current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 5k1p_A mol:protein length:274 Pyrrolysine--tRNA ligase, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .
# Score Template Links and tools%idFirst MPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLAFAQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNLLast
1 -117.0005k1p_A mol:protein length:274 Pyrrolysine--tRNA ligase  ali model  100  1MPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLAFAQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL 268
2 -107.0004q6g_A mol:protein length:267 Pyrrolysine--tRNA ligase  ali model follow..  97  1.PALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMVAPNIFNYARKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFFQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCSVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL 267
3 -99.8004tqd_A mol:protein length:291 Pyrrolysine--tRNA ligase  ali model follow..  99  19.PALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLSFIQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL 285
4 -99.0002e3c_A mol:protein length:291 Pyrrolysyl-tRNA synthetase  ali model follow..  98  19.PALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSGSYYNGISTNL 285
5 -98.4004cs2_A mol:protein length:274 PYRROLYSINE--TRNA LIGASE  ali model follow..  98  1MPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLANYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVFGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL 268
6 -95.1003qtc_A mol:protein length:290 Pyrrolysyl-tRNA synthetase  ali model follow..  98  17..ALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLTPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLVFWQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVFGDTLDVMHGDLELSSALVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL 282
7 -93.4004bw9_A mol:protein length:291 PYRROLYSINE--TRNA LIGASE  ali model follow..  98  20..ALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLGNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVFGDTLDVMHGDLELSSAVVGPRPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL 285
8 -72.8002zni_A mol:protein length:308 Pyrrolysyl-tRNA synthetase  ali model follow..  41  26.SFWTKVQYQRLKELNASGEQLELSRDRAFQGIEHQLMSQGKRHLEQLRTVKHRPALLELEEKLAKALHQQGFVQVVTPTIITKSALAKMTIGEDHPLFSQVFWLDGKKCLRPMLAPNLYTLWRELERLWDKPIRIFEIGTCYRKESQGAQHLNEFTMLNLTELGTPLEHQRLEDMARWVLEAAGIEFELVTESSVVYGDTVDVMKGDLELASGAMGPHFLDEKWEIFDPWVGLGFGLERLLMIREGTQHVQSMARSLSYLDGVRLNI 301
9 -54.1001b70_A mol:protein length:350 PHENYLALANYL-TRNA SYNTHETASE  ali model follow..  13  48.RKRGQELNAIKAALEAALEAREKALEEAALKEALERERVDVSLPGASLFSGGLHPITLMERELVEIFRALGYQAVEGPEVESEFFFDALNIPEHHPARDMWDTFEGRLLLRTHTSPMQVRYMVAH----TPPFRIVVPGRVFRFEQTDATHEAVFHQLEGLVVGEGIAMAHLKGAIYELAQALFGPDSRFQPVYFPFVEPGAQFAKWLELGGAGMVHPKVFQAVDAYREGFAFGLGVERLAMLRYGIPDIRYFFGGRLKF....... 342
10 -52.8002rhq_A mol:protein length:294 Phenylalanyl-tRNA synthetase alpha chain  ali model follow..  13  3....SSSSGLVPRGSHMGTELMEKLNQQ------LAEETIDVTLPSRQISIGSKHPLTRTVEEIEDLFLGLGYEIVDGYEVEQDYYFEALNLPKSHPARDMQDSFTDEILMRTHTSPVQARTMEKRNG--QGPVKIICPGKVYRRDSDDATHSHQFTQIEGLVVDKNIKMSDLKGTLELVAKKLFGAEIRLRPSYFPFTEPSVEVDGWIEILGAGMVHPNVLEMAGFDSNGFAFGMGPDRIAMLKYGIEDIRYFYTNDVRF....... 276
11 -51.3003l4g_A mol:protein length:508 Phenylalanyl-tRNA synthetase alpha chain  ali model follow..  17  182......STSISKQETELSPEMISSGSWRDRPFKPYNFLAHGVL-----PDSGHLHPLLKVRSQFRQIFLEMGFTEMTDNFIESS--FDALFQPQQHPARDQHDTFARKNLLRTHTTSASARALYRLAQKPFTPVKYFSIDRVFRNETLDATHLAEFHQIEGVVADHGLTLGHLMGVLREFFTKLGITQLRFKPAYNPYTEPSMEVFKWVEVGNSGVFRPEMLLPMGLPENVIAWGLSLERPTMIKYGINNIRELVGHKVNL....... 484
