current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 5vl1_A mol:protein length:506 Lysine--tRNA ligase, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500
# Score Template Links and tools%idFirst MAMSSAESNIPEQFRIRRDKRARLLAEGYDPYPVAIERTHTLAEIRATYADLPTDSATEDIVGVAGRVVFARNTGKLCFATLQDGDGTQLQAMISLDEVGRESLDRWKADVDIGDVVYVHGTVISSRRGELSVLADSWRMAAKALRPLPVAHKEMSEESRVRQRYVDLIVRPQAREVARQRIAVIRAVRNALERRGFLEVETPMLQTLAGGAAARPFVTHSNALDIDLYLRIAPELFLKRCIVGGFDRVFELNRVFRNEGSDSTHSPEFSMLETYQTYGTYDDSALITRELIQEVADEAIGTRQLSMPDGSVYDIDGEWATMEMYSSLSEALGEQITPETTVARLRDIASGLDVEIDNSVFGHGKLVEELWEHAVGNKLTAPTFVKDFPVETTPLTRQHRSIPGVTEKWDLYVRGVELATGYSELNDPVVQRDRFADQARAAAAGDDEAMQLDEDFLTALEYGMPPCTGTGMGIDRLLMCLTGLSIRETVLFPIVRPHSNLast
1 -172.0005vl1_A mol:protein length:506 Lysine--tRNA ligase  ali model  100  1MAMSSAESNIPEQFRIRRDKRARLLAEGYDPYPVAIERTHTLAEIRATYADLPTDSATEDIVGVAGRVVFARNTGKLCFATLQDGDGTQLQAMISLDEVGRESLDRWKADVDIGDVVYVHGTVISSRRGELSVLADSWRMAAKALRPLPVAHKEMSEESRVRQRYVDLIVRPQAREVARQRIAVIRAVRNALERRGFLEVETPMLQTLAGGAAARPFVTHSNALDIDLYLRIAPELFLKRCIVGGFDRVFELNRVFRNEGSDSTHSPEFSMLETYQTYGTYDDSALITRELIQEVADEAIGTRQLSMPDGSVYDIDGEWATMEMYSSLSEALGEQITPETTVARLRDIASGLDVEIDNSVFGHGKLVEELWEHAVGNKLTAPTFVKDFPVETTPLTRQHRSIPGVTEKWDLYVRGVELATGYSELNDPVVQRDRFADQARAAAAGDDEAMQLDEDFLTALEYGMPPCTGTGMGIDRLLMCLTGLSIRETVLFPIVRPHSN 500
2 -170.0006aqh_A mol:protein length:508 Lysine--tRNA ligase  ali model follow..  79  5.PPESVDPDLPEQFRIRQAKRADLLAQGRQPYPVDVPRTHTLLEIRQAYPDLPVDARTGEIVGVTGRVVFARNSGKLCFATLQEGDGTQLQAMISLAEVGQEALDNWKTYVDIGDIVFVHGEVITSKRGELSVLADSWQMAAKALRPLPVAHKEMSEESRVRQRYVDLIVRDQARKVARQRIAVMRAIRSALERRGFLEVETPMLQTLAGGAAARPFVTHSNALDTELYLRIAPELFLKRCLVGGFERVFELNRVFRNEGADSTHSPEFVMLETYQAYGTYDDSAVVTRELIQEVADEAIGTRQVPLPDGTVYDLDGEWESIQMYPSLSEALGEEITPDTPAETLWAIADRLGLDIPDRGYGHGKLVEELWEHTVGAKLWAPTFVKDFPVETTPLTRSHRSIPGVTEKWDLYVRRIELATGYSELTDPIIQRERFEAQARAAAAGDDEAMALDEDFLAALEYGMPPSTGTGMGIDRLMMTLTGLSIRETVLFPIVKPR.. 502
3 -159.0003bju_A mol:protein length:521 Lysyl-tRNA synthetase  ali model follow..  36  2......SVDPNQYYKIRSQAIHQLKVNGEDPYPHKFHVDISLTDFIQKYSHLQPGDHTDITLKVAGRIHAKRASGKLIFYDLRGEGV-KLQVMANSRNYSEEEFIHINNKLRRGDIIGVQGNPGKTKKGELSIIPYEITLLSPCLHMLPHLHFGLDKETRYRQRYLDLILNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHNELDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKMVSGMVKHITGSYKVTYHQAYDVDFTPPFRRINMVEELEKALGMKLPETNLFETLDDICVAKAVECPPP-RTTARLLDKLVGEFLEVTCINPTFICDHPQIMSPLAKWHRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKAKAAGDDEAMFIDENFCTALEYGLPPTAGWGMGIDRVAMFLTDSNIKEVLLFPAMKPEDK 510
