model follow..  36  1.GPMTARAVRGTKDLFGKELRMHQRIVATARKVLEAAGALELVTPIFEETQVFEKGVGAATDIVRKEMFTFQDRGG--RSLTLRPEGTAAMVRAYLEHGMVWPQPVRLWMAGPMFRAERPQKGRYRQFHQVNYEALGSENPILDAEAVVLLYECLKELGLRR-LKVKLSSVGDPEDRARYNAYLREVLSPHREALSEDSKERLELNPMRILDSKSERDQALLKGVRPMLDFLGEEARAHLKEVERHLERLSVPYELEPALVRGLDYYVRTAFEVHHEEIGAQSALGGGGRYDGLSELLGGP---RVPGVGFAFGVERVALALEAEGFGLEKGPDLYLIPLTEEAVAEAFYLAEALR-PRLRAEYALA-----PRKPAKGLEEALKRGAAFAGFLGEDELRAGEVTLKRLATGEQVRLSREEVPGYLLQALG. 423
4 -121.0002el9_A mol:protein length:431 Histidyl-tRNA synthetase  ali model follow..  54  9..AKNIQAIRGMNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTDVVEKEMYTFEDRNG--DSLTLRPEGTAGCVRAGIEHGLLYNQEQRLWYIGPMFRHERPQKGRYRQFHQLGCEVFGLQGPDIDAELIMLTARWWRALGISEHVTLELNSIGSLEARANYRDALVAFLEQHKEKLDEDCKRRMYTNPLRVLDSKNPEVQALLNDAPALGDYLDEESREHFAGLCKLLESAGIAYTVNQRLVRGLDYYNRTVFEWVTNSLGSQGTVCAGGRYDGLVEQLGGR---ATPAVGFAMGLERLVLLVQAVNPEFKPVVDIYLVASGADTQSAAMALAERLRDELPGVKLMTNH---GGGNFKKQFARADKWGARVAVVLGESEVANGTAVVKDLRSGEQTAVAQDSVAAHLRTLLG. 431
5 -116.0004e51_A mol:protein length:467 Histidine--tRNA ligase  ali model follow..  48  22.KLEKLTGVKGMNDILPQDAGLWEFFEATVKSLLRAYGYQNIRTPIVEHTPLFTRGIGEVTDIVEKEMYSFVDALNG-ENLTLRPENTAAVVRAAIEHNMLYDGPKRLWYIGPMFRHERPQRGRYRQFHQVGVEALGFAGPDADAEIVMMCQRLWEDLGLTG-IKLEINSLGLAEERAAHRVELIKYLEQHADKLDDDAQRRLYTNPLRVLDTKNPALQEIVRNAPKLIDFLGDVSRAHFEGLQRLLKANNVPFTINPRLVRGLDYYNLTVFEWVTDKLGAQGTVAAGGRYDPLIEQLGGK---PTAACGWAMGIERILELLKEEHLVPEEGVDVYVVHQGDAAREQAFIVAERLRDTGLDVILHCSADG-AGASFKSQMKRADASGAAFAVIFGEDEVTNGTASVKPLEKSVQQSVPVESLTEFLINAMVA 454
6 -109.0001wu7_A mol:protein length:434 Histidyl-tRNA synthetase  ali model follow..  25  1MYRLQIEKIRGFRDFYPEDMDVEKFIFKTAEEAAEAFGFRRIDFPSLEYLDLYRIKSGEE---LLQQTYSFVDKGG--REVTLIPEATPSTVRMVTSRK-DLQRPLRWYSFPKVWRYEEPQAGRYREHYQFNADIFGSDSPEADAEVIALASSILDRLGLQDIYEIRINSRKIMSDPFSVFSIIDRYHKISREEFVDQRSAGIGEDGVSMIADLCSGTRGIDEMAR--ITGKSSEEIARMAAVEDLLASYGVKVRYDFSIVRGLSYYTGIVFEAYDRS-GQFRAILGGGRYDNLASLMSGE---SVPAVGFGMGDAVISLLLKRENVQIPEKKSVYICRVGKINSSIMNEYSRKLRERGMNVTVEIM-----ERGLSAQLKYASAIGADFAVIFGERDLERGVVTIRNMYTGSQENVGLDSVVEHLISQATL 427
7 -107.0003hrk_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  21  18KNMVETEPVQGCRDFPPEAMRCRRHLFDVFHATAKTFGFEEYDAPVLESEELYIRKAGEE---ITEQMFNFITKGG--HRVALRPEMTPSLARLLLGKGRSLLLPAKWYSIPQCWRYEAITRGRRREHYQWNMDIVGVKSVSAEVELVCAACWAMRSLGLSKDVGIKVNSRKVLQTVVEQAGVTSDKFAPVCVIVDKMEKAQLAVLGLEPTVVDAITTTLSLKSIDEIAQRVGEEAVKELRQFFEQVEAYGYGVLFDASVVRGLAYYTGIVFEGFDRE-GKFRALCGGGRYDNLLTTYGSP--TPIPCAGFGFGDCVIVELLQEKRLLPDHVVDDVVIPFDESMRPHALAVLRRLRDAGRSADIILD-----KKKVVQAFNYADRVGAVRAVLVAPEEWERGEVQVKMLREGTGKEEGGAERGFAVPL.... 446
8 -102.0003hri_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  20  18MNMVETEPVQGCRDFPPETMRLRKYLFDVFHSTARKFGFEEYDSPVLESEELYIRKAGEE---ITEQMFNFITKGG--HRVALRPEMTPSLARQLLAKGRSLLLPAKWYSIPQCWRYEAITRGRRREHYQWNMDIIGVKSVSSEVELVCAACTAMQSLGLSSKVGVKINSAGVSADKFAPVCVIVDKMEKLEEVVAQLAAIGLESNVVDAITSTLS-----LKTIDEIAQRIGEEAVRELRDFITQIEAYGFGVIFDASVVRGLAYYTGIVFEGFDRD-GNFRALCGGGRYDNLLTTYGSP--TAVPCVGFGFGDCVIVELLNEKKLLPEHVVDDLVIPFDETMRPHALSILRRLRDAGRSADIVFD-----KKKVVQAFNYADRIGALRAVLVAPDEWARGEVRVKMLREGAGREEGANERGIVLPVD... 447
9 -99.5003net_A mol:protein length:465 Histidyl-tRNA synthetase  ali model follow..  22  7NDKINFSTPSGFPEFLPSEKRLELYLLDTIRRVYESYGFTPIETPAVERLEVLQAKGNQGDNIIQAEKDKSGDTGS--EARALKFDQTVPLAAYIARHLNDLTFPFARYQMDVVFRGERAKDGRFRQFRQCDIDVVGRESLLYDAQMPAIITEIFEAVNIGD-FVIRINNLNISETQIKSCISIIDNLEKIGEAKVKLELEKEGINPEQTQKKIDGSVDDVLDKLKHLSQTLPELGVSELETVITGVRNLGVPFCIDLAIARGLNYYTGTVYETTLIGHEALGSICSGGRYEELVGTFIGE---KMPGVGISIGLTRLISRLLKAGILNTTPAQVVVVNMQDELMPTYLKVSQQLRQAGLNVITNFE-----KRQLGKQFQAADKQGIRFCVIIGADEAAAQKSSLKDLQSGEQVEVALADLAEEIKRRLT. 465
10 -99.5004g85_A mol:protein length:517 Histidine-tRNA ligase, cytoplasmic  ali model follow..  22  62KQKFVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGEDS----KLIYDLKDQGG--ELLSLRYDLTVPFARYLAMNKL---TNIKRYHIAKVYRRDNPARGRYREFYQCDFDIAGNFDPMPDAECLKIMCEILSSLQIGD-FLVKVNDRRILDGMFAICGVSDSKFRTICSSVDKLDKVSWEEVADRIGDGGVSLVEQLLQDPKLSQNKQALEGLGDLKLLFEYLTLFGIDISFDLSLARGLDYYTGVIYEAVLLQTPAQGSVAAGGRYDGLVGMFDPKG-RKVPCVGLSIGVERIFSIVEQRLEALETETQVLVASAQKKLLEERLKLVSELWDAGIKAELLYK----KNPKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRSVTSREEVDVRREDLVEEIKRRTGQ 515
11 -97.8004g84_A mol:protein length:464 Histidine--tRNA ligase, cytoplasmic  ali model follow..  22  10.RQFVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGEDS----KLIYDLKDQGG--ELLSLRYDLTVPFARYLAMNKL---TNIKRYHIAKVYRRDNPTRGRYREFYQCDFDIAGNFDPMPDAECLKIMCEILSSLQIGD-FLVKVNDRRILDGMFAICGVSDSKFRTICSSVDKLDKVSWEEVADRIGDGGVSLVEQLLQDPKLSQNKQALEGLGDLKLLFEYLTLFGIDISFDLSLARGLDYYTGVIYEAVLLQTPAQGSVAAGGRYDGLVGMFDPKG-RKVPCVGLSIGVERIFSIVEQRLEALETETQVLVASAQKKLLEERLKLVSELWDAGIKAELLYK----KNPKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRSVTSREEVDVRREDLVEEIKRRTGQ 462
12 -86.6003od1_A mol:protein length:400 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  20  6.KPFMFEKPFGMRDTLPEWYKTKKNICDQMTEEINLWGYDMIETPTLEYYETV----GVVSAILDQQLFKLLDQQG--NTLVLRPDMTAPIARLVASSLKDRAYPLRLAYQSNVYRAQQNEGGKPAEFEQLGVELIGDGTASADGEVIALMIAALKRAGLSE-FKVAIGHVGYVNALLMDVVGNEQRADRLRRFLYEKNYVGYRKSRLMNLLSLRGGRAAIEEARGLIQTEKGKTALAEMTKLYEVLESYGASVKFDLTLVLHMSYYTGVVFEGYGNRLGV--PLCSGGRYDELLSKFHRP----AQATGFGVRIDLLVEALNGEII--SNGHEQTCILFSNERRFEAIELARKKRANGEAVVLQDL-----AGVTDVDAMSSNYQDVIYCIGTAGRGGEDA.............................. 400
13 -77.7001z7m_A mol:protein length:344 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  22  11MEKINYLLPEESAEMTLNQVKSLRQIEGRLRKLFSLKNYQEVMPPSFEYTQLYTALESNGKTFNQEKMFQFIKHEG--QSITLRYDFTLPLVRLYSQIKD--STSARYSYFGKIFRKEKRHKGRSTENYQIGIELFGESADKSELEILSLALQVIEQLGLNK-TVFEIGSAKFFQRLCQLADGSTELLTELLLKLNAFIEKNNFSKELRGLLKEIFITNELSRLENLVTNTKDDVLISSFDQLKEFSEKLSMPIIIDLGMVPKMDYYTDLMFKAYSS--AANQPILSGGRYDQLLSNFQE----EAFAIGFCCHMDTILKALERQELEEDND.................................................................................................... 338
14 -77.0003rac_A mol:protein length:373 Histidine-tRNA ligase  ali model follow..  21  18AVRGFADRPPGMQDGYPDFAKRRRAVETRLLSFVEDAGYEPVTSGLFEYVDTLLRARSPESS---RDWIRLFDGGG--DAVALRPEMTPSIARMAAPRVAAGRTPIRWCYCERVYRRTSWASGKAAESTQVGIERIGEEASVVDMDVLRLLHEASAAAGVRH-HRIVVSHARLVPRLLDALGISASLSRAFLACLTSGNYVQFRENLLTWSPAERDAAKRSREASDRELEALLRDAWRYLCRLAEALHDSGLAVTFDLALHRELDYYTGLVFEMFAPGVGA--PIAQGGRYDELLAQFGA----GAPAVGFAFEVERVMAVLEAQEEGEGE..................................................................................................... 372
15 -76.8006FTT Entity 1(prereleased)  ali follow..  17  3.......LPDGVADVLFEDAHKQEVLRHQLTQQLITHGYQLVSPPMIEFTESLLSGASED---LKRQTFKIIDQLTG-RLMGIRADITPQILRIDAHHG--GDGIARYCYAGDVIHTLPSGLFGSRTPLQLGAEIFGCESIAADIELIDVLFSMINSLDMSAVLHVDLGHVTIFKRLAELAALSASDTEQLMQLYANKNLPELKGSDFYTLARFGHDIANLLGRLSENADTKIVTAIDELQRLKAHLQVQWCAVSIDVTELSGYHYHTGIVFNGYIN--SETQPLVRGGRFDGMKSNQLATN-QPRQATGFSMDVSRLLAHTQLDAPFIVLIDYDAFNNLDSAQRQLLLQQVASLRQQGYRVTMPLTAEDM-PVGLTHRLSLADNQWRLHAV........................................ 388
16 -76.8005m8h_A mol:protein length:388 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  17  3.......LPDGVADVLFEDAHKQEVLRHQLTQQLITHGYQLVSPPMIEFTESLLSGASED---LKRQTFKIIDQLTG-RLMGIRADITPQILRIDAHHG--GDGIARYCYAGDVIHTLPSGLFGSRTPLQLGAEIFGCESIAADIELIDVLFSMINSLDMSAVLHVDLGHVTIFKRLAELAALSASDTEQLMQLYANKNLPELKGSDFYTLARFGHDIANLLGRLSENADTKIVTAIDELQRLKAHLQVQWCAVSIDVTELSGYHYHTGIVFNGYIN--SETQPLVRGGRFDGMKSNQLATN-QPRQATGFSMDVSRLLAHTQLDAPFIVLIDYDAFNNLDSAQRQLLLQQVASLRQQGYRVTMPLTAEDM-PVGLTHRLSLADNQWRLHAV........................................ 388
17 -57.7001usy_A mol:protein length:275 ATP PHOSPHORIBOSYLTRANSFERASE REGULATORY SUBUNIT  ali model follow..  16  2.............DFLDFE------KVFSFYSKATKKGFSPFFVPALEKAEEP-------------AGNFFLDRKG--NLFSIREDFTKTVLNHRKRYS--PDSQIKVWYADFVYRYSGSD---LVAEYQLGLEKVPRNSLDDSLEVLEIIVESASEFFEGP-VIVEIGHTGVYEDHEKVLNLIDTKNLAEIEFLSHMKKIDLSRVEKIIEDSIYRRSPEHLKTMDLPLSVR-----EDLLSASSFLQEKTVSVEIDLTLARTIEEYCGLIFTIYDTSSSR--LVAAGGEYTVNGE----------KGVGGSIFLEGK.................................................................................................................. 273
18 -48.9004cs2_A mol:protein length:274 PYRROLYSINE--TRNA LIGASE  ali model follow..  12  34ESELLSRRKKDLQQIYAEERENLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRV------DKNFCLRPMLAPNLANYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTRENLESI--ITDFLNHLGID--FKIVGDSCMVFGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGKVKHDFKNIKRAARSESYYNGISTN.................................................................................................................................................................................................. 267
19 -46.7002lw7_A mol:protein length:170 Histidine--tRNA ligase, cytoplasmic  ali model follow..  16  3....................................................................................................................................................................................................................................................................................RAALEELVKLQGERVRGLKQQKASAELIEEAQLGPDESKQKFVLKTPKALEEKTTETQVLVASAQKKLLEERLKLVSELQDAGIKAELLYK----KNPKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRSVTSREEVDVRREDLVEEIKRRTGQ 165
20 -45.0003qtc_A mol:protein length:290 Pyrrolysyl-tRNA synthetase  ali model follow..  13  48ESELLSRRKKDLQQIYAEERENLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRV------DKNFCLRPMLTPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLVFWQMGSGCTRENLESI--ITDFLNHLGID--FKIVGDSCMVFGDTLDVMHGDLELSSALVGPIPLDREWGID-KPWIGAGFGLERLLKVKHDFKNI---------KRAARSESYYNGISTNL.................................................................................................................................................................................. 282