12 -50.6003pco_A mol:protein length:327 Phenylalanyl-tRNA synthetase, alpha subunit  ali model follow..  12  62....EAKEQVQQALNARKAELESAALNARLAAETIDVSLPGRR-----IENGGLHPVTRTIDRIESFFGELGFTVATGPEIEDDYHFDALNIPGHHPARADHDTFDTTRLLRTQTSGVQIRTMKAQ-----QPPIRIIAPGRVYRNDYDQTHTPMFHQMEGLIVDTNISFTNLKGTLHDFLRNFFEEDLRFRPSYFPFTEPSAEVDKWLEVLGCGMVHPNVLRNVGIDPEGFAFGMGMERLTMLRYGVTDLRSFFENDLRF....... 322
13 -48.4004p71_C mol:protein length:338 Phenylalanine--tRNA ligase alpha subunit  ali model follow..  14  54.PKVGALINVAKEKVQDVLNARKTELEGAALAARLAAERIDVTLPGRGQLSGGLHPVTRTLERIEQCFSRIGYEVAEGPEVEDDYHFEALNIPGHHPARAMHDTFNANMLLRTHTSPVQVRTMESQ----QPPIRIVCPGRVYRCD-SDLTHSPMFHQVEGLLVDEGVSFADLKGTIEEFLRAFFEKQLRFRPSFFPFTEPSAEVDGWLEVMGCGMVHPNVLRMSNIDPEGFAFGMGAERLAMLRYGVNDLRLFFDNDLRF....... 333
14 -45.3005x6c_A mol:protein length:553 O-phosphoserine--tRNA(Cys) ligase  ali model follow..  13  79...FEEMINPVIVDEMEIYKQFGPEAMAVLDRCFYLAGLPRPDVGLGNEKVEIIKNLGIDIDEEKKERLREVLHLYKKGAIDGDDLAKALNVSNEMGLKVLETAFSTTLTLRSHMTSGWFITLSSLIKKRKLPLKLFSIDRCFRREQEDRSHLMSYHSASCVVVGEDVSVDDGKVVAEGLLAQFGFTKFKFDEKKSKYYTPETQTEEWIEVATFGVYSPIALAKYNIDVPVMNLGLGVERLAMIIYGYEDVRAMVYPQFYE....... 361
15 -42.8002du3_A mol:protein length:534 O-phosphoseryl-tRNA synthetase  ali model follow..  14  1...MKFDPQKYRELAEKDFEAAWKAGKEILAERSPNELYPRVG-----FSFGKEHPLFATIQRLREAYLSIGFSEVVNPLIVEDVHVKKQFGREALAVLDRCFPISSTLTLRSHMTTGWFITLSHIADKLPLPIKLFSIDRCFRREGEDATRLYTYFSASCVLVDEELSVDDGKAVAEALLRQFGFENFRKDEKRSKYYIPDTQTEGWIEIATFGIYSPTALAEYDIPYPVMNLGLGVERLAMILYGYDDVRKMVYPQIHG....... 353
16 -42.6003hrk_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  16  1................MAMGTLEAQTQGPGSMQKNMVETEPVQGCRDFPPEAMRC-RRHLFDVFHATAKTFGFEEYDAPVLESEELYIRKAGEETEQMFNFITKGGHRVALRPEMTPSLARLLLGKGRSLLLPAKWYSIPQCWRYEAITRGRRREHYQWNMDIVGVKSVSAEVECAACWAMRSLGLDVGIKVNSRKVLQTVVEQAGVTSDKFAPVCVIVDKMEKIPREE....................................... 218
17 -42.1002el9_A mol:protein length:431 Histidyl-tRNA synthetase  ali model follow..  12  4..............................YQDPMAKNIQAIRGMNDYLPGETAI-WQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTDVVEKEMYTFGDSLTLRPEGTAGCVRAGIEHGLLYNQEQRLWYIGPMFRHERPQKGRYRQFHQLGCEVFGLQGPDIDAELITARWWRALGISETLELNSIGSLEARANYRDALVAFLEQHKEKLDEDCKRRMYT---------NPLRVLDSKNPEVQALLND........... 228
18 -41.7003hri_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  17  1................MAMGTLEAQTQGPGSMQMNMVETEPVQGCRDFPPETMR-LRKYLFDVFHSTARKFGFEEYDSPVLESEELYIRKAGEETEQMFNFITKGGHRVALRPEMTPSLARQLLAKGRSLLLPAKWYSIPQCWRYEAITRGRRREHYQWNMDIIGVKSVSSEVECAACTAMQSLGLSSKDVG--------------------------VKINSRKILQTVVEQAGVSADKFAPVCVIVDKMEKLPREEVVAQLAAIGL 228
19 -41.6005e3i_A mol:protein length:438 Histidine--tRNA ligase  ali model follow..  12  1.................................MAMSSIVAIKGFNDVLPTQTAA-WRRLEQHLASLMDAYGYQQIRLPIVEQTGLFKRAIGDATDIVEKEMYTFPESLTLRPEGTAGCVRALVEHNLLRGATPRVWYMGPMFRYEKPQKGRYRQFHQFGVETFGVATPDIDAELITARLWKRMGVDHQLELNTLGETDERTEYRNALVAFLNEHKDALDEDSQRRLTT---------NPLRILDSKIESTQKILEN........... 224
20 -40.8004rdx_A mol:protein length:423 Histidine--tRNA ligase  ali model follow..  14  1..................................GPMTARAVRGTKDLFGKELRM-HQRIVATARKVLEAAGALELVTPIFEETQVFEKGVGAATDIVRKEMFTFGRSLTLRPEGTAAMVRAYLEHMKVWPQPVRLWMAGPMFRAERPQKGRYRQFHQVNYEALGSENPILDAEAVLYECLKELGLRRKVKLSSVGDPEDRARYNAYLREVLSPHREALSEDSKERLEL---------NPMRILDSKSERDQALLKE........... 221
21 -40.4003od1_A mol:protein length:400 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  14  2..............................NAMSKPFMFEKPFGMRDTLPEWYKT-KKNICDQMTEEINLWGYDMIETPTLEYYETVGVVSAILDQQLFKLLDQQGNTLVLRPDMTAPIARLVASSLKDRAYPLRLAYQSNVYRAQQNEGGKPAEFEQLGVELIGDGTASADGEVIMIAALKRAGLEFKVAIGHVGYVNALLMDVVGNEQRADRLRRFLYEKNYVGYRE--------VKSLNLSTIDKSRLMNL.............. 220
22 -40.3001qe0_A mol:protein length:420 Histidine--tRNA ligase  ali model follow..  15  1.....................................MIKIPRGTQDILPEDSKK-WRYIENQLDELMTFYNYKEIRTPIFESTDLFARGVGDSTDVVQKEMYTFDRSITLRPEGTAAVVRSYIEHKGNPNQPIKLYYNGPMFRYERKQKGRYRQFNQFGVEAIGAENPSVDAEVLVMHIYQSFGLKHKLVINSVGDMASRKEYNEALVKHFEPVIHEFCSDCQSRLHT---------DPMRILDCKVDRDKEAIKT........... 219
23 -40.2004e51_A mol:protein length:467 Histidine--tRNA ligase  ali model follow..  12  1.............MAMGTLEAQTQGPGSMTEQKRKLEKLTGVKGMNDILPQDAGL-WEFFEATVKSLLRAYGYQNIRTPIVEHTPLFTRGIGEVTDIVEKEMYSFGENLTLRPENTAAVVRAAIEHNMLYDGPKRLWYIGPMFRHERPQRGRYRQFHQVGVEALGFAGPDADAEIVCQRLWEDLGLTGKLEINSLGLAEERAAHRVELIKYLEQHADKLDDDAQRRLYTNPL.................................... 226
24 -39.6001wu7_A mol:protein length:434 Histidyl-tRNA synthetase  ali model follow..  13  1.................................MYRLQIEKIRGFRDFYPEDMDV-EKFIFKTAEEAAEAFGFRRIDFPSLEYLDLYRIKSGEELQQTYSFVDKGGREVTLIPEATPSTVRMVTSR-KDLQRPLRWYSFPKVWRYEEPQAGRYREHYQFNADIFGSDSPEADAEALASSILDRLGLQDEIRINSRKIMEEIIGGMTS-PFSVFSIIDRYHKISREEFVDQLRSAGIGEDGVSMIADLCSGTRGIDE............ 227
25 -38.4004g85_A mol:protein length:517 Histidine-tRNA ligase, cytoplasmic  ali model follow..  13  29VRGLKQQKASAELIEEEVAKLLKLKAQLGPDESKQKFVLKTPKGTRDYSPRQMA-VREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAMNKLT---NIKRYHIAKVYRRDNPARGRYREFYQCDFDIAGNFDPMAECLKIMCEILSSLQIDFLVKVNDRRILDGMFAICGVSDSKFRTICSSVDKLDKVSWEE....................................... 259
26 -37.7003rac_A mol:protein length:373 Histidine-tRNA ligase  ali model follow..  14  7......................TRSAWGARAWEAVRGFADRPPGMQDGYPDFAKR-RRAVETRLLSFVEDAGYEPVTSGLFEYVDTLLRARSPESRDWIRLFDGGGDAVALRPEMTPSIARMAAPRVAAGRTPIRWCYCERVYRRTSWASGKAAESTQVGIERIGEEASVMDVLRLLHEASAAAGVHHRIVVSHARLVPRLLDALGISASLSRAFLACLTSGNYVQFRE....................................... 223
27 -37.4003net_A mol:protein length:465 Histidyl-tRNA synthetase  ali model follow..  11  1...........................SNAMAKNDKINFSTPSGFPEFLPSEKR-LELYLLDTIRRVYESYGFTPIETPAVERLEVLQAKGNQGDNIIDKSGDTGSEARALKFDQTVPLAAYIARHLNDLTFPFARYQMDVVFRGERAKDGRFRQFRQCDIDVVGREKLSAQMPAIITEIFEAVNIGDFVIR----------------------------INNRKVLTGFFQSLNISETQIKSCISIIDNLEKIGEAKVKLELEKEGI 231
28 -37.0001z7m_A mol:protein length:344 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  13  1.......................MRGSGSIEGRMEKINYLLPEESAEMTLNQVKS-LRQIEGRLRKLFSLKNYQEVMPPSFEYTQLYTALESNGKTFNQEKMFQFGQSITLRYDFTLPLVRLYSQIKD--STSARYSYFGKIFRKEKRHKGRSTENYQIGIELFGESADKSELEILALQVIEQLGLNKVFEIGSAKFFQRLCQLADGSTELLTELLLKKDLS--------------GLNAFIEKNNFSKELRGL.............. 221
29 -37.0004g84_A mol:protein length:464 Histidine--tRNA ligase, cytoplasmic  ali model follow..  15  6..............................FELRRQFVLKTPKGTRDYSPRQMA-VREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAMNKLT---NIKRYHIAKVYRRDNPTRGRYREFYQCDFDIAGNFDPMAECLKIMCEILSSLQIDFLVKVNDRRILDGMFAICGVSDSKFRTICSSVDKLDKVSWEE....................................... 206
30 -32.7006FTT Entity 1(prereleased)  ali follow..  12  4.........................................PDGVADVLFEDAHK-QEVLRHQLTQQLITHGYQLVSPPMIEFTESLLSGASEDKRQTFKIIDQLTRLMGIRADITPQILRIDAHHGG--DGIARYCYAGDVIHTLPSGLFGSRTPLQLGAEIFGCESIAADIELILFSMINSLDMSAVLHVD........................................................................... 156
31 -32.7005m8h_A mol:protein length:388 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  12  4.........................................PDGVADVLFEDAHK-QEVLRHQLTQQLITHGYQLVSPPMIEFTESLLSGASEDKRQTFKIIDQLTRLMGIRADITPQILRIDAHHGG--DGIARYCYAGDVIHTLPSGLFGSRTPLQLGAEIFGCESIAADIELILFSMINSLDMSAVLHVD........................................................................... 156
32 -32.4003cmq_A mol:protein length:415 Phenylalanyl-tRNA synthetase, mitochondrial  ali model follow..  14  1MAAECATQRAPGSVVELLGKSYPQDDHSNLTRKVLTRVGRNLH-------NQQHHPLWLIKERVKEHFYKQYVGRFGTPLFSVYDNLSPVVTTWQNPADHPSRKKGDNYYLNRTHMLRAHTSAHQWDLLHAGLDAFLVVGDVYRRDQIDSQHYPIFHQLEAVRLAVKLVEFDLKQTLTRLMAHLFGDELEIVDCYFPFTHPSFEMEEWLEVLGCGVMEQQLVNSAGAQDRGWAFGLGLERLAMILYDIPDIRLFWCEDERF....... 303
33 -30.1003g1z_A mol:protein length:326 Putative lysyl-tRNA synthetase  ali model follow..  18  15...................................................PNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLFPFETRFVGPGHSQGINLYLMTSPEYHMKRLLAAGCG------PVFQLCRSFRNEEMGRHHNPEFTMLEWYRPHYDMYMNEVDDLLQQVLAQISTEDHRVAERFEVYYKGIELANGFHELTDAREQQQRFEQDNRKRPDCSGVALGVDRLVMLALGAESLADV.............. 318
34 -29.9001usy_A mol:protein length:275 ATP PHOSPHORIBOSYLTRANSFERASE REGULATORY SUBUNIT  ali model follow..  16  6.........................................................FEKVFSFYSKATKKGFSPFFVPALEKAEEPA---------GNFFLDRKGNLFSIREDFTKTVLNHRKRYSP--DSQIKVWYADFVYRYSG---SDLVAEYQLGLEKVPRNSLDDSLEVLIVESASEFFEGPVIV............................................................................. 127
35 -29.8003a5y_A mol:protein length:345 Putative lysyl-tRNA synthetase  ali model follow..  16  2............................GSSSSGLVPRGSHMSETASWQPSASIPNRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLVPFETRFVGPGHSQGMNLWLMTSPEYHMKRLLVAGCG------PVFQLCRSFRNEEMGRYHNPEFTMLEWYRPHYDMYMNEVDDLLQQVLAQISTEDHRVAERFEVYYKGIELANGFHELTDAREQQQRFEQDNRKRPDCSGVALGVDRLVMLALGAETLAEV.............. 331
36 -27.9003ig2_A mol:protein length:213 Phenylalanyl-tRNA synthetase beta chain  ali model follow..  17  1...................................................SNADKSNKLQNLVAEQLVGCGFNEILNNSLTRAAYYDGLESYPSKNLVMLLNPLSADLCMRQTLLFGGLESIAHNANRKNADLKFFEFGNCYHFDAEKKNPEKEDYHLGLWVTGENTSVYELKAYVENIFKRLGLDLHSLVVGNLS-TALTVNTKGGKRLATFGVVTKKMLKAFDVDNEVYYADLNWKELM.......................... 213
37 -27.6003ica_A mol:protein length:213 Phenylalanyl-tRNA synthetase beta chain  ali model follow..  17  1...................................................SNADRRYKWQTVVSEQLVGAGFNEILNNSLTAGSYYEGLKSHPREMAVELMNPLSQELCMRQTLLFGGLETLSHNLRRKHLSLYLFEWGKCYRFHAAKRTDETEDDRLGIWICGEPTSVFELKAVVEQVLCRVGIETGAYTLKTAD-SAMEVKTRSGKLLGTFGTVSTELIKRFEIEQPVYFAELLWDALM.......................... 213
38 -26.9003bju_A mol:protein length:521 Lysyl-tRNA synthetase  ali model follow..  17  122.......KTKKGELSIIPYEITLLSPHFGLKDKETRYRQRYLDLILNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNII-----PGGAVAKPFITYHNELDMNLYMRIAPELYHKMLV------VGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYAD--YHDLMEITEKMVSGMVKSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKAKPPTAGWGMGIDRVAMFLTDSNNIKEV.............. 499
39 -26.8005hgq_A mol:protein length:524 Lysine--tRNA ligase  ali model follow..  19  124.......RSKSGELSIIPYEIIQLHTHFGLKNQETRYRMRYLDLIMNPDVKNRFVTRSRMISFLRRYLDNLGFLEVETPMMNLI-----AGGATAKPFITHHNDLDMDLYLRVAPELYLKMLV------VGGIDRVYEIGRVFRNEGIDQTHNPEFTSCEFYMAYAD--YEDLMKITEDMLARMVYSIPGLTERFELFVVTKEIVNAYTELNDPLTQRLRFDEQAKQKPPTAGWGMGIDRLAMILTDSNNIKEV.............. 502
40 -26.7001e1o_A mol:protein length:504 LYSYL-TRNA SYNTHETASE, HEAT INDUCIBLE  ali model follow..  17  129.......KTQTGELSIHCTELRLLTKFHGLQDQEVRYRQRYLDLIANDKSRQTFVVRSKILAAIRQFMVARGFMEVETPMMQVI-----PGGASARPFITHHNALDLDMYLRIAPELYLKRLV------VGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYAD--YHDLIELTESLFRTLAQVNPEITDRFEFFIGGREIGNGFSELNDAEDQAERFQEQVNAKPPTAGLGIGIDRMIMLFTNSHTIRDV.............. 494
41 -26.5005eln_A mol:protein length:535 Lysine--tRNA ligase  ali model follow..  17  132.......KSKRGELSLFSKSVVLLTAISGLKDQEVRYRQRYLDLMLNEESRKVFKLRSRAIKYIRNYFDRLGFLEVETPMLNMI-----YGGAAARPFITYHNELETQLYMRIAPELYLKQLI------VGGLDKVYEIGKNFRNEGIDLTHNPEFTAMEFYMAYAD--YYDLMDLTEELISGLVLEKPEMTERFELFVLGKELCNAYTELNEPLQQRKFFEQQADAKPPTGGWGLGIDRLIMFLADKNNIKEV.............. 507
42 -26.5001bbu_A mol:protein length:504 PROTEIN (LYSYL-TRNA SYNTHETASE)  ali model follow..  16  129.......KTKTGELSIHCTELRLLDKFHGLQDQEARYRQRYLDLISNDESRNTFKVRSQILSGIRQFMVNRGFMEVETPMMQVI-----PGGAAARPFITHHNALDLDMYLRIAPELYLKRLV------VGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYAD--YKDLIELTESLFRTLAQVNPEITDRFEFFIGGREIGNGFSELNDAEDQAQRFLDQVAAKPPTAGLGIGIDRMVMLFTNSHTIRDV.............. 494
43 -26.5003a74_A mol:protein length:493 Lysyl-tRNA synthetase  ali model follow..  15  120.......KTKVGELSIKVSSYEFLEKYHGLKDIEQRYRQRYLDLIMNPESKKTFITRSLIIQSMRRYLDSHGYLEVETPMMHAV-----AGGAAARPFITHHNALDMTLYMRIAIELHLKRLI------VGGLEKVYEIGRVFRNEGISTRHNPEFTMLELYEAYAD--FRDIMKLTENLIAHIA-DDPRFTDRFELFIVGREHANAFTELNDPIDQRQRFEEQLKERPPTGGLGIGVDRLVMLLTNSPSIRDV.............. 484
44 -26.5003p8t_A mol:protein length:294 AsnS-like asparaginyl-tRNA synthetase related protein  ali model follow..  23  12..................................................YKAIDIQTKILDYMTKFFTDRGFKWLLPIMLSPITDPLWPDPAGEGIRPAEVDVYGVRMRL------THSMILHKQLAIAMGLEKIFVLSPNIRLESRRKRHSYEFTQLDFEIEGAK--MKDVMRLIEELIYGLFRKAEEWTGREFPRARHFKVYDGYGEVSSGGEREWEYEKRAGKLKPSAGAGIGVERLVRFIVGAKHIAEV.............. 281
45 -26.2004ex5_A mol:protein length:529 Lysine--tRNA ligase  ali model follow..  17  144.......RTNKGELSVKCTQLRLLDKFHGLADQETRYRQRYVDLIVTPETRTTFRARTKAIASIRKFMGDADFMEVETPMLHPI-----PGGAAAKPFVTHHNALDMEMFLRIAPELYLKRLI------VGGFERVFEINRNFRNEGVSPRHNPEFTMMEFYAAYTD--YRWLMDFTERLIRQAAVTVAGITERFELFITGREIANGFSELNDPEDQAARFKKQVEQKPPTGGCGIGIDRLVMLLTDSPTIRDV.............. 513
46 -25.9001nnh_A mol:protein length:294 asparaginyl-tRNA synthetase-related peptide  ali model follow..  22  12..................................................SPTLDIQTKILEYMTDFFVKEGFKWLLPVIISPITDPLWPDPAGEGMEPAEVEIYGVKMRL------THSMILHKQLAIAMGLKKIFVLSPNIRLESRQKRHAYEFTQLDFEVERAK--MEDIMRLIERLVYGLFRKAEEWTGREFPKTKRFEVFEGYGEVASGGEREWEYEKKAGKLKPSAGAGIGVERLVRFIVGAKHIAEV.............. 281
47 -25.8004ycv_A mol:protein length:516 Lysine--tRNA ligase  ali model follow..  18  123.......KSKKGELSIFPKETILLSAKYGLKDTEIRYRQRYLDLLINESSRHTFVTRTKIINFLRNFLNERGFFEVETPMMNLI-----AGGANARPFITHHNDLDLDLYLRIATELPLKMLI------VGGIDKVYEIGKVFRNEGIDNTHNPEFTSCEFYWAYAD--YNDLIKWSEDFFSQLVYTKPGLTERLEMFICGKEVLNAYTELNDPFKQKECFKLQQKDRPPTGGLGLGIDRITMFLTNKNSIKDV.............. 498
48 -25.5006chd_A mol:protein length:597 Lysine--tRNA ligase  ali model follow..  17  190.......KTKKGELSIIPYEITLLSPHFGLKDKETRYRQRYLDLILNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNII-----PGGAVAKPFITYHNELDMNLYMRIAPELYHKMLV------VGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYAD--YHDLMEITEKMVSGMVLEVTCINPTFICLTERFELFVMKKEICNAYTELND-DEAMFIDENFCGWGMGIDRVAMFLTDSNNIKEV.............. 567
49 -25.1006aqh_A mol:protein length:508 Lysine--tRNA ligase  ali model follow..  21  159...............................SEESRVRQRYVDLIVRDQARKVARQRIAVMRAIRSALERRGFLEVETPMLQTL-----AGGAAARPFVTHSNALDTELYLRIAPELFLKRCL------VGGFERVFELNRVFRNEGADSTHSPEFVMLETYQAYGT--YDDSAVVTRELIQEV.................................................................................... 298
50 -25.0005vl1_A mol:protein length:506 Lysine--tRNA ligase  ali model follow..  21  156...............................SEESRVRQRYVDLIVRPQAREVARQRIAVIRAVRNALERRGFLEVETPMLQTL-----AGGAAARPFVTHSNALDIDLYLRIAPELFLKRCI------VGGFDRVFELNRVFRNEGSDSTHSPEFSMLETYQTYGT--YDDSALITRELIQEV.................................................................................... 295
51 -23.6004h2w_A mol:protein length:346 Amino acid--[acyl-carrier-protein] ligase 1  ali model follow..  15  5SSGLVPRGSHMNIAVLPNSPDTAPQIADPLDHLADKLFHSMGSDGVYARTALYESIVERLAALITS-HREAGTEALRFPPVMSRAQLEKSGSRFDAGGDWTTSLSPADLVLSPAACYPVYPIAASRGPLPKGGLRFDVAADCFRRESKHLDRLQSFRMREYVCIGTPDDVSDWMVRAQAIARDLGLTFRVDYASDPFFGRAGKMLEQPTACMSFNYHREHFGTTWGIQDA--CVAFGMDRLAVAMFH-AKVRDILGLQ.......... 327
52 -23.6004j15_A mol:protein length:521 Aspartate--tRNA ligase, cytoplasmic  ali model follow..  18  181.......................EEEGRATVNQDTRLDNRVID-LRTSTSQAVFRLQSGICHLFRETLINKGFVEIQTPKIISAA-----SEGGANVFTVSYFKNNAYLAQSPQ--------LYKQMCICADFEKVFSIGPVFRAEDSNTRHLTEFVGLDIEMAFNY-HYHEVMEEIADTMVQI---YTMPDPRNPKQSNSYDMFMRGEEILSGAQRIHDPQLHHGIDLEKIGGGIGLERVTMLFLGLHNVRQT.............. 503
53 -23.5004up7_A mol:protein length:777 LYSINE--TRNA LIGASE  ali model follow..  19  134.............MILSPCLHMLPSMHYGLGDQETRFRKRYLDLIVNPESVKNFVLRTKVVKAVRKYLDDKGFLEVETPILNT-----IPGGATARPFITHHNQLDIQMYMR--IAPELYL----KELVVGGINRVYEIGRLFRNEGIDQTHNPEFTTCEFYMAYAD--YNDIMKMTEELLGNM.................................................................................... 291
54 -23.2001asy_A mol:protein length:490 ASPARTYL-tRNA SYNTHETASE  ali model follow..  18  151......................AEAAGLPVVNLDTRLDYRVID-LRTVTNQAIFRIQAGVCELFREYLATKKFTEVHTPKLLGAP-----SEGGSSVFEVTYFKGKAYLAQSPQ--------FNKQQLIVADFERVYEIGPVFRAENSNTRHMTEFTGLDMEMAFEE-HYHEVLDTLSELFVFIFSEYTMPDPANPKYSNSYDFFMRGEEILSGAQRIHDHAKAHGLSPPHAGGGIGLERVVMFYLDLKNIRRA.............. 478
55 -23.2003l4g_B mol:protein length:589 Phenylalanyl-tRNA synthetase beta chain  ali model follow..  12  335..YLKSEVIGDGNQIEIEIPPTRADIIHACDIVEDAAIAYGYNNIQMTLPKANQFPLNKLTELLRHDMAAAGFTEALTFALCSQEDIADKLGSATKAVHISNPKTAEFQVARTTLLPGLLKTIAANRKM-PLPLKLFEISDIVIKDSNTDVGAKNYRHLCAVYYNKNPGFEIIHGLLDRIMQLLDVPPGEDKGGYVI-GRCAEIFARGQSVGKLGVLHPDVITKFELTMPCSSLEINIGPFL.......................... 589
56 -22.9001wyd_A mol:protein length:429 hypothetical aspartyl-tRNA synthetase  ali model follow..  16  86.....ELHAEEITLLSKAKAPLPLDVSGKVKADIDTRLRERVLDLRRQEMQAVIKIQSLALKAFRETLYKEGFIEIFTPKIIAS---ATEGGAQLFPV----IYFGKEAFLA--QSPQLYKELMAGVVE-----RVFEVAPAWRAEESDTPHLAEFISMDVEMAFAD--YNDVMQLLEKILHNIVKTYTKSKSENPELSESFDLIYKFLEIVSGSTRNHKREKKKGLKPESFGFGMGLARLMVMLTGIQSVKEI.............. 417
57 -22.8003mey_A mol:protein length:346 Bll0957 protein  ali model follow..  13  1...MGSSSSGLVPRGSHMNIAVLPNSPDTAPQIADPLDHLADKLFHSMGSDGVTALYESIVERLAALITSHGTEALRFPPVMSRAQLEKSGSRFDAGGDWTTSLSPADLVLSPAACYPVYPIAASRGPLPKGGLRFDVAADCFRRESKHLDRLQSFRMREYVCIGTPDDVSDWMVRAQAIARDLGLTFRVDYASDPFFGRVGQMKEQPTACMSFNYHREHFGTTWGIQDA--CVAFGMDRLAVAMFH-AKVRDILGLQ.......... 327
58 -22.6001n9w_A mol:protein length:422 aspartyl-tRNA synthetase 2  ali model follow..  17  122..................................................RAPLKVQAALVRGFRRYLDRQDFTEIFTPKVVR-------AGAEGGSGLFGVDYFEKRAYLA--QSPQLYKQIMVGVFE-----RVYEVAPVWRMEHHTSRHLNEYLSLDVEMGFIA-DEEDLMRLEEALLAEMSVRPFYTYPEEDGTTRSFDLLFRGLEITSGGQRIHRYEKAKGMDPEAFGFAIGAERLTQKLLGLPNVRYA.............. 410
59 -22.6001b8a_A mol:protein length:438 PROTEIN (ASPARTYL-TRNA SYNTHETASE)  ali model follow..  19  89.....EILPEKIVVLNRAETPLPLDPTGKVKAELDTRLNNRFMDLRRPEVMAIFKIRSSVFKAVRDFFHENGFIEIHTPKIIATA-----TEGGTELFPMKYFEEDAFLAESPQ--------LYKEIMMASGLDRVYEIAPIFRAEEHNTTHLNEAWSIDSEMAFIE-DEEEVMSFLERLVAHA---YIMKYDNKPEICRAFDLEYRGVEISSGGQREHRHDKEKGLNPESFGFGLGAERLIKQMLDLPNIREV.............. 426
60 -22.3003i7f_A mol:protein length:548 Aspartyl-tRNA synthetase  ali model follow..  19  241..................................................IAIFRIQSACCGLFREFLTSQKFVEIHTPKLIGCS-----SEGGSNIFEVKYFDRKAYLAQSPQ--------LYKQMAIMGDFRKVFEVGPVFRAENSNTRHLTEFEGLDIEMEIVE-NYHECIDVMEKLFTFI---YTMPDIDDPNYSNSYDVFVRGQEITSGAQRIHDPEIEKGVDPATLGCGIGLERITMLYLGIPNIRKV.............. 536
61 -22.1001efw_A mol:protein length:580 ASPARTYL-TRNA SYNTHETASE  ali model follow..  16  91..EVELSALEVLAEAKTPPFPVDAGWRGEEEKEASEELRLKYRYLDLRRRRENLRLRHRVIKAIWDFLDREGFVQVETPFL-----TKSTPEGARDFLVPYRHEPGLFYALP--QSPQLFKQM----LMVAGLDRYFQIARCFRDEDLRADRQPDFTQLDLEMSFVE--VEDVLELNERLMAHV.................................................................................... 261
62 -21.7004wj3_M mol:protein length:599 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  18  96.....EVLGYELEVLNQAETPPFPLDEYSDVGEETRLRYRFIDLRRPEM-AAKLKLRARITSSIRRYLDDNGFLDVETPIL-----GRPTPEGARDYLVPSRTYPGHFFALP--QSPQLFKQL----LMVAGFDRYYQIAKCFRDEDLRADRQPEFTQIDIETSFLD--ESDIIGITEKMVRQL.................................................................................... 260
63 -21.7005xix_A mol:protein length:472 Asparagine--tRNA ligase, cytoplasmic  ali model follow..  17  117.....ELSCDFWELIGLAPAGGADNLINEESDVDVQLNNRHMM-IRGENMSKILKARSMVTRCFRDHFFDRGYYEVTPPTLVQTQ-----VEGGATLFKLDYFGEEAFLTQSSQLYLETC---------LPALGDVFCIAQSYRAEQSRTRHLAEYTHVEAECPFLT--FDDLLNRLEDLVCDV--EDSRLTESVDVLMPNVGEIVGGSMRIFDSEEILAGYKREGIDPTPYGYGLGLERFLTWILNRYHIRDV.............. 454
64 -21.6003m4p_A mol:protein length:456 Asparaginyl-tRNA synthetase, putative  ali model follow..  14  110..EMQVTEWKVIGESPIDLENIINKDSSIPQKMQNRHIVIRSEHTQQVL-----QLRSEIQWYFRKYYHDNHFTEIQPPTIVKTQ-----CEGGSTLFKLQYFNEPAYLTQSSQLYLESV---------IASLGKSFCMLSSYRAEQSRTVHLAEYLHLEAELISFEDLLNHLEDLVCTVIDNVMAVHGDKIRKMMTYADAIKYCND--EIVGGSMRIWNYDKANGLNPDPYGYGLGVERLVMWLLGEDHIRKV.............. 444
65 -21.6001x54_A mol:protein length:434 Asparaginyl-tRNA synthetase  ali model follow..  19  132..................................................SAIMKVKETLIMAAREWLLKDGWHEVFPPILVT-------GAVEGGATLFKLKYFDKYAYLSQSAQLYLEAAIFGLE-------KVWSLTPSFRAEKSRTRHLTEFWHLELEAMDLWDIMKVEEELVSYMVQRTLELRKKEIEMFISYDEAIDILQGYGEIIGGSQREDDYDLEEGMDPKDYGFGLGVERLVAWVLKLDHIRWA.............. 422
66 -21.4004rmf_A mol:protein length:609 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  18  92..EVNATELTVLGESAPLPFQLDEQAGEEARLKYRYLDLRREG-------GNALRLRSKVNAAARSVLAEHDFVEIETPTL-----TRSTPEGARDFLVPARLQPGSFYALPQ--SPQLFKQL----LMVAGMERYYQIARCYRDEDFRADRQPEFTQLDMEMSFVE--ADDVIAISEQVLKAV-----------------WATIGYDLPLPLPRISYEEAMRRFGSDKPDLRFGIELVECTEY........................ 297
67 -21.2004o2d_A mol:protein length:620 Aspartate--tRNA ligase  ali model follow..  18  108..EVNATELTVLGESAPLPFQLDEQAGEEARLKYRYLDLRREG-------GNALRLRSKVNAAARSVLAEHDFVEIETPTL-----TRSTPEGARDFLVPARLQPGSFYALPQ--SPQLFKQL----LMVAGMERYYQIARCYRDEDFRADRQPEFTQLDMEMSFVE--ADDVIAISEQVLKAV------------------ATIGYDLPLPLPRISYEEAMRRFGSDKPDLRFGIELVECTEY........................ 313
68 -20.9002xti_A mol:protein length:437 ASPARAGINYL-TRNA SYNTHETASE, CYTOPLASMIC, PUTATIVE  ali model follow..  14  87.....ELIADFWKIIGNAPPGGIDNVLNEEASVDKMLDNRHLV-IRGENAAALLRLRAAATRAMREHFYNAGYVEVAPPTLVQTQ-----VEGGSTLFNLDYFGEQSFLTQSSQLYLETCIPTLG---------DVFCIAQSYRAEKSTRRHLAEYAHVEAECPFIT--LDDLMEKIEELVCDT--KDNTLTESVDLLMPGVGEIVGGSMRIWKFDELSKAFKNVEIDPKPYGYGLGLERFICWLTNTNHIRDV.............. 425
69 -20.9005w25_A mol:protein length:616 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  16  98.EGNANPEIATGEIEVNATSLTVLGECAPLPFQLDEPAGEELRLKYRYLDAAAIRLRSRVNAAARAVLARHDFVEIETPTI-----TRSTPEGARDFLVPARLHPGSFYALPQ--SPQLFKQL----LMVAGMERYYQIARCYRDEDFRADRQPEFTQLDMEMSFVD--AEDIIAISEEVLTEL-----------------WALIGYRIPTPIPRIGYAEAMRRFGTDKPDLRFGLELVECT.......................... 314
70 -20.4001eqr_A mol:protein length:590 ASPARTYL-TRNA SYNTHETASE  ali model follow..  16  80.EKNINRDMATGEIEVLASSLTIINRADVLPLDSNHVNTEEARLKYRYLDAQRLKTRAKITSLVRRFMDDHGFLDIETPML-----TKATPEGARDYLVPSRVHKGKFYALP--QSPQLFKQL----LMMSGFDRYYQIVKCFRDEDLRADRQPEFTQIDVETS---MTAPQVREVMEALVRHL.................................................................................... 255
71 -19.8002i4l_A mol:protein length:458 Proline-tRNA ligase  ali model follow..  12  13....SHMRLSRFFLPILKENPKEAEIVSHRLMLRAGMLRQEAAGIYAWLPLGHR-VLKKIEQIVREEQNRAGAIELLMPTLQLADLWRESGDAYGPEMLRIADRHKRELLYGPTNEEMITEIFRAYIKSYKSPLNLYHIQWKFRDEQRPRFRGREFLMKDAYSFDVDEAGARMFVAYLRTFARMGLKAIPMRAETGPIG..................................................................... 217
72 -19.6004lns_A mol:protein length:351 Asparagine synthetase a  ali model follow..  10  11...................................................LLQEQILTVKRSFSEALEKLNLVEVRAPILFRVGDGTQDNLSGFEKAVQVPVKAIPNASFEVVHSLAKWKRRTLANYKFAPGHGLYTHMTALRVDDLDNIHSVVVDQWDWEMVDDQRNLAFLKEVVCKVYAAIRKTELAVCEKYKQKPILPETIDDSLEVSSMGVNAEALRHQISLTPQTVGGGIGQSRMVMFMLRKKHIGEVQCSVWPEEIRKKH. 348
73 -19.0004ah6_A mol:protein length:617 ASPARTATE--TRNA LIGASE, MITOCHONDRIAL  ali model follow..  15  101.....EIKVKTAELLNACKKLPFEIKNFVKKTEALRLQYRYLDLRSFQM-QYNLRLRSQMVMKMREYLCNLGFVDIETPTL------FKRTPGGAKEFLVPSREPGKFYSLP--QSPQQFKQL----LMVGGLDRYFQVARCYRDEGSRPDRQPEFTQIDIEMSFVD--QTGIQSLIEGLLQYS.................................................................................... 265
74 -19.0002cim_A mol:protein length:522 SERYL-TRNA SYNTHETASE  ali model follow..  16  225.........................................................ARIFRTFEKIVLELGYREMIFPKLVTWEVWMKSGTHEVPTKLIKEKIAEPIGGMCYAQCPPFWMYVAGETLPNEEPVKVFDRGTSHRYESGGIHRVDEFHRIEIVWIGTKEEVLKLHDRYMHIFNDILDIEWRKARVTPWFMAQEGLLGEWLEFQNVSINGDKYPKGFNVKLQ--CSGVGLERWAAV........................ 486
75 -19.0004hvc_A mol:protein length:519 Bifunctional glutamate/proline--tRNA ligase  ali model follow..  10  7....QGPKKQTRLGLEAKKEENLADWYSQVITKSEMIEYHDISGCYILRPWAYA-IWEAIKDFFDAEIKKLGVENCYFPMFVSQSALEKEKTHVADVTRSGKTELAEPIAIRPTSETVMYPAYAKWVQSHRDPIKLNQWCNVVRWEFKHPQRTREFLWQEGHSAEAAEEVLQILDLYAQVYEELLAIPVVK............................................................................. 208

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 7 1 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I. and Godzik A Connecting the Protein Structure Universe by Using Sparse Recurring Fragments. Structure (Camb.) (2005) Aug;13(8):1213-24