4 -157.0005hgq_A mol:protein length:524 Lysine--tRNA ligase  ali model follow..  38  2....ADPSDPQEYFKLRTALINERRSKGINPYPHKFHVSISLADFIAKYNSLEKDVINDIVQSVAGRVFSKRESGGKLIFYDLHGEGTRLQVLANARFHGDEAFDNLHDRIKRGDIIGVNGYPARSKSGELSIIPYEIIQLTPCLHMLPHTHFGLNQETRYRMRYLDLIMNPDVKNRFVTRSRMISFLRRYLDNLGFLEVETPMMNLIAGGATAKPFITHHNDLDMDLYLRVAPELYLKMLVVGGIDRVYEIGRVFRNEGIDQTHNPEFTSCEFYMAYADYEDLMKITEDMLARMVYYMHGTYKIQYHPVYEVDFTPPFRKVNIYDGLQEKLGIQFPPADTLDTFDKLAVENNVECPAP-RTTARLLDKLIGEFLEPTFISPTFLTGHPQIMSPLAKWHRSIPGLTERFELFVVTKEIVNAYTELNDPLTQRLRFDEQAKQKQAGDDEAQNIDENYCTALEYGLPPTAGWGMGIDRLAMILTDSNIKEVLFFPAMRPDEK 513
5 -157.0005eln_A mol:protein length:535 Lysine--tRNA ligase  ali model follow..  34  6.LEAQTQGPGSHYTDNRYKMMECIKDAGRPFYPHKFKISMSLPAYALKYGNVENGYIKDTTLSLSGRVTSIRSSSKLIFYDIFCEEQ-KVQIIANIMDISTGEFSVSHSEIRRGDVVGFTGFPGKSKRGELSLFSKSVVLLSPCYHMLPTAISGLDQEVRYRQRYLDLMLNEESRKVFKLRSRAIKYIRNYFDRLGFLEVETPMLNMIYGGAAARPFITYHNELETQLYMRIAPELYLKQLIVGGLDKVYEIGKNFRNEGIDLTHNPEFTAMEFYMAYADYYDLMDLTEELISGLVLEIHGSLKIPYHKCIEIDFTTPWKRFSFVEEIESGLGEKLKRPLDIDFMVEMCEKHEIELPHP-RTAAKLLDKLAGHFVETKCTNPSFIIDHPQTMSPLAKWHREKPEMTERFELFVLGKELCNAYTELNEPLQQRKFFEQQADAKASGDVEACPIDETFCLALEHGLPPTGGWGLGIDRLIMFLADKNIKEVILFPAMRNVKQ 518
6 -155.0003a74_A mol:protein length:493 Lysyl-tRNA synthetase  ali model follow..  41  1.....SHEELNDQLRVRREKLKKIEELGVDPFGKRFERTHKAEELFELYGDLSKEEEQQIEVAVAGRIMTKRGMGKAGFAHIQDVTG-QIQIYVRQDDVGEQQYELF-KISDLGDIVGVRGTMFKTKVGELSIKVSSYEFLTKALRPLPEKYHGLDIEQRYRQRYLDLIMNPESKKTFITRSLIIQSMRRYLDSHGYLEVETPMMHAVAGGAAARPFITHHNALDMTLYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGISTRHNPEFTMLELYEAYADFRDIMKLTENLIAHIATEVLGTTKIQY-GEHLVDLTPEWRRLHMVDAIKEYVGVDFWRQMSDEEARELAKEHGVEVAPH-MTFGHIVNEFFEQKVEDKLIQPTFIYGHPVEISPLAKKNPDDPRFTDRFELFIVGREHANAFTELNDPIDQRQRFEEQLKEREQGNDEAHEMDEDFLEALEYGMPPTGGLGIGVDRLVMLLTNSSIRDVLLFPQMRHK.. 493
7 -154.0001e1o_A mol:protein length:504 LYSYL-TRNA SYNTHETASE, HEAT INDUCIBLE  ali model follow..  37  6.RGANEAIDFNDELRNRREKLAALRQQG-VAFPNDFRRDHTSDQLHEEFDAKDNQESLNIEVSVAGRMMTRRIMGKASFVTLQDVGG-RIQLYVARDSLPEGVYNDQFKKWDLGDIIGARGTLFKTQTGELSIHCTELRLLTKALRPLPDKFHGLDQEVRYRQRYLDLIANDKSRQTFVVRSKILAAIRQFMVARGFMEVETPMMQVIPGGASARPFITHHNALDLDMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYHDLIELTESLFRTLAQEVLGTTKVTY-GEHVFDFGKPFEKLTMREAIKKYRPETDMADLDNFDAAKALAESIGITVEKSWGLGRIVTEIFDEVAEAHLIQPTFITEYPAEVSPLARRNDVNPEITDRFEFFIGGREIGNGFSELNDAEDQAERFQEQVNAKAAGDDEAMFYDEDYVTALEYGLPPTAGLGIGIDRMIMLFTNSTIRDVILFPAMRPQK. 504
8 -153.0001bbu_A mol:protein length:504 PROTEIN (LYSYL-TRNA SYNTHETASE)  ali model follow..  38  6.QGADAVVDLNNELKTRREKLANLREQG-IAFPNDFRRDHTSDQLHAEFDGKENEEALNIEVAVAGRMMTRRIMGKASFVTLQDVGG-RIQLYVARDDLPEGVYNEQFKKWDLGDILGAKGKLFKTKTGELSIHCTELRLLTKALRPLPDKFHGLDQEARYRQRYLDLISNDESRNTFKVRSQILSGIRQFMVNRGFMEVETPMMQVIPGGAAARPFITHHNALDLDMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYKDLIELTESLFRTLAQDILGKTEVTY-GDVTLDFGKPFEKLTMREAIKKYRPETDMADLDFDSAKAIAESIGIHVEKS-WGLGRIVTEIFEEVAEAHLIQPTFITEYPAEVSPLARRNDVNPEITDRFEFFIGGREIGNGFSELNDAEDQAQRFLDQVAAKDAGDDEAMFYDEDYVTALEHGLPPTAGLGIGIDRMVMLFTNSTIRDVILFPAMRPVK. 504
9 -152.0004ycv_A mol:protein length:516 Lysine--tRNA ligase  ali model follow..  34  2......EVDPRLYFENRSKFIQDQKDKGINPYPHKFERTISIPEFIEKYKDLGNGEHEDTILNITGRIMRVSASGQKLRFFDLVGDGEKIQVLANYSFHNHENFAECYDKIRRGDIVGIVGFPGKSKKGELSIFPKETILLSACLHMLPMKYGLKDTEIRYRQRYLDLLINESSRHTFVTRTKIINFLRNFLNERGFFEVETPMMNLIAGGANARPFITHHNDLDLDLYLRIATELPLKMLIVGGIDKVYEIGKVFRNEGIDNTHNPEFTSCEFYWAYADYNDLIKWSEDFFSQLVYHLFGTYKISYNQPIEIDFTPPYPKVSIVEEIEKVTNTILEQPFDSNEMINIIKEHKIELPNP-PTAAKLLDQLASHFIENKYNKPFFIVEHPQIMSPLAKYHRTKPGLTERLEMFICGKEVLNAYTELNDPFKQKECFKLQQKDREKGDTEAAQLDSAFCTSLEYGLPPTGGLGLGIDRITMFLTNKSIKDVILFPTMRPANG 509
10 -149.0004ex5_A mol:protein length:529 Lysine--tRNA ligase  ali model follow..  41  22.PQAAVAADENQIVAERRDKLRALRDQG-IAYPNDFQPTHHAADLQTAYADADKEAAKSLEVAIAGRMMLKRVMGKASFATVQDGSG-QIQFFVTPADVGAETYDAF-KKWDLGDIVAARGVLFRTNKGELSVKCTQLRLLAKALRPLPDKFHGLDQETRYRQRYVDLIVTPETRTTFRARTKAIASIRKFMGDADFMEVETPMLHPIPGGAAAKPFVTHHNALDMEMFLRIAPELYLKRLIVGGFERVFEINRNFRNEGVSPRHNPEFTMMEFYAAYTDYRWLMDFTERLIRQAAVDALGTATIQY-QGRELDLAQPFHRLTITQAIQKYAPSYTDGQLDDAFLRSELKRLGVDVTFLNAGIGALQLALFEETAEAQLWEPTFIIDYPIEVSPLARESDTVAGITERFELFITGREIANGFSELNDPEDQAARFKKQVEQKDAGDEEAMFFDADYIRALEYGMPPTGGCGIGIDRLVMLLTDSTIRDVLLFPHLRRED. 523
11 -147.0006chd_A mol:protein length:597 Lysine--tRNA ligase  ali model follow..  36  64VGPEEESVDPNQYYKIRSQAIHQLKVNGEDPYPHKFHVDISLTDFIQKYSHLQPGDHTDITLKVAGRIHAKRASGKLIFYDLRGEGV-KLQVMANSRNYSEEEFIHINNKLRRGDIIGVQGNPGKTKKGELSIIPYEITLLSPCLHMLPHLHFGLDKETRYRQRYLDLILNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHNELDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKMVSGMVKHITGSYKVTYHQAYDVDFTPPFRRINMVEELEKALGMKLPETNLFEILDDICVAKAVECPPP-RTTARLLDKLVGEFLEVTCINPTFICDHPQIMSPLAKWHRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKAKAAGDDEAMFIDENFCTALEYGLPPTAGWGMGIDRVAMFLTDSNIKEVLLFPAMKPEDK 578
12 -134.0004up7_A mol:protein length:777 LYSINE--TRNA LIGASE  ali model follow..  36  2.......MLSKQLFLNRCKDVEEYQKAGHNPWPHKFNVSITVPEFIAKYSGLEKSQVSDDIVSVAGRVLSKRSSSSLMFIDLHDSQT-KLQIMLNKSAYENEDFVSLTKMIYRGDICGFTGHPTRTKTGELSLIPISGMILSPCLHMLPSMHYGLDQETRFRKRYLDLIVNPESVKNFVLRTKVVKAVRKYLDDKGFLEVETPILNTIPGGATARPFITHHNQLDIQMYMRIAPELYLKELVVGGINRVYEIGRLFRNEGIDQTHNPEFTTCEFYMAYADYNDIMKMTEELLGNMVKDITGGSTKLEIKDRLMDINNEEDIKMLEKFFKEPIPRPFNSAECSKVIEKHCTELNYYYDGKRISYVHALEEKFGEKIPRPLDGPEALTFQPQLMSPLAKYHRSEPELTERFELFILKREIANAYTELNNPIVQRSNFEQQAKDKAAGDDEAQLVDEVFLDAIEHAFPPTGGWGLGIDRLAMLLADVNIKEVILFPTMRPEDE 566
13 -103.0003a5y_A mol:protein length:345 Putative lysyl-tRNA synthetase  ali model follow..  26  5...........................................................................................................................................................SSGLVPRGSHMSETASSASIPNLLKRAAIMAEIRRFFADRGVLEVETPCMSQTVTDIHLVPFETRGHSQGMNLWLMTSPEYHMKRLLVAGCGPVFQLCRSFRNEEMGRYHNPEFTMLEWYRPHYDMYRLMNEVDDLLQQVLD------------------CPAAESLSYQQAFLRYLEIDPLSADKTQLREVAAKLDLSNVADTEEDRDTLLQLLFTFGVEPNIEKPTFVYHFPASQASLAQISTEDHRVAERFEVYYKGIELANGFHELTDAREQQQRFEQDNRKRAARGLPQHPIDQNLIEALKVGMPDCSGVALGVDRLVMLALGATLAEVIAFSVDR.... 338
14 -99.5003g1z_A mol:protein length:326 Putative lysyl-tRNA synthetase  ali model follow..  28  10..........................................................................................................................................................................PSASIPNLLKRAAIMAEIRRFFADRGVLEVETPCMSQTVTDIHLFPFETRGHSQGINLYLMTSPEYHMKRLLAAGCGPVFQLCRSFRNEEMGRHHNPEFTMLEWYRPHYDMYRLMNEVDDLLQQVLDCQ------------------PAESLSYQQAFQRHLEIDPLSADKTQLREAAAKLDLSNIADTEEDRDTLLQLLFTMGVEPHIEKPTFIYHFPASQASLAQISTEDHRVAERFEVYYKGIELANGFHELTDAREQQQRFEQDNRKRAARGLPQQPIDQNLLDALAAGLPDCSGVALGVDRLVMLALGASLADVIAFTVDR.... 325
15 -97.1001efw_A mol:protein length:580 ASPARTYL-TRNA SYNTHETASE  ali model follow..  25  1...................................MRRTHYAGSLRETH--------VGEEVVLEGWVNRRRDLGGLIFLDLRDREG-LVQLVAHPASPAYATAERVRPVRAKGLVRLRPEPNPRLATGRVEVELSALEVLAEAKTPPFPVDAGWSEELRLKYRYLDLR-RRRMQENLRLRHRVIKAIWDFLDREGFVQVETPFLTKSTPEGARDFLVPYRHEPGLFYALPQSPQLFKQMLMVAGLDRYFQIARCFRDEDLRADRQPDFTQLDLEMSFVEVEDVLELNERLMAHVFREALGSGGVAKFLEPVREALLQATEARPGDTLLFVAGPRKVAATALGAVRLRAADLLGLKREGFRVVDFPLLEWDEEEEAWTYMHHPFTSPHPEDLPLLEK--DPGRVRALAYDLVLNGVEVGGGSIRIHDPRLQARVFRLLGI----GEEEQREKFGFFLEALEYGAPPHGGIAWGLDRLLALMTGSSIREVIAFPKNKEGKD 556
16 -96.2004j15_A mol:protein length:521 Aspartate--tRNA ligase, cytoplasmic  ali model follow..  18  8LVPRGSHMPSASASRKSQEKPREIMDAAEDYAKERYGISSMIQSQEKPDRVLVRIQKADEVVWVRARVHTSRAKGKQCFLVLRQQQF-NVQALVAVGDHASKQMVKFAANINKESIVDVEGVVRKVNQQDVELHVQKIYVISLAEPRLPEGRATVNQDTRLDNRVIDL-RTSTSQAVFRLQSGICHLFRETLINKGFVEIQTPKIISAASEGGANVFTVSY--FKNNAYLAQSPQLYKQMCICADFEKVFSIGPVFRAEDSNTRHLTEFVGLDIEMAFNYYHEVMEEIADTMVQIFKGLQE------------RFQTEIQTVNKQFPCEPFKFLEPTLRLEYCEALAMLREAGVEMGDEDDLSTPNEKLLGHLVKEKYDTDFYILDKYPLAVRPYTMPDPRNPKQSNSYDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEK--------IKAYIDSFRFGAPPHAGGGIGLERVTMLFLGHNVRQTSMFPRDPKR.. 512
17 -89.4004wj3_M mol:protein length:599 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  21  2..................................GMMRSHYCGQLNESL--------DGQEVTLCGWVHRRRDHGGVIFLDVRDREG-LAQVVFDPD---RAETFAKADRVRSEFVVKITGKVRLRPSGSIEVLGYELEVLNQATPPFPLDEYSDGEETRLRYRFIDL-RRPEMAAKLKLRARITSSIRRYLDDNGFLDVETPILGRPTPEGARDYLVPSRTYPGHFFALPQSPQLFKQLLMVAGFDRYYQIAKCFRDEDLRADRQPEFTQIDIETSFLDESDIIGITEKMVRQLFKEVLDVEFDEFPPEANLNVILDRVGAVDGDIVFFGADKAKIVCDALGALRIKVGHDLKLLTRE-WAPMWVVDFPMFEENDDGSLSALHHPFTSPKCTPAELEANPGAALSRAYDMVLNGTELGGGSIRIHDKSMQQAVFRVLGI----DEAEQEEKFGFLLDALKYGAPPHGGLAFGLDRLVMLMTGASIREVIAFPKTQSAGD 565
18 -89.1001asy_A mol:protein length:490 ASPARTYL-tRNA SYNTHETASE  ali model follow..  20  6........................DNYGKLPLIQSRDSDRTGQK-RVKFVDLDEAKDSDKEVLFRARVHNTRQQGALAFLTLRQQAS-LIQGLVKANKEGTISKNMVKGSLNLESIVLVRGIVKKVDEPNLEIHITKIYTISETPEALPAGLPVVNLDTRLDYRVIDL-RTVTNQAIFRIQAGVCELFREYLATKKFTEVHTPKLLGAPSEGGSSVFEVTY--FKGKAYLAQSPQFNKQQLIVADFERVYEIGPVFRAENSNTRHMTEFTGLDMEMAFEEYHEVLDTLSELFVFIFSELPKRFAHEIEEEFKLPKDGKMVRLTYKEGIE------------------MLRAAGKEIGDFEDLSTENEKFLGKLVRDKYDTDFYILDKFPLEIRPYTMPDPANPKYSNSYDFFMRGEEILSGAQRIHDHALLQERMKAH------GLSPEDPGLKDYCDGFSYGCPPHAGGGIGLERVVMFYLDKNIRRASLFPRDPKR.. 487
19 -85.9001eqr_A mol:protein length:590 ASPARTYL-TRNA SYNTHETASE  ali model follow..  23  2.....................................RTEYCGQLRL--------SHVGQQVTLCGWVNRRRDLGSLIFIDMRDREG-IVQVFFDPDRADALK---LASELRNEFCIQVTGTVRARATGEIEVLASSLTIINRA-DVLPLDSNHVTEEARLKYRYLDL-RRPEMAQRLKTRAKITSLVRRFMDDHGFLDIETPMLTKATPEGARDYLVPSRVHKGKFYALPQSPQLFKQLLMMSGFDRYYQIVKCFRDEDLRADRQPEFTQIDVETSFMTAPQVREVMEALVRHLWLEVKGVDLGDFPNAEIIEDILDRTAAQDGDMIFFGADNKKIVADAMGALRLKVGKDLGLTDESKWAPLWVIDPMFEDDGEGGLTAMHHPFTSPKDMTAAELKAAPENAVANAYDMVINGYEVGGGSVRIHNGDMQQTVFGILGI----NEEEQREKFGFLLDALKYGTPPHAGLAFGLDRLTMLLTGTNIRDVIAFPKTTAAAC 562
20 -85.8003i7f_A mol:protein length:548 Aspartyl-tRNA synthetase  ali model follow..  19  7.ATQEKKPQLPPVVLLKTPELVSGENFKVMPMHQSQPCYKTGLKYTEIEE---VPAMAEKTVTIRARVQAVRGKGNMVFLFLRKGIY-TCQALVMKSETISKEFVQFCQKISAESICDITGIVKAVEKQDVEIHVTSIAVVSLAEYPLPMQIEDVSQDTRLDNRMLDL-RTVTNIAIFRIQSACCGLFREFLTSQKFVEIHTPKLIGCSSEGGSNIFEVKY--FDRKAYLAQSPQLYKQMAIMGDFRKVFEVGPVFRAENSNTRHLTEFEGLDIEMEIVNYHECIDVMEKLFTFIFDEIPKRFPIRKQYPFEDLIYRPFLRLTYKEAIE------------------MLRASGETIGDYDDFTTPQEVKLGELIKAKYNTDFYILDKFPAAIRPFTMPDIDDPNYSNSYDVFVRGQEITSGAQRIHDPEFLMKRCIEK------GVDPAT--LKDYIESFRFGSWPHAGCGIGLERITMLYLGPNIRKVTLFPRDPIR.. 545
21 -85.7001b8a_A mol:protein length:438 PROTEIN (ASPARTYL-TRNA SYNTHETASE)  ali model follow..  23  1...................................MYRTHYSSEITEEL--------NGQKVKVAGWVWEVKDLGGIKFLWIRDRDG-IVQITAPKKKVDPELFKLIPK-LRSEDVVAVEGVVNFTPKAKFEILPEKIVVLNRAETPLPLDPTGAELDTRLNNRFMDL-RRPEVMAIFKIRSSVFKAVRDFFHENGFIEIHTPKIIATATEGGTELFPMKY--FEEDAFLAESPQLYKEIMMASGLDRVYEIAPIFRAEEHNTRHLNEAWSIDSEMAFEDEEEVMSFLERLVAHAINYVREHNELDILNFELEEPKLPFPRVSYDKALE------------------ILGDLGKEIPWGEDIDTEGERLLGKYMMENENAPLYFLYQYPSEAKPFIMKYDNKPEICRAFDLEYRGVEISSGGQREHRHDILVEQIKEKGLNPES--------FEFYLKAFRYGMPPHGGFGLGAERLIKQMLDPNIREVILFPRDRRR.. 435
22 -85.3004o2d_A mol:protein length:620 Aspartate--tRNA ligase  ali model follow..  22  2...................AMGTLEAQTQGPGSMVL-RTHAAGSLRPAD--------AGQTVTLAGWVARRRDHGGVIFIDLRDASG-VSQVVFREGDVLAA-----AHRLRAEFCVAVTGVV-EIPTGQIEVNATELTVLGESA-PLPFQLDEQGEEARLKYRYLDL-RREGPGNALRLRSKVNAAARSVLAEHDFVEIETPTLTRSTPEGARDFLVPARLQPGSFYALPQSPQLFKQLLMVAGMERYYQIARCYRDEDFRADRQPEFTQLDMEMSFVEADDVIAISEQVLKAVWATIGYDLPLPLFGSDKPDLRFGIELVECTEYFKDTLGGPVAKNLSDAERDGLVAHVGANPGDEAADEATAAGDVAVGSGAWTAMHHAFTAPKPDSVDTFDS--DPGNALSDAYDIVCNGNEIGGGSIRIHRRDIQERVFAMMGI----DHDEAQEKFGFLLDAFSYGAPPHGGIAFGWDRITALLAGVSIREVIAFPKSGGGVD 578
23 -85.3004ah6_A mol:protein length:617 ASPARTATE--TRNA LIGASE, MITOCHONDRIAL  ali model follow..  21  2............................IPEFSSFVVRTNTCGELRSSH--------LGQEVTLCGWIQYRRQNT---FLVLRDFDG-LVQVIIPQDESAASVKKIL-CEAPVESVVQVSGTVIKMPTGEIEIKVKTAELLNACKKPFEIKNFVKTEALRLQYRYLDLR-SFQMQYNLRLRSQMVMKMREYLCNLGFVDIETPTL-FKRTPGGAKEFLVPSREPGKFYSLPQSPQQFKQLLMVGGLDRYFQVARCYRDEGSRPDRQPEFTQIDIEMSFVDQTGIQSLIEGLLQYSWPNDKD------------PVVVPFPTMTFAEVLATY---DTRFGMKIIDISDVFRNTEIGFLQDALSKPHGTVKAPKEENPRELESAHHPFTAPHPSDIHLLYTEPKKARSQHYDLVLNGNEIGGGSIRIHNAELQRYILATL-------LKEDVKMLSHLLQALDYGAPPHGGIALGLDRLICLVTGSSIRDVIAFPKSFRGHD 573
24 -82.2004rmf_A mol:protein length:609 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  21  3.....................................RTHAAGSLRP--------ADAGQTVTLAGWVARRRDHGGVIFIDLRDASG-VSQVVFREGDVLAA-----AHRLRAEFCVAVTGVV-EIPTGQIEVNATELTVLGESA-PLPFQLDEQGEEARLKYRYLDL-RREGPGNALRLRSKVNAAARSVLAEHDFVEIETPTLTRSTPEGARDFLVPARLQPGSFYALPQSPQLFKQLLMVAGMERYYQIARCYRDEDFRADRQPEFTQLDMEMSFVEADDVIAISEQVLKAVWATIGY------------DLPLPLPRISYEEAMRRF-GSDKPDLRFGIELVECTEYFKDTTFREAADEATAAGDVAVGSGAWTAMHHAFTAPKPDSVDTFDS--DPGNALSDAYDIVCNGNEIGGGSIRIHRRDIQERVFAMMGI----DHDEAQEKFGFLLDAFSYGAPPHGGIAFGWDRITALLAGVSIREVIAFPKSGGGVD 562
25 -81.2005xix_A mol:protein length:472 Asparagine--tRNA ligase, cytoplasmic  ali model follow..  17  3..........SSSSGLVPRGSHMAKKITIKNDPSLPEPKCVKIG--------ALEGYRGQRVKVFGWVHRLRRQGKLMFLVLRDGTG-YLQCVLADELCQCYNG----VLLSTESSVAVYGMLNLTPKGKQALSCDFWELIGLAPAGGADNLINSDVDVQLNNRHMMI-RGENMSKILKARSMVTRCFRDHFFDRGYYEVTPPTLVQTQVEGGATLFKLDY--FGEEAFLTQSSQLY-LETCLPALGDVFCIAQSYRAEQSRTRHLAEYTHVEAECPFLTFDDLLNRLEDLVCDVVDRILKSPAGSIVNPNFQPPKRPFKRMNYSDAIVWLKEHDVKKEDGTF-----------------YEFGEDIPEAPERLMTDTINEPILLCRFPVEIKSYMQRCPEDSRLTESVDVLMNVGEIVGGSMRIFDSEEILAGYKREGIDPTP--------YYWYTDQRKYGTCPHGGYGLGLERFLTWILNYHIRDVCLYPRFVQR.. 463
26 -81.2005w25_A mol:protein length:616 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  20  2......................GSSSSGLVPRGSHVLRSHAAGLLREGD--------AGQQVTLAGWVARRRDHGGVIFIDLRDASGI-AQVVFRDPQ--DTEVLAQAHRLRAEFCVSVAGVVEEIATGEIEVNATSLTVLGEC-APLPFQLDEPGEELRLKYRYLDL-RRDDPAAAIRLRSRVNAAARAVLARHDFVEIETPTITRSTPEGARDFLVPARLHPGSFYALPQSPQLFKQLLMVAGMERYYQIARCYRDEDFRADRQPEFTQLDMEMSFVDAEDIIAISEEVLTELWALIGYRIPT------------PIPRIGYAEAMRRF---DLRFGLELVECTDFFSDTTFRVFQAPYVGAVVMAAGEVAVGSGAWTAVHHAFTAPKPEWEDRIESDTGSVLADAYDIVCNGHEIGGGSVRIHRRDIQERVFAVMGL----DKAEAEEKFGFLLEAFMFGAPPHGGIAFGWDRTTALLAGMSIREVIAFPKTGGGVD 581
27 -81.1003m4p_A mol:protein length:456 Asparaginyl-tRNA synthetase, putative  ali model follow..  16  2...................PGSMMTEATTTPVETPIVCNIR-----------DAAGLEGKLVTFKGWAYHIRKARKLIFVELRDGSG-YCQCVIFGKELCEPEK---VKLLTRECSLEITGRLNAYAGLNLEMQVTEWKVIGESPIDLENIINKSSIPQKMQNRHIVI-RSEHTQQVLQLRSEIQWYFRKYYHDNHFTEIQPPTIVKTQCEGGSTLFKLQY--FNEPAYLTQSSQLY-LESVIASLGKSFCMLSSYRAEQSRTRHLAEYLHLEAELPFISFEDLLNHLEDLVCTVIDNVMAVHKIRKMNPHLKLPTRPFKRMTYADAIK------------------YCNDHGILNKDKPFEYGEDISEKPERQMTDEIGCPIFMIHFPSKMKAFMSKVPGHPDLTESVDLLMPGVEIVGGSMRIWNYDELMGAYKANGLNPDP---------YWYTQQRKYGSCPHGGYGLGVERLVMWLLGDHIRKVCLYPRYLER.. 453
28 -79.5001wyd_A mol:protein length:429 hypothetical aspartyl-tRNA synthetase  ali model follow..  23  1...................................MYRSHFIADVTPEY--------DGKEVIWAGWVHLLRDLGGKKFIILRDKTG-LGQVVVDKNSSAFGIS----QELTQESVIQVRGIVKADKRAPIELHAEEITLLSKAKAPLPLDVSGADIDTRLRERVLDL-RRQEMQAVIKIQSLALKAFRETLYKEGFIEIFTPKIIASAGGAQLFPVIYFGK----EAFLAQSPQLY-KELMAGVVERVFEVAPAWRAEESDTFHLAEFISMDVEMAFADYNDVMQLLEKILHNIVKTIKEEGELKILNYEPPEVKIPIKRLKYTEAIEILRSKGYNIKFGDD----------------------IGTPELRILNEELKEDLYFIVDWPSDARPFTKSKSENPELSESFDLIYKFLEIVSGSTRNHKREVLEEALKKKGLKPES---------EFFLKWFDYGMPPHAGFGMGLARLMVMLTGQSVKEIVPFPRDKKR.. 426
29 -79.0001x54_A mol:protein length:434 Asparaginyl-tRNA synthetase  ali model follow..  19  11.....................................................KPELDGKKVRLAGWVYTNMRVGKKIFLWIRDSTG-IVQAVVAKNVVGEETFEKAKK-LGRESSVIVEGIVKADEPGGAEVHVEKLEVIQAVSEFPIPENPEASPELLLDYRHLHI-RTPKASAIMKVKETLIMAAREWLLKDGWHEVFPPIL--VTGAVEGGATLFKLKYFDKYAYLSQSAQLYLE-AAIFGLEKVWSLTPSFRAEKSRTRHLTEFWHLELEAAWMDLWDIMKVEEELVSYMVQRTLELRKKEIEMTTLKNTEPPFPRISYDEAIDI-----------------------LQSKGVNVEWGDDLGADEERVLTEEFDRPFFVYGYPKHIKAFYMKEDPN----DPRKVLASDMLAPEGYGEIIGGSQREDDYDKLLNRILEEGMDPKDY-EWYLDLRRYGSVPHSGFGLGVERLVAWVLKDHIRWAALFPRTPAR.. 431
30 -77.4001n9w_A mol:protein length:422 aspartyl-tRNA synthetase 2  ali model follow..  23  7....................................................DLKAHVGQEVELLGFLHWRRDLGRIQFLLLRDRSG-VVQVVTGGL-----------KLPLPESALRVRGLVVENAKGGLEVQAKEVEVLSPALEPTPKEEWRANPDTLLEYRYVTL-RGEKARAPLKVQAALVRGFRRYLDRQDFTEIFTPKV--VRAGAEGGSGLFGVDYFEKRAYLAQSPQLY-KQIMVGVFERVYEVAPVWRMEHHTSRHLNEYLSLDVEMGFADEEDLMRLEEALLAEMLEEALNTDEIRLLGATWPSFPQDIPRLTHAEAKRILKEELGYPVGQDLS-------------------EEAERLLGEYAKERWGSDWLFVTRYPRSVRPFYT-YPEEDGTTRSFDLLFRGLEITSGGQRIHRYEELLESLKAKGMDPEA---------HGYLEVFKYGMPPHGGFAIGAERLTQKLLGPNVRYARAFPRDRHR.. 419
31 -76.0002xti_A mol:protein length:437 ASPARAGINYL-TRNA SYNTHETASE, CYTOPLASMIC, PUTATIVE  ali model follow..  20  10.......................................................KHRNERVCIKGWIHRMRRQGKLMFFILRDGTG-FLQVLLMDKLCQTYDA----LTVNTECTVEIYGAIKEVPEGKEALIADFWKIIGNAPPGGNVLNEEASVDKMLDNRHLVI-RGENAAALLRLRAAATRAMREHFYNAGYVEVAPPTLVQTQVEGGSTLFNLDY--FGEQSFLTQSSQLYLETC-IPTLGDVFCIAQSYRAESRTRRHLAEYAHVEAECPFITLDDLMEKIEELVCDTVDRLLADEEAKKLNPKFQPPERPFLRMEYKDAIKWLQEHNVENEFGNTF-----------------TYGEDIAEAAERFMTDTINKPILLNRFPSEIKAFMQRDAKDNTLTESVDLLMPGVEIVGGSMRIWKFDELSKAFKNVEIDPKP--------YYWYLDQRLYGTCPHGGYGLGLERFICWLTNNHIRDVCLYPRFVGR.. 434
32 -57.5002zni_A mol:protein length:308 Pyrrolysyl-tRNA synthetase  ali model follow..  16  4.........................................................................................................SSSGLVPRGSHMFLTRRDQYQRLKELNASGEQLEMGFSDALSRDRAFQGIHQLMSQGKRHLEQLRTVKHRPAL---LELEEKLAKALHQQGFVQVVTPTIITKMTIGEDHPLFSQVFWLDGKKCLRLAPNLYTLWRLWDKPIRIFEIGTCYRKESQGAQHLNEFTMLNLTELGTPLEERHQRLEDMARWVLEAAGIRTESSVVYGDTVDVMKGDLELASGAMGPHFLDEKWEIFDPWVGL--------------GFGLERLLMIREGTQHVQSMARSLSYLDGVR.............................................................................................................. 298
33 -48.3003p8t_A mol:protein length:294 AsnS-like asparaginyl-tRNA synthetase related protein  ali model follow..  16  2...................................................................................................................................................................NAVEI--SRDIYKAIDIQTKILDYMTKFFTDRGFKWLLPIMLSPIPDPAGEGIRPAEVDVYGVRMRLTHSMILHKQLAIAMGLEKIFVLSPNIRLESRDGRHSYEFTQLDFEIEGAKMKDVMRLIEELIYGLFRKAEEWT------GREFPRARHFKVYDYKDILEEFGS--------------------------------------DEKASMEMEEPFWIVNIPREFYD---REENGVWKNYDLILPYGYGEVSSGGEREWEYEKIVAKIRAAGLKEDS---------RPYLEIARAGLKPSAGAGIGVERLVRFIVGKHIAEVQPFP....... 285
34 -45.9001nnh_A mol:protein length:294 asparaginyl-tRNA synthetase-related peptide  ali model follow..  15  2...................................................................................................................................................................NAVEI--SREISPTLDIQTKILEYMTDFFVKEGFKWLLPVIISPIPDPAGEGMEPAEVEIYGVKMRLTHSMILHKQLAIAMGLKKIFVLSPNIRLESRDGRHAYEFTQLDFEVERAKMEDIMRLIERLVYGLFRKAEEWT------GREFPKTKRFEVFEYSEVLEEFGS--------------------------------------DEKASQEMEEPFWIINIPREFYDR---EVDGFWRNYDLILPYGYGEVASGGEREWEYEKIVAKIRKAGLNEDS---------RPYLEIAKAGLKPSAGAGIGVERLVRFIVGKHIAEVQPFP....... 285
35 -39.5004bw9_A mol:protein length:291 PYRROLYSINE--TRNA LIGASE  ali model follow..  15  2.......................................................................................................GSSSSGLVPRGSHMASAPALTKSQTDRLEVLLNPKDEISLNS---GKPFRELESELLRRKKDLQQIYAEERENY---LGKLEREITRFFVDRGFLEIKSPILIPLMGIDNDTELSKQIFRVDKNFCLRPMLAPNLGNYLLPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGRENLESIITