current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 5gro_A mol:protein length:115 Aspartate--tRNA(Asp/Asn) ligase, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .
# Score Template Links and tools%idFirst MAVGTMRSHFCTEISEKDVGKIVKVAGWCNTYRDHGGVVFIDLRDKSGLVQLVCDPSSKAYEKALEVRSEFVLVAKGKVRLRGAGLENPKLKTGKIEIVLEELIIENKSLast
1 -69.2005gro_A mol:protein length:115 Aspartate--tRNA(Asp/Asn) ligase  ali model  100  1MAVGTMRSHFCTEISEKDVGKIVKVAGWCNTYRDHGGVVFIDLRDKSGLVQLVCDPSSKAYEKALEVRSEFVLVAKGKVRLRGAGLENPKLKTGKIEIVLEELIIENKS 109
2 -56.8004gn3_B mol:protein length:113 OBody AM1L10  ali model follow..  27  4.SVYPKKTHWTAEITPNLHGTEVVVAGWVASLGDYGRVKIVKVSDREGGAAVSVYLEDHLFKVFAELSREDVVVIKGIVEASKA---AADMHNG-VEIFPSEIWILNKA 112
3 -56.1004gn4_B mol:protein length:108 OBody AM2EP06  ali model follow..  26  1.AVYPKKTHWTAEITPNLHGSEVVVAGWVAHLGDYGRVKIVKVSDREGGAAVPVYLEDHLFKVFAELSREDVVVIKGIVEASEQYGS-----ATGVEIFPSEIWILNKA 108
4 -55.7004gn5_A mol:protein length:113 OBody AM3L15  ali model follow..  26  1..VSPKKTHWTAEITPNLHGSEVVVAGWVAHLGDYGRVKIVKVSDREGGAAVPVYLERHLFKVFAELSREDVVVIKGIVEAGWPVAL-----DTGVEIFPSEIWILNKA 107
5 -54.8004gla_C mol:protein length:109 OBody NL8  ali model follow..  26  2.SVYPKKTHWTAEITPNLHGTEVVVAGWVASLGDYGRVKIVKVSDREGGAAVPVYLEAHLFKVFAELSREDVVVIKGIVEASK-------GVGRGVEIFPSEIWILNKA 107
6 -54.6004glv_B mol:protein length:107 OBody AM3L09  ali model follow..  26  1..VSPKKTHWTAEITPNLHGSEVVVAGWVAHLGDYGRVKIVKVSDREGGAAVPVYLEDHLFKVFAELSREDVVVIKGIVEATTVTRW-----DTGVEIFPSEIWILNKA 107
7 -45.2001efw_A mol:protein length:580 ASPARTYL-TRNA SYNTHETASE  ali model follow..  47  2.....RRTHYAGSLRETHVGEEVVLEGWVNRRRDLGGLIFLDLRDREGLVQLVAHPASPAYATAERVRPEWVVRAKGLVRLRPEP--NPRLATGRVEVELSALEVLAEA 103
8 -44.8001eqr_A mol:protein length:590 ASPARTYL-TRNA SYNTHETASE  ali model follow..  38  1.....MRTEYCGQLRLSHVGQQVTLCGWVNRRRDLGSLIFIDMRDREGIVQVFFDPDRDALKLASELRNEFCIQVTGTVRARDEKNINRDMATGEIEVLASSLTIINRA 105
9 -44.6004wj3_M mol:protein length:599 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  46  1..MGMMRSHYCGQLNESLDGQEVTLCGWVHRRRDHGGVIFLDVRDREGLAQVVFDPDRETFAKADRVRSEFVVKITGKVRLRPEGARNPNMASGSIEVLGYELEVLNQA 108
10 -43.4005w25_A mol:protein length:616 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  38  14.HVFVLRSHAAGLLREGDAGQQVTLAGWVARRRDHGGVIFIDLRDASGIAQVVFRDPTEVLAQAHRLRAEFCVSVAGVVEIRPEGNANPEIATGEIEVNATSLTVLGEC 123
11 -41.9004rmf_A mol:protein length:609 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  40  2.....LRTHAAGSLRPADAGQTVTLAGWVARRRDHGGVIFIDLRDASGVSQVVFREG-DVLAAAHRLRAEFCVAVTGVVEVRPEGNENPEIPTGQIEVNATELTVLGES 104
12 -41.4004o2d_A mol:protein length:620 Aspartate--tRNA ligase  ali model follow..  39  15..SMVLRTHAAGSLRPADAGQTVTLAGWVARRRDHGGVIFIDLRDASGVSQVVFREG-DVLAAAHRLRAEFCVAVTGVVEVRPEGNENPEIPTGQIEVNATELTVLGES 120
13 -40.4004ah6_A mol:protein length:617 ASPARTATE--TRNA LIGASE, MITOCHONDRIAL  ali model follow..  31  5FSSFVVRTNTCGELRSSHLGQEVTLCGWIQYRRQNT---FLVLRDFDGLVQVIIPQDASVKKILCEAPVESVVQVSGTVISRPAGQENPKMPTGEIEIKVKTAELLNAC 113
14 -35.8001wyd_A mol:protein length:429 hypothetical aspartyl-tRNA synthetase  ali model follow..  38  2.....YRSHFIADVTPEYDGKEVIWAGWVHLLRDLGGKKFIILRDKTGLGQVVVDKNSSAFGISQELTQESVIQVRGIVKADKRA-------PRGIELHAEEITLLSKA 98
15 -34.0001b8a_A mol:protein length:438 PROTEIN (ASPARTYL-TRNA SYNTHETASE)  ali model follow..  31  2.....YRTHYSSEITEELNGQKVKVAGWVWEVKDLGGIKFLWIRDRDGIVQITAPKKPELFKLIPKLRSEDVVAVEGVVNFTPKAKLG-------FEILPEKIVVLNRA 101
16 -33.4001x54_A mol:protein length:434 Asparaginyl-tRNA synthetase  ali model follow..  27  2.....IEKVYCQEVKPELDGKKVRLAGWVYTNMRVGKKIFLWIRDSTGIVQAVVAKNEETFEKAKKLGRESSVIVEGIVKADER-------APGGAEVHVEKLEVIQAV 101
17 -33.1004j15_A mol:protein length:521 Aspartate--tRNA ligase, cytoplasmic  ali model follow..  16  62..........VRDLTIQKADEVVWVRARVHTSRAKGKQCFLVLRQQQFNVQALVAVGKQMVKFAANINKESIVDVEGVVRKVNQKI--GSCTQQDVELHVQKIYVISLA 162
18 -30.3005xix_A mol:protein length:472 Asparagine--tRNA ligase, cytoplasmic  ali model follow..  25  39...............EGYRGQRVKVFGWVHRLRRQGKLMFLVLRDGTGYLQCVLADELCQCYNGVLLSTESSVAVYGMLNLTPKG----KQAPGGHELSCDFWELIGLA 129
19 -29.2003m4p_A mol:protein length:456 Asparaginyl-tRNA synthetase, putative  ali model follow..  23  14.....VETPIVCNIRDGLEGKLVTFKGWAYHIRKARKLIFVELRDGSGYCQCVIFGKECEPEKVKLLTRECSLEITGRLNAYAGKNHPPEIDILNLEMQVTEWKVIGES 122
20 -28.9001asy_A mol:protein length:490 ASPARTYL-tRNA SYNTHETASE  ali model follow..  17  34..............EAKDSDKEVLFRARVHNTRQQGALAFLTLRQQASLIQGLVKANKNMVKWAGSLNLESIVLVRGIVKKVDEPIKSAT--VQNLEIHITKIYTISET 133
21 -28.9003i7f_A mol:protein length:548 Aspartyl-tRNA synthetase  ali model follow..  16  48.....LKYTEIEELVPAMAEKTVTIRARVQAVRGKGNMVFLFLRKGIYTCQALVMKSKEFVQFCQKISAESICDITGIVKAVEKPI--EKATQQDVEIHVTSIAVVSLA 153
22 -28.8002xti_A mol:protein length:437 ASPARAGINYL-TRNA SYNTHETASE, CYTOPLASMIC, PUTATIVE  ali model follow..  23  9...............VKHRNERVCIKGWIHRMRRQGKLMFFILRDGTGFLQVLLMDKLCQTYDALTVNTECTVEIYGAIKEVPEG----KEAPNGHELIADFWKIIGNA 99
23 -27.6001n9w_A mol:protein length:422 aspartyl-tRNA synthetase 2  ali model follow..  28  9...............KAHVGQEVELLGFLHWRRDLGRIQFLLLRDRSGVVQVVTGGL-------KLPLPESALRVRGLVVENAK-------APGGLEVQAKEVEVLSPA 88
24 -20.1004up7_A mol:protein length:777 LYSINE--TRNA LIGASE  ali model follow..  22  32......VSITVPEFIAQVSDDIVSVAGRVLSKRSSSALMFIDLHDSQTKLQIMLNKSA--YENKEDFVSLTKMIYRGDICGFTGH--PTRTKTGELSLIPISGMILSPC 139
25 -17.6003a74_A mol:protein length:493 Lysyl-tRNA synthetase  ali model follow..  21  51..............ELEEQQIEVAVAGRIMTKRGMGKAGFAHIQDVTGQIQIYVRQDEQQYELFKISDLGDIVGVRGTM----------KTKVGELSIKVSSYEFLTKA 139
26 -17.5004ex5_A mol:protein length:529 Lysine--tRNA ligase  ali model follow..  19  75..............ALEAKSLEVAIAGRMMLKRVMGKASFATVQDGSGQIQFFVTPAAETYDAFKKWDLGDIVAARGVL----------RTNKGELSVKCTQLRLLAKA 163
27 -16.9001bbu_A mol:protein length:504 PROTEIN (LYSYL-TRNA SYNTHETASE)  ali model follow..  30  59..............ELEALNIEVAVAGRMMTRRIMGKASFVTLQDVGGRIQLYVARDGVYNEQFKKWDLGDILGAKGKL----------KTKTGELSIHCTELRLLTKA 148
28 -16.8001e1o_A mol:protein length:504 LYSYL-TRNA SYNTHETASE, HEAT INDUCIBLE  ali model follow..  24  59..............ELESLNIEVSVAGRMMTRRIMGKASFVTLQDVGGRIQLYVARDGVYNDQFKKWDLGDIIGARGTL----------KTQTGELSIHCTELRLLTKA 148
29 -14.9003bju_A mol:protein length:521 Lysyl-tRNA synthetase  ali model follow..  20  48............QPGDHLTDITLKVAGRIHAKRASGGLIFYDLRGEGVKLQVMANSREEFIHINNKLRRGDIIGVQGNP----------KTKKGELSIIPYEITLLSPC 141
30 -14.5005vl1_A mol:protein length:506 Lysine--tRNA ligase  ali model follow..  20  54..............TDSATEDIVGVAGRVVFARNTGKLCFATLQDGDGTLQAMISLDEVGRESLDRVDIGDVVYVHGTV----------SSRRGELSVLADSWRMAAKA 144
31 -14.5001nnx_A mol:protein length:109 Protein ygiW  ali model follow..  16  24......SVTTVESAKSLRDDTWVTLRGNIVERISDDLYVF---KDASGTINVDIDHKR----NGVTVTPKDTVEIQGEV----------DKDWNSVEIDVKQIRKVNP. 109
32 -14.5005hgq_A mol:protein length:524 Lysine--tRNA ligase  ali model follow..  18  50............EKDVILNDIVQSVAGRVFSKRESGGLIFYDLHGEGTRLQVLANAREAFDNLHDRIKRGDIIGVNGYP----------RSKSGELSIIPYEIIQLTPC 143
33 -14.5004ycv_A mol:protein length:516 Lysine--tRNA ligase  ali model follow..  19  50..............GEHLEDTILNITGRIMRVSASGQLRFFDLVGDGEKIQVLANYSFNFAECYDKIRRGDIVGIVGFP----------KSKKGELSIFPKETILLSAC 142
34 -14.4006chd_A mol:protein length:597 Lysine--tRNA ligase  ali model follow..  20  116............QPGDHLTDITLKVAGRIHAKRASGGLIFYDLRGEGVKLQVMANSREEFIHINNKLRRGDIIGVQGNP----------KTKKGELSIIPYEITLLSPC 209
35 -14.3006aqh_A mol:protein length:508 Lysine--tRNA ligase  ali model follow..  19  57..............VDARTGEIVGVTGRVVFARNSGKLCFATLQEGDGTLQAMISLAEVGQEALDNVDIGDIVFVHGEV----------TSKRGELSVLADSWQMAAKA 147
36 -14.0005eln_A mol:protein length:535 Lysine--tRNA ligase  ali model follow..  15  57............ENGYIDKDTTLSLSGRVTSIRSSSSLIFYDIFCEEQKVQIIANIMGEFSVSHSEIRRGDVVGFTGFP----------KSKRGELSLFSKSVVLLSPC 151
37 -13.1003kf6_A mol:protein length:159 Protein stn1  ali model follow..  14  48....................RWIQIVGYIAAIDIYEGKHVLTVDDCSGMVLRVVQDDFSMSKRAISMSPGNVVCVFGKINS-----------RSEVELIAQSFEELRDP 129
38 -12.8004joi_A mol:protein length:166 CST complex subunit STN1  ali model follow..  14  37....................KQVDVLGTVIGVRERDAFYSYGVDDSTGVINCICKKLQETIEQKTKIEIGDTIRVRGSIRT-----------REEREIHATTYYKVDDP 140
39 -12.2004gnx_B mol:protein length:136 Putative uncharacterized protein  ali model follow..  15  37....................GQLTFVAVVRNISRNATNVAYSVEDGTGQIEVRLDSSSDDSSKASEIRNNVYVRVLGTLKS-----------QNRRSISSGHMRPVID. 116
40 -11.9002pi2_A mol:protein length:270 Replication protein A 32 kDa subunit  ali model follow..  12  72....................SQVTIVGIIRHAEKAPTNIVYKIDDMTAAPMDVRVDTDDTSSENTVVPPETYVKVAGHLRS-----------QNKKSLVAFKIMPLED. 151
41 -9.9903nbh_B mol:protein length:147 RecQ-mediated genome instability protein 2  ali model follow..  12  56....................AAVWMQGRVVMADRGE----ARLRDPSGDFSVRGLERVP--RGRPCLVPGKYVMVMGVVQA-----------SPEPCLQAVKMTDLSDN 128
42 -9.7303mxn_B mol:protein length:150 RecQ-mediated genome instability protein 2  ali model follow..  12  59....................AAVWMQGRVVMADRGE----ARLRDPSGDFSVRGLERVP--RGRPCLVPGKYVMVMGVVQA-----------SPEPCLQAVKMTDLSDN 131
43 -9.6205ihe_A mol:protein length:475 DNA polymerase II small subunit  ali model follow..  21  111..........IGKLNYVSGDEEVTIIGLVNSKRETNRGLIFEVEDKTGIVKVFLPKDSEDYREAFKVLPDAVVAFKGFYSK............................ 181
44 -9.4902pi2_E mol:protein length:142 Replication protein A 14 kDa subunit  ali model follow..  25...........AGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDGEG-KNGTIELMEPL-------DEEISGIVEVVGRVTAKATILCTSYVQFKDLGLYNEAVKIIHD. 119
45 -9.4603kf8_A mol:protein length:220 Protein stn1  ali model follow..  86....................NQINIFGKIEFNGVEESYVILVISDFIGIDSKIREQFKEVGLTLDKKNYGKIVELEGEIYN-----------YDSINVSKKPDRELK.. 175

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 7 6 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Awobuluyi M, Yang J, Ye Y, Chatterton JE, Godzik A, Lipton SA, Zhang D. Subunit-specific roles of glycine-binding domains in activation of NR1/NR3N-methyl-D-aspartate receptors. Mol Pharmacol. 2007 Jan;71(1):112-22. Epub 2006 Oct 17.