21 -41.6005k1p_A mol:protein length:274 Pyrrolysine--tRNA ligase  ali model follow..  12  34ESELLSRRKKDLQQIYAEERENLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRV------DKNFCLRPMLAPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLAFAQMGSGCTRENLESI--ITDFLNHLGIDF--KIVGDSCMVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIG-AGFGLERLLKVKHDFKNIKRAARSE..................................................................................................................................................................................................... 258
22 -40.8004bw9_A mol:protein length:291 PYRROLYSINE--TRNA LIGASE  ali model follow..  11  51ESELLSRRKKDLQQIYAEERENLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRV------DKNFCLRPMLAPNLGNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTRENLESI--ITDFLNHLGID--FKIVGDSCMVFGDTLDVMHGDLELSSAVVGPRPLDREWGIDKPWIGA-----------FGLERLLKVKHDFKNIKRAARSESYYNGISTNL.................................................................................................................................................................................. 285
23 -35.7004q6g_A mol:protein length:267 Pyrrolysine--tRNA ligase  ali model follow..  14  33ESELLSRRKKDLQQIYAEERENLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVD------KNFCLRPMVAPNIFNYARKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFFQMGSGCTRENLE--SIITDFLNHLGIDFKIVGD......................................................................................................................................................................................................................................................................... 192
24 -35.7002e3c_A mol:protein length:291 Pyrrolysyl-tRNA synthetase  ali model follow..  15  52.SELLSRRKKDLQQIYAEEREYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRV------DKNFCLRPMLAPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTRENLE--SIITDFLNHLGIDFKI............................................................................................................................................................................................................................................................................ 207
25 -30.5004tqd_A mol:protein length:291 Pyrrolysine--tRNA ligase  ali model follow..  15  52.SELLSRRKKDLQQIYAEEREYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDND----TELSKQIFRVD--KNFCLRPMLAPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLSFIQMGSGCTRENLE--SIITDFLNHLGIDFKI............................................................................................................................................................................................................................................................................ 207
26 -27.8002zni_A mol:protein length:308 Pyrrolysyl-tRNA synthetase  ali model follow..  14  63IEHQLMSQGKRHLEQLVKHRPALLELEEKLAKALHQQGFVQVVTPTIITKSALAKMTIGED----HPLFSQVFWLD--GKKCLRPMLAPNLYTLWRELERLWDKPIRIFEIGTCYRKESQGAQHLNEFTMLNLTELGTPLEERHQRLEDMARWVLEAAGIREF............................................................................................................................................................................................................................................................................. 221
27 -25.9002i4l_A mol:protein length:458 Proline-tRNA ligase  ali model follow..  15  48......QEAAGIYAWLPLGHRVLKKIEQIVREEQNRAGAIELLMPTLQLADLWRES--GRYDAYGPEMLRIADRHK--RELLYGPTNEEMITEIFRAYKSYKSLPLNLYHIQWKFRDERPRFGRGREFLMKDAYSFDVDEAGARKKMFVAYLRTFARMGL-KAIPMRAET-GPIGGDLSHEFIVLAETGESGVYIDRDVLNLPVPDENVDYDGDLTPIIKQWTSVYAATEDVHEPARYESEVPEANRLNT-----------RGIEV--GQIFYF-------------GTKYSDSMKNVTGPDGTDAPIH-YGVGVSRLLGAIIEACVAPFRVTILNLKQGDAATDAACDQLYRELSAKGVDVLYD------TDQRAGAKFATADLIGIPWQIHVGPRGLAEGKVELKRRSDGARENLALADVVARLT..... 452
28 -24.5004k86_A mol:protein length:535 Proline--tRNA ligase  ali model follow..  13  52SEMIEYHDISGCYILRPWAYAIWEAIKDFFDAEIKKLGVENCYFPMFVSQSALEKE--KTHVADFAPEVAWVTRSGKTEPIAIRPTSETVMYPAYAKWQSHRDLPIKLNQWCNVVRWEKHPQPRTREFLWQEGHSAFATMEEAAEEILDLYAQVYEELLAIPVVK---------GRKTEKEKFAGGDYTTTIEAFISASGRAIQGGTSHHLGQNFSKMFEI--------VFEDPKIPGEKQFAYQN-------------------------------SWGLTTRTIGV-----MTMVHGDNMGLVLP----------PRVACVQVVIIPCGITNALSEEDKEALIAKCNDYRRRLLSVNIRVRADLR----DNYSPGWKFNHWELKGVPIRLEVGPRDMKSCQFVAVRRDTGEKLTVAENEAETKLQAILED 424
29 -23.9004hvc_A mol:protein length:519 Bifunctional glutamate/proline--tRNA ligase  ali model follow..  13  36SEMIEYHDISGCYILRPWAYAIWEAIKDFFDAEIKKLGVENCYFPMFVSQSALEKE-KTHVADFAPEVAWVTRSGKTAEPIAIRPTSETVMYPAYAKWQSHRDLPIKLNQWCNVVRWEKHPQPRTREFLWQEGHSAFATMEEAAEEILDLYAQVYEELLAIPVV---------KGRKTEKEKFAGGDYTTTIEAFISASGRAIQGGTSHHLGQNFSKMFEI--------VFEDPKIPGEKQFAYQN-------------------------------SWGLTTRTIG------MTMVHGDNMGLVLP-----ACVQVVIIPCGITNALSEED--------KEALIAKCNDYRRRLLSVNIRVRADLR----DNYSPGWKFNHWELKGVPIRLEVGPRDMKSCQFVAVRRDTGEKLTVAENEAETKLQAILED 408
30 -23.7005xif_A mol:protein length:500 Prolyl-tRNA synthetase (ProRS)  ali model follow..  13  29......YDISGCYIMRPWAFHIWEKVQRFFDDEIKKMGVENSYFPMFVSRHKLEKEKDH--EGFSPEVAWVTHYGDSPEKIAIRPTSETIMYPAYAKWRSHRDLPLKLNQWCSVVRWEKQPTPRTREFLWQEGHTAHATEEEAWELVLDI---------------------------------------------------------LELYRRWYEECLAVPVIKGEKSEGEKFAGGKKTTTVEAFIPENGRGIQAATSHLLGTNF--AKMFEIEFEDEEGHKRLVHQTSWGCTTRSLGVMIMTHGDDKGLVIPPR--------------ASVQVVIIPILGEILGKCRELKTMLEKADIRVRIDDR----SNYTPGWKYNHWEVKGVPLRLELGPKDLAKGTARVVRRDTGEAYQISWADLAPKLLELMEG 389
31 -23.7004ncx_A mol:protein length:506 Proline--tRNA ligase  ali model follow..  10  27SELIEYYDISGCYILRPAAYYIWECVQAFFNKEIKKLNVENSYFPLFVTKNKLEKEKNH--EGFSPEVAWVTKYGDSPEEIAIRPTSETIMYSVFPKWRSYRDLPLKLNQWNTVVRWEKQPTPRTREFLWQEGHTAHKNEEEAV-KLVFDILDLYRRWYEEYLAVPIIKGIKSEGEK---------------------------------------------------------GGANFTSTAEAFISENGRAIQAATSHYLGTNF--AKMFKIEFEDENEVKQYVHQTSWGCTTRSIGIMIMTHGDDKGLVLPPN--------------SKYKVVIVPIFNAIHSYCKDIEKILKNAQINCVYDDR----ASYSPGYKFNHWELRGIPIRIEVGPKDLQNNSCVIVRRDNNEKCNVKKESVLLETQQMLVD 393
32 -23.4005xip_A mol:protein length:498 Prolyl-tRNA synthetase, putative  ali model follow..  11  24GELVEYYDISGCYIIRPWAYRIWEAVQKFFDDGIKRLGVENCYFPMFVSQAKLEKEKDHVEGF-KPEVAWVTHYGDSEEKVAIRPTSETIMYPAYAKWRSHRDLPLKLNQWNNVVRWEKQPTPRTREFLWQEGHTAHATEEEAYTLILELYRQWYEDYLAVPVI------------------------------------------------------------KGEKSENEKFAGGKKTTTIEGIIPDTGRGIQAATSHLLGQNF--SRMFSIEFEDEKGAKQLVHQTSWGCTTRSLGVMIMTHGDDKGLVLPPR--------------VAVQAVIIPIIMEIVAKCRELERLLNAAGVRVKVDDR----TNYTPGWKFNDWELKGVPLRLEIGPRDVESCQTRVVRRDTSEARNVPWAEAASTIPAMLET 390
33 -23.3005f9y_A mol:protein length:511 Aminoacyl-tRNA synthetase  ali model follow..  10  31SEMIEYYDISGCYILRPWSYFIWETIQSVFDQKIKQHDVQNAYFPIFVTQKKLETEKDH--EGFSPEVAWVTKSGKSDEPIAIRPTSETIMYPYFAKWRSHRDLPLKINQWTSIVRWEKHPTPRTREFLWQEGHTAHSTRKEALEMVDIILNEYASIYEDLLATPVVKGT------KSENEKFPGGDITKSIEGFIPEIGRAVQAATSHLLGQNFSK-----------------------------------------------------MFGVEFEDEKGNKEYAHQTSWGLTTRAIGVMIMTHGDNKGLVL-----------------APVQVIIIPIIEEQKKICNEVECILKKAGVRVKIDDR----SNYTPGWKYNHWEVKGVCLRFEVGPRDIEKRSVRVVVRDNMEKMDIPISELESKIPKLLEE 397
34 -23.2002j3l_A mol:protein length:572 PROLYL-TRNA SYNTHETASE  ali model follow..  13  34......QVAAGIYSYLPLANRVLEKLKTIMREEFEKIDAVEMLMPALLPAELWKES--GRYETYGPNLYRLKDRND--RDYILGPETFTELIRDEINS--YKRLPLNLYQIQTKYRDERSRSGRGREFIMKDGYSFHADEASLDQDYEKAYSRIFERCGLE-AIIGDGGAMGGKDSKEGTIAEVANFFEVEPQRIIKSVLFIADEEPVMVLVRGDHDVNDVKLKNFLGADFLDEATEEDARRVLGAGFGSIGPVNVSEDVKIYADLAVQDLANAIVGANEDGYHLTNGTRYSDAMGALDENGREKSVIMGYGIGVSRLLSAIVEQNADERAPFDLHVVQMNEYQTKLSQEVEAMMTEAGYEVLVD------RNERAGVKFADADLIGCPIRITVG-KKAVDGVVEVKIKRTGEMLEVRKEELESTLSILMNT 567
35 -22.7005ucm_A mol:protein length:579 Proline--tRNA ligase  ali model follow..  14  36......RLASGLYTWLPMGLRVLRKVETIVREEMNAAGALEVLMPAVQPAELWQES--GRWEQYGPELLRLKDRHE--REFCVGPEVITDLARNELNS--YKQLPINFYQIQTKFRDERPRFGRGREFIMKDAYSFHLSQDSLQQGMYQAYSKIFSRLGL-DFRPVQADN-GSIGGSGSHEFHVLANSGEDDIVFSDSSDYAANIEKAEAVPRESARGSATEDNTKTIAALVDGFQLPIEKTIKTLVVHGAEEGTLVALIVRG-DLPLPEVADLRNVVEGDPSPDGKGTKYSEAMKLLSEQGKPVNLIMGYGIGVSRVVAAAIEQNHDERAPFQIALVPLKESVKQATDKLYAELTAAGFEVLLD---DRDKKTSPGVKFADMELIGIPHRIVISDRGLSEGVLEYKGRRDSESQNLPIGELMSFITEKLSR 573
36 -22.4004p3n_A mol:protein length:415 Threonine--tRNA ligase, cytoplasmic  ali model follow..  15  27..........GSCFFLPKGAYIYNALIEFIRSEYRKRGFQEVVTPNIFNSRLWMTS--GHWQHYSENMFSFEVEK---ELFALKPMNCPGHCLMFDHRRSWRELPLRLADFGVLHRNELSGA-RVRRFQQDDAHIFCAMEQIEDKGCLDFLRTVYSVFGFSFKLNLSTRPEKFLGDIEVWDQA---------------------------------------------------------KQLENSLNEFGEKWELNS----GDGAFYGPKIDIQIKDAIGRYHQCATIQLDTYVSHDGDDKKRPVIVHRAILGVERMIAILTEN-----SPRQVMVVPVGPTCDEYAQKVRQQFHDAKFMADIDLD----PGCTLNKKIRNAQLAQYNFILVVGEKEKISGTVNIRTRDNKVHGERTISETIERLQQLKEF 400
37 -22.3004hwt_A mol:protein length:413 Threonine--tRNA ligase, cytoplasmic  ali model follow..  15  23..........GSCFFLPKGAYIYNALIEFIRSEYRKRGFQEVVTPNIFNSRLWMTS--GHWQHYSENMFSFEVEK---ELFALKPMNCPGHCLMFDHRRSWRELPLRLADFGVLHRNELSGA-RVRRFQQDDAHIFCAMEQIEDKGCLDFLRTVYSVFGFSFKLNLSTRPEKFLGDIEVWDQA---------------------------------------------------------KQLENSLNEFGEKWELNS----GDGAFYGPKIDIQIKDAIGRYHQCATIQLDTYVSHDGDDKKRPVIVHRAILGVERMIAILTEN-----SPRQVMVVPVGPTCDEYAQKVRQQFHDAKFMADIDLD----PGCTLNKKIRNAQLAQYNFILVVGEKEKISGTVNIRTRDNKVHGERTISETIERLQQLKEF 396
38 -21.8001h4q_A mol:protein length:477 PROLYL-TRNA SYNTHETASE  ali model follow..  14  26.ELADYGPVRGTIVVRPYGYAIWENIQQVLDRMFKETGHQNAYFPLFIPMSFLRKEAEH--EGFSPELAVVTHAGGEEEPLAVRPTSETVIGYMWSKWRSWRDLPQLLNQWGNVVRWEMRTRPRTSEFLWQEGHTAHATREEAEEEMLSIYARLAREYAAIPVIE---------GLKTEKEKFAGAVYTTTIEALMKDGKALQAGTSHY------------------------------------------------------LGENFARAFDIKFQDRDLQVKYVHTTSWGLSWRFIGAIIMTHGDDRGLVL-----------------APIQVVIVPIYERVLEAAQGLRQALLAQGLRVHLD----DRDQHTPGYKFHEWELKGVPFRVELGPKDLEGGQAVLAS-RLGGKETLPLAALPEALPGKLDA 387
39 -21.5003ial_A mol:protein length:518 Prolyl-tRNA synthetase  ali model follow..  14  36......YPVKGCVVFRPYGFFMENAIMRLCEEEYAKVGISQILFPTVIPESFLKKESDH--KGFEAECFWVEKGGLQEERLALRPTSETAIYSMFSKWRSYKDLPLKIHQTCTIFRHEKNTKPRVREIHWNEAHCCHATAEDAVSQLSDY-------WKVIDTIFSDELCFKGQKLRRVCWDRFPGADYSEVSDVVMPCGRVLQTAGIHNLGQRFSSTFDI--------LYANKANESVH-----YLTCAGISTRVLACALSIHGDSGGLVLPPLIAP------------------------------------IHVVIIPIGCGKKNNQESDQQVLGKVNE--------ADTLKSKLGLRVSIDDD----FSKSMGDKLYYYELKGVPLRIEVGQRDLANGQCIVVPRDVGKDQKIPITEVMKVSSHTTEN 402
40 -21.4005xil_A mol:protein length:512 Putative prolyl-tRNA synthetase  ali model follow..  13  25.EMIEYYDVSGCYIIRPWAYYVWKCVQRFLGGKIEKLGVEDCYFPMFVSRSCLEREKDH--EGFAPEVAWVTRAGDTEQPVAVRPTSETVMYPYYAKWRSHRDLPVRLNMWNNVIRWESHPTPRTREFLWQEGHCAWAKAEECAKEILECYASVYEQLLAVPVV---------RGRKTEKEKFAGGDYTTTVETFIEAVGRGCQGATSHNLGQNFG-------------------------------KMFDIRFQDPENNEQTLIPWQNSW--------GLSTRVIG------MIMVHGDNRGMVMP---RVASTQVIIIPVGITKDTTEEAR--------QELLASCWRLESELCEGGVRARCDLR----DNYSPGWRFNHWEVKGVPLRVELGPRELAERSLAVAVRHSGARHSVAWDAQTPAAVAALLE 396
41 -20.7001nj1_A mol:protein length:501 Proline-tRNA Synthetase  ali model follow..  12  52......YPVKGMHVWMPHGFMIRKNTLKILRRILDR-DHEEVLFPLLVPEDELAKEAIHVKGF-EDEVYWVTHGGLSQRKLALRPTSETVMYPMFALWRSHTDLPMRFYQVVNTFRYETKHT-VREITTFKEAHTIHATASEAEEQAVEIYKEFFNSLGIP----------------------------------------------------------YLITRRPPWDKFPGSEYTVAFDTLMPDGKTLQIGTVHN------LGQTFARTFEIKFETPEGDHEYVHQTCYGLSDRVIASVIAIHGDESGLCLPPD--------------AAHQVVIVPIAEEVMEACRELRSRLEAAGFRVHLD-----DRDIRAGRKYYEWEMRGVPLRVEIGPRDLEKGAAVISRRDTGEKVTADLQGIEETLRELMKD 408
42 -20.5003a31_A mol:protein length:471 Probable threonyl-tRNA synthetase 1  ali model follow..  13  39.........AGVPLFSLGGGPIRYALAEVLAKFHARRGYYVVETPIIASTELFKVS-----EFYRNNMYLFDIEG---HEFAVKPMNCPYHILLFLNERSKLPLPFKVFEFGRVHRYEPSGS-RVRGFTQDDAHIIVPGGRVIDYDVFEEMKLVLERLFKLGVFKVRLSMSDKSLIGKEFMGSKEEWEGAE-------------------------------------------------EALREAASRINEKYGIDIVELEGEAAFYGPKLDFEESGVSKEWQMGT--RFRYDVVREEFGIEEVYIIHRALLGIERFLGVYLEH-----APIQFAVIAVKTGGEDLASSIAKGLLDKGFRVAVKGS----SKTGLSSDVRHIESTAKPAVVFIGAKEVREKVLDVRVFDLESMKRRRLAIAYGDAADAVEN 441
43 -20.4004hwo_A mol:protein length:411 Threonine--tRNA ligase  ali model follow..  15  23..........GMVFWHNDGWTIFRELEVFVRSKLKEYQYQEVKGPFMMDRVLWEKT--GHWDNYKDAMFTTSSEN---REYCIKPMNCPGHVQIFNQGKSYRDLPLRMAEFGSCHRNEPSGS-RVRGFTQDDAHIFCTEEQIRDNGCIRLVYDMYSTFGFEKI------------------------------------VVKLSTRPEKRIGSDEMWDRA--------------------ADLAVALEENNIPFEYQLG------FYGPKIEFTLYDCLDRAWQCGT--RLSASYVGEDNERKVPVMIHRAILGMERFIGILTEE-----APVQVVIMNITDSQSEYVNELTQKLSNAGIRVKAD-----LRNEKIGFKIREHTLRRVPYMLVCGDKEVESGKVAVRTRRGKDLGSMDVNEVIEKLQQEIRS 395
44 -20.2001nj8_A mol:protein length:459 Proline-tRNA Synthetase  ali model follow..  12  25......YPIKGCGVYLPYGFKIRRYTFEIIRNLLDESGHDEALFPMLIPEDLLAKE-AEHIKGFEDEVYTHGGKTQLDVKLALRPTSETPIYYMMKLWKVHTDLPIKIYQIVNTFRYEKHTRPLIRLMTFKEAHTAHSTKEEAENQAISIYKKFFDTLGIPYLISKRPEW----------------------------------------------------------------DKFPGAEYTMAFDTIFPDGRTMQIATVHNLGQNFSKTFEIIFETPTGDKDYAYQTCYGISDRVIASIIAIHGDEKGLILPPI--------------APIQVVIVPLIFKGKEDIVKEIYEKLKGKFRVHID------RDIRPGRKFNDWEIKGVPLRIEVGPKDIENKKITLFRRDTMEKFQVDETQLMEVVEKTLNN 381
45 -20.2001b76_A mol:protein length:442 Glycine--tRNA ligase  ali model follow..  14  29.........QGVYDYGPLGVELKNNLKQAWWRVYERDDMEGLDASVLTHRLVLHYS--PPRYFNMMFQDLRGPRGGRGLLAYLRPETAQGIFVNFKNDATSRKLGFGIAQIGKAFRNETPRNFRVREFEQMEIEYFVRPGEDEYRYWVEERLKWWQEMGLSRE-NLVPYQQPPES-------------SAHYAKATVDILYRFPHGSLELEGIAQRTDFDLGSHTKDQEALGITARVLRNEHSTQRLAYRDPE-WFVPYVIEPSAGVDRGVLALLAEAFTREEL---------------------------PNGEERIVLKLKPQ-LAPIKVAVIPLVKNRPEITEYAKRLKARLLALGLGRVLY-----EDTGNIGKAYRRHDEVGTPFAVTVDYDTIGQSTVTVRDRDTMEQIRLHVDELEGFLRERLR. 441
46 -19.3001nyq_A mol:protein length:645 threonyl-tRNA synthetase 1  ali model follow..  16  261.........AGLPLWLPNGATIRREIERYIVDKEVSMGYDHVYTPVLANVDLYKTS--GHWDHYQEDMFPPMQLDET-ESMVLRPMNCPHHMMIYANKHSYRELPIRIAELGTMHRYEASGA-RVRGMTLNDSHIFVRPDQIKEKRVVNMIIDVYKDFGFEDYFRLSYRDPEDKE--------------------------------------KYFDDDDMWNKAENMLKEAADELGLSYEEAIGEAAFYGPKLDVQVKTAMGKEETLSTALDFLLPE-----------RFDLTYIGQDGEHHRPVVIHRGVVSMERFVAFLTEE-----APKQVQIIPVNVDLHDYARQLQDELKSQGVRVSIDDR-----NEKMGYKIREAQMQKIPYQIVVGDKEVENNQVNVRQYGSQDQETVEKDEFIWNLVDEIRL 641
47 -18.0001qf6_A mol:protein length:642 THREONYL-TRNA SYNTHETASE  ali model follow..  15  262..........GMVFWHNDGWTIFRELEVFVRSKLKEYQYQEVKGPFMMDRVLWEKT--GHWDNYKDAMFTTSSEN---REYCIKPMNCPGHVQIFNQGKSYRDLPLRMAEFGSCHRNEPSGS-RVRGFTQDDAHIFCTEEQIRDNGCIRLVYDMYSTFGFEKI------------------------------------VVKLSTRPEKRIGSDEMWDRA--------------------ADLAVALEENNIPFEYQLG------FYGPKIEFTLYDCLDRAWQCGT--RLSASYVGEDNERKVPVMIHRAILGMERFIGILTEE-----APVQVVIMNITDSQSEYVNELTQKLSNAGIRVKAD-----LRNEKIGFKIREHTLRRVPYMLVCGDKEVESGKVAVRTRRGKDLGSMDVNEVIEKLQQEIRS 634
48 -17.8003ugq_A mol:protein length:460 Threonyl-tRNA synthetase, mitochondrial  ali model follow..  13  45......PLSPGSMFFLPNGAKIFNKLIEFMKLQQKKFGFNEVVTPLIYKKTLWEKS--GHWENYADDMFKVETTDEEKEEYGLKPMNCPGHCLIFGKKRSYNELPLRFSDFSPLHRNEASGA-RLRKFHQDDGHIFCTPSQVKSFNSLKLIDIVYNKIFPFVK---------------------------GGSGAESNYFINFSTRPDHFIGDLKVWNHA--------------------QVLKEILEESGKPWKLNPG------FYGPKLDIMVTDHLRKTHQVAT--RFDLKFKDQDNSYKRPIMIHRATFGIERFMALLIDS-----NPYQAVIIPVNTKNVQQLDMCPVPLNDWHFNVDLD-----IRNEPVGYRIKSAILKNYSYLIIVGDEEVQLQKYNIRERDNRKSFKLTMSQIWEKFIELEKN 452
49 -16.8001v95_A mol:protein length:130 Nuclear receptor coactivator 5  ali model follow..  10  5........................................................................................................................................................................................................................................................................................................................................SSGPVDCSVIVVNKQTKDYAESVGRKVRDLGMVVDLIFL---NTEVSLSQALEDVSRGGSPFAIVITQQHQIHRSCTVNIMFGTPQENMPQADAMVLVARNYER 107
50 -16.4001ati_A mol:protein length:505 GLYCYL-TRNA SYNTHETASE  ali model follow..  15  123................ENLHALVQAMMQAPERAGGAMTAAGVLDPASGEPGDWTPP--RYFNMMFQDLRG--PRGGRGLLAYLRPETAQGIFVNFVLDATSRKLGFGIAQIGKAFRNETPRNFRVREFEQMEIEYFVRPGEDEYRYWVEERLKWWQEMGLS-------------RENLVPYQQPPESSAHYAKAT--DILYRFPHGSLELEGIAQRTDFDLGSHTKDQEALGITARVLRNEHSTQRLAYRDPETG---------KWFVPYVIEPSAGVDRGVLALLAEAFTREELPN----------------GEERIVLKLKPQ-LAPIKVAVIPLVKNRPEITEYAKRLKARLLALGLGRVLY-----EDTGNIGKAYRRHDEVGTPFAVTVDYDTIGQSTVTVRDRDTMEQIRLHVDELEGFLRERLR. 504
51 -13.5002pme_A mol:protein length:693 Glycyl-tRNA synthetase  ali model follow..  13  90........VSGLYDFGPVGCALKNNIIQTWRQHFQEEQILEIDCTMLTPEPVLKTSVDKFADFMVKLMFKTFIGPGGNMPGYLRPETAQGIFLNFLLEFNQGKLPFAAAQIGNSFRNESPRSGRVREFTMAEIEHFVDPSEKDHPKFQNVADLHLYLYSFIGRIYLYLTKVGISPDKLRFRQHMENEMAHYACD-CWDAESKTSYGWIEIVGCADRSCYDLSCHARATKVPLVAEKPLKEPKTVNVVQFEPSKGAIGKAYKKDDECYITEMEMLLNEKGEFTIETEG-LTKDMINVK---YVEEVVPNV--SFGLGRIMYTVFEHTFHVREGDEVLPLSQNQEFMPFVKELSEALTRHGVSHKVD------SSGSIGRRYARTDEIGVAFGVTIDFDTVNKTTATLRDRDSMRQIRAEISELPSIVQDLAN. 657
52 -13.3001nnh_A mol:protein length:294 asparaginyl-tRNA synthetase-related peptide  ali model follow..  13  1.....MNAVEIISREISPTLDIQTKILEYMTDFFVKEGFKWLLPVIISPITDPLWPDPAGEGMEPAEVEIYGVKMRLTHSMILHKQLAIAMG--------------KIFVLSPNIRLESRQKDDGREFTQLDFEVERAK------DIMRLIERLVYGLKAEEWTGREFPKTKRFE-VFEYSEVLEEFGSDEKASQEMEEPFWIINIPREFYDREVDGFWRLPYGYGEVAS--GGEREWEYEKIVAKIRKAGLN-------EDSFRPYLEIA------------------KAGKL------------PSAGAGIGVERLVRFI.............................................................................................................. 272
53 -13.2003p8t_A mol:protein length:294 AsnS-like asparaginyl-tRNA synthetase related protein  ali model follow..  13  1.....MNAVEIISRDIYKAIDIQTKILDYMTKFFTDRGFKWLLPIMLSPITDPLWPDPAGEGIRPAEVDVYGVRMRLTHSMILHKQLAIAMG--------------KIFVLSPNIRLESRRKDDGREFTQLDFEIEGAK------DVMRLIEELIYGLKAEEWTGREFPRARHFK-VYDYKDILEEFGSDEKASMEMEEPFWIVNIPREFYDREENGVWKLPYGYGEVSS--GGEREWEYEKIVAKIRAAGLK-------EDSFRPYLEIA------------------RAGKL------------PSAGAGIGVERLVRFI.............................................................................................................. 272
54 -12.6003g1z_A mol:protein length:326 Putative lysyl-tRNA synthetase  ali model follow..  12  1..........GMSETATPNLLKRAAIMAEIRRFFADRGVLEVETPCMSQA-----VTDIHLFPFETRFVGPGHSQGINLYLMTSPEY---HMKRLLAAGCG-----PVFQLCRSFRNEEMGRHHNPEFYRPHYDMYRLMNEVDDLLQQVLDCQPAESLSYQQAFQRHLEIDPLSADKTQLREAAAKLDLSNIADTEEDRDTLLQLLFTMGVEPHIGKEKPFIYHFPASQASLAQISTEDHRVAERF-------YYKGIELANGFHELTDAREQQQRFEQDNRKRAARGLPQQPIDQNLLDALAAGLPDCGVALGVDRLVMLALGAESLAD...................................................................................................... 317
55 -12.3002g4c_A mol:protein length:474 DNA polymerase gamma subunit 2  ali model follow..  77.........GCHPGFGPLGVELRKNLAAEWWTVVFREQVFPVDALHHKPGPLLPGD--LQDKELSKEQLVTFLENVLKTSGKLRENLLHGALEHYCLDLVNKRLPYGLAQIGVCFHPVFDTKQSIGEKTEASLVWF-------------------------------TPPRTSNQWLDFWLRHRLQWWR----------KFAMSPSNFSSSDCQDEEGRKGNKLIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQLTENSFTRKK-----------------------NLHRKVLKLHPC-LAPIKVALDVGRGPTLELRQVCQGLFNELLENGISV---PGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISS 464
56 -12.2004ztu_B mol:protein length:472 DNA polymerase subunit gamma-2, mitochondrial  ali model follow..  10  71..........CHPGFGPLGVELRKNLAAE-EQVFPVDALHHKPGPLLPGDSAFRLVSAEQDKELSKEQLVAFLENVLKTSGKLRENLLHGALEHYCLDLVNKRLPYGLAQIGVCFHPVFDTKQSIGEKTEASLVWF-------------------------------TPPRTSNQWLDFWLRHRLQWWR----------KFAMSPSNFSSSDCQDEEGRKGNKLIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQLTENSFTRKK-----------------------NLHRKVLKLHPC-LAPIKVALDVGRGPTLELRQVCQGLFNELLENGISV---PGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISS 457
57 -12.2005c51_B mol:protein length:485 DNA polymerase subunit gamma-2, mitochondrial  ali model follow..  94.........GCHPGFGPLGVELRKNLAAEWWTVVFREQVFPVDALHHKPGPLLPGD--LQDKELSKEQLVAFLENVLKTSGKLRENLLHGALEHYCLDLVNKRLPYGLAQIGVCFHPVFDTK-SIGEKTEASLVWF-------------------------------TPPRTSNQWLDFWLRHRLQWWR----------KFAMSPSNFSSSDCQDEEGRKGNKLIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQLTENSFTRKK-----------------------NLHRKVLKLHPC-LAPIKVALDVGRGPTLELRQVCQGLFNELLENGISV---PGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISS 481
58 -11.8001n9w_A mol:protein length:422 aspartyl-tRNA synthetase 2  ali model follow..  18  125...................LKVQAALVRGFRRYLDRQDFTEIFTPKVVRAGAEGGSGLFGVDYFEKRAY-----------LAQSPQLYKQIMVGVFE---------RVYEVAPVWRMEEHHTSRHNEYLSLDVEMGFIAD-----DLMRLEEALLAEMEALNTAGDEIRLLGATW-RLTHAEAKRILKEELGYPVGQDLSEEAERLLGEYAKERWGSDWLFVTRYPRSVRPFYTYPEED-----GTTRSFDL-------LFRGLEITSGGQ-RIHRYEELLESLKAKGMDPEAFHGYLEVFKYGMPPHGGFAIGAERLTQKL.............................................................................................................. 401
59 -11.8001asy_A mol:protein length:490 ASPARTYL-tRNA SYNTHETASE  ali model follow..  11  181...................FRIQAGVCELFREYLATKKFTEVHTPKLLGAPSEGGSSVFEVTYFKGKAY-----------LAQSPQF---NKQQLIVADFE-----RVYEIGPVFRAENSNTHRHTEFTGLDMEMAFEEH-----EVLDTLSELFVFIELPKRFAHEIELVRKQYPVEEFKLPKDGKMVRLT------------KEGIEMLRAAGKEIGDFEDLSTENEKFLGKLVRDKYDTDFYILDKFPLEIR-NPKYSNSYDFFMR-------------EEILSGAQHALLQERMKAHGLSPPPHAGGGIGLERVVMFY.............................................................................................................. 469
60 -11.8003m4p_A mol:protein length:456 Asparaginyl-tRNA synthetase, putative  ali model follow..  13  156...................LQLRSEIQWYFRKYYHDNHFTEIQPPTIVKTQCEGGSTLFKLQYFNEPAY-----------LTQSSQLYLESVIASLG---------KSFCMLSSYRAEQSRTVRHAEYLHLEAELPFIS------DLLNHLEDLVCTV---------------IDNVMAVHGDKIRKMNPHLKLPTRPFKRMTYADAIKYCNDHGILNKDKPFEYGEDISEKPERQMTDEIGCPIFMIHFPSKMK-HPDLTESVDLLMPGVGE-----------IVGGSNYDELMGAYKANGLNPCPHGGYGLGVERLVMWLLGEDHIRK...................................................................................................... 443
61 -11.7003a5y_A mol:protein length:345 Putative lysyl-tRNA synthetase  ali model follow..  12  28.................PNLLKRAAIMAEIRRFFADRGVLEVETPCMSQA-----VTDIHLVPFETRFVGPGHSQGMNLWLMTSPEYH---MKRLLVAGCG-----PVFQLCRSFRNEEMGRYHNPEFYRPHYDMYRLMNEVDDLLQQVLDCPAAESLSYQQAFLRYLEIDPLSADKTQLREVAAKLDLSNVADTEEDRDTLLQLLFTFGVEPNIGKEKPFVYHFPASQASLAQISTEDHRVAERF-------YYKGIELANGFHELTDAREQQQRFEQDNRKRAARGLPQHPIDQNLIEALKVGMPDCGVALGVDRLVMLALGAETLAE...................................................................................................... 330
62 -11.6001x54_A mol:protein length:434 Asparaginyl-tRNA synthetase  ali model follow..  13  135...................MKVKETLIMAAREWLLKDGWHEVFPPILVTGAVEGGATLFKLKYFDKYAY-----------LSQSAQLYLEAAIFGLE---------KVWSLTPSFRAEKSRTRRHTEFWHLELEAAWMD------DIMKVEEELVSYMRTLELRKKEIEMFRDDLTTLKNTEPPFPRI-SYDEAIDILQSKGVNVEWGDDLGADEERVLTEEFDRPFFVYGYPKHIKAFYMKEDP--NDPRKVLASDMLAPEGYGEIIGGSQREDDYDKLLNRILEEGMDPKDYEWYLDLRRYGSVPHSGFGLGVERLVAWV.............................................................................................................. 413
63 -11.6001g5h_A mol:protein length:454 MITOCHONDRIAL DNA POLYMERASE ACCESSORY SUBUNIT  ali model follow..  10  56.............RFGPLGVELRKNLASQWWSSMVVFREQVFAVDSLHQEPGSSQPRDSAFRLVSPESIREILQDLLKTSGKLRATLLHGALEHYCLDLVNRKLPFGLAQIGVCFHPVSNSNQRVGEKTEASLVWF-------------------------------TPTRTSSQWLDFWLRHRLLWWR----------KFAMSPSNFSSADCQDELGRKGSKPIETLWNLGDQELLHTYPGNVSTIQGRDGRKNVVPCVLSVSGDVDLGTLAYLYDSFQLAENSFARKKSL-----------------------QRKVLKLHPC-LAPIKVALDVGKGPTVELRQVCQGLLNELLENGISVWPGYSET--VHSSLEQLHSKYDEMSVLFSVLVTETTLENGLIQLRSRDTTMKEMMHISKLRDFLVKYLAS 439
64 -11.5005xix_A mol:protein length:472 Asparagine--tRNA ligase, cytoplasmic  ali model follow..  13  164...................LKARSMVTRCFRDHFFDRGYYEVTPPTLVQTQVEGGATLFKLDYFGEEAF-----------LTQSSQLYLETCLPALG---------DVFCIAQSYRAEQSRTRRHAEYTHVEAECPFLT------DLLNRLEDLVCDVRILKSPAGSIVHELNPNFQPPKRPFKRMNYSDAIVWLKEHDVKKEDGTFYEDIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCP-----------DSRLTESVDVLMPNVGE-----------IVGGSDSEEILAGYKREGIDPCPHGGYGLGLERFLTWI.............................................................................................................. 445
65 -11.5003ikl_A mol:protein length:459 DNA polymerase subunit gamma-2, mitochondrial  ali model follow..  66..........................SEALLEICQRRHFLSGSKQQLSRDSLLSGGFGPLGVELRKNLAA-LLPGDSAFRGGLRENLLHGALEHYCLDLVNKRLPYGLAQIGVCFHPVFDTK-SIGEKTEASLVWF-------------------------------TPPRTSNQWLDFWLRHRLQWWR----------KFAMSPSNFSSSDCQDEEGRKGNKLIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQLTENSFTRKK-----------------------NLHRKVLKLHPC-LAPIKVALDVGRGPTLELRQVCQGLFNELLENGISV---PGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISS 449
66 -11.4001wyd_A mol:protein length:429 hypothetical aspartyl-tRNA synthetase  ali model follow..  17  134...................IKIQSLALKAFRETLYKEGFIEIFTPKIIASATEGGAQLFPVIYFGKEAF-----------LAQSPQLYKELMAGVVE---------RVFEVAPAWRAEESDTPFHAEFISMDVEMAFAD------DVMQLLEKILHNI---------------VKTIKEEGKEELKILNYEPPEVKIPIKRLKYTEAIEILRSKGYNIKFGDDIGTPELRILNEELKEDLYFIVDWPSDARPFYTKNPELSESFDLIYK-------------LEIVSGSKREVLEEALKKKGLKPPPHAGFGMGLARLMVML.............................................................................................................. 408
67 -11.1004j15_A mol:protein length:521 Aspartate--tRNA ligase, cytoplasmic  ali model follow..  15  210...................FRLQSGICHLFRETLINKGFVEIQTPKIISAASEGGANVFTVSYFKNNAY-----------LAQSPQL---YKQMCICADFE-----KVFSIGPVFRAEDSNTHRH-EFVGLDIEMAFNYH-----EVMEEIADTMVQIGLQERFQTEIQTVNKQFPCEPFKFLEPTLRLEYCEALAMLREAGVEMGDEDDLSTPNEK---------LLGHLVKEKYDTDFYILDKYPLAVRPFYTMNPKQSNSYDMFMR-------------EEILSGAQPQLLTERALHHGIDLPPHAGGGIGLERVTMLF.............................................................................................................. 494
68 -11.1003i7f_A mol:protein length:548 Aspartyl-tRNA synthetase  ali model follow..  14  244...................FRIQSACCGLFREFLTSQKFVEIHTPKLIGCSSEGGSNIFEVKYFDRKAY-----------LAQSPQL---YKQMAIMGDFR-----KVFEVGPVFRAENSNTRRHTEFEGLDIEMEIVEN-----ECIDVMEKLFTFIEIPKRFPDELKVIRKQYPFEDLIYRPFLRL-TYKEAIEMLRASGETIGDYDDFTTPQEV---------KLGELIKAKYNTDFYILDKFPAAIRPFYTMDPNYSNSYDVFVR-------------QEITSGADPEFLMKRCIEKGVDPWPHAGCGIGLERITMLY.............................................................................................................. 527
69 -11.0002xti_A mol:protein length:437 ASPARAGINYL-TRNA SYNTHETASE, CYTOPLASMIC, PUTATIVE  ali model follow..  13  134...................LRLRAAATRAMREHFYNAGYVEVAPPTLVQTQVEGGSTLFNLDYFGEQSF-----------LTQSSQLYLETCIPTLG---------DVFCIAQSYRAEKSRTRRHAEYAHVEAECPFITLDDLMEKIEELVCDTVDRLLADEEAKKLLEHINPKF-ERPFLRMEYKDAIKWLQEHNVENEFGNTFTYGEDIAEAAERFMTDTINKPILLNRFPSEIKAFYMQRDA-----------DNTLTESVDLLMPGVGE-----------IVGGSKFDELSKAFKNVEIDPCPHGGYGLGLERFICWLTNTNHIRD...................................................................................................... 424
70 -11.0004h2w_A mol:protein length:346 Amino acid--[acyl-carrier-protein] ligase 1  ali model follow..  12  48.........DGVYARTALYESIVERLAALITSHRE-AGTEALRFPPVMSRAQLEKGLHGTEREINAAVSRFDAGGDSPADLVLSPAACYPVYPIAASRGPLPKGGLRFDVAADCFRREPSKH-RLQSFRMREYVCIGTPDDVSDFRWMVRAQAIARDLGLTFRVDYASDPF--------------------------------AGKMLANNQRDQQLKFELLIPLRSEEQPTACMSFNYHR-----------------------EHFGTT-WGIQDANGEPAHTGCVA------------------------FGMDRLAVMFHTHGTDLSAWPAKVRDILGLQPHVAAGAHGEGWR............................................................................ 340
71 -10.9003mey_A mol:protein length:346 Bll0957 protein  ali model follow..  12  48.........DGVYARTALYESIVERLAALITSHRE-AGTEALRFPPVMSRAQLEKGLHGTEREINAAVSRFDAGGDSPADLVLSPAACYPVYPIAASRGPLPKGGLRFDVAADCFRREPSKH-RLQSFRMREYVCIGTPDDVSDFRWMVRAQAIARDLGLTFRVDYASDPF--------------------------------VGQMKAVSQKQQQLKFELLIPLRSEEQPTACMSFNYHR-----------------------EHFGTT-WGIQDANGEPAHTGCVA------------------------FGMDRAVAMFHTHGTDLSAWPAKVRDILGLQPHVAAGAHGEGWR............................................................................ 340
72 -10.8001b8a_A mol:protein length:438 PROTEIN (ASPARTYL-TRNA SYNTHETASE)  ali model follow..  15  137...................FKIRSSVFKAVRDFFHENGFIEIHTPKIIATATEGGTELFPMKYFEEDAF-----------LAESPQL---YKEIMMASGLD-----RVYEIAPIFRAEEHNTTRHNEAWSIDSEMAFIED-----EVMSFLERLVAHAYVREHNAKELDILNFELERVSYDKALEILGDLGKEPWGEDIDTEGERLLGKYMMENENAPLYFLYQYPSEAKPFYIMKYDNKPEICRAFD-----------EYRGVEISSGGQ-REHRHDILVEQIKEKGLNPESFEFYLKAFRYGMPPHGGFGLGAERLIKQMLDLPNIRE...................................................................................................... 425
73 -10.4005x6c_A mol:protein length:553 O-phosphoserine--tRNA(Cys) ligase  ali model follow..  10  135.........................DIDEEKKERLREVLHLYKKGAIDGDDLVFEIAEMGLKVLETAFPEFKDLKPESTTLTLRSHMTSGWFITLSSLIKKRKLPLKLFSIDRCFRREQ-DRSHLMSYHS--ASCVVVGEDVSVDDGKVVAEGLLAQFGFTK-FKFKPDEKKSKYYTPETQTEVYAYHPKLGEWIEVATFGVYSPIALAKYNIDVERLAMIIYGYEDVRAMVYPQ---YEYRLSDRDIAGMIRVDKVPILDEFYNF-ANELIDICIANKDKESP--------EVKREFNFNGERRVIKV------KKLLGPSVLNEVYVYDGNIYGIPPTFEGVKEQYIPILKKAKEEGVSTNIRY-----------DGIIYKLVAKIEEALVSNVDEFK---FRVPIVRSLSDINLKIDELALKQIMGENK 536
74 -10.2003qne_A mol:protein length:485 Seryl-tRNA synthetase, cytoplasmic  ali model follow..  12  164YDPERGVRIVGHR-LRNYGVFLNQALINYGLSFLSSKGYVPLQAPVMMNKEVMAKT--AQLSQFDEELYKVIDGEDEKYLIATSEQPISAYHAGEWFESPAEQLPVRYAGYSSCFRREAGSHGRVHAFEKIEQFVLTEPEKSWEERMIGCSEEFYQSLGLPRVVGIVSGELNNAAAKK.............................................................................................................................................................................................................................................................. 351
75 -10.0002rhq_A mol:protein length:294 Phenylalanyl-tRNA synthetase alpha chain  ali model follow..  14  27LAEETIDVTLPSRQISIGSKHPLTRTVEEIEDLFLGLGYEIVDGYEVEQDYYNFEALNLPKSHPARDM---QDSFYITDEILMRTHTSPVQARTMEKRN--GQGPVKIICPGKVYRRDSDDATHSHQFTQIEGLVVDKNIKMSD---------------LKGTLELVAKKLFGADREIRLRPSYFPF--------------------------------------------------------------------TEPSVEVDVSCFKCKGKGCNVCKHTGWIEILGAGMVHPNVLEMAGFDSNEYSGFAFGMGPDRIAMLK.............................................................................................................. 260

FFAS is supported by the NIH grant R01-GM087218-01
1 2 6 4 6 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Rodrigues AP, Grant BJ, Godzik A, Friedberg I. The 2006 automated function prediction meeting. BMC Bioinformatics. 2007 May 22;8 Suppl 4:S1-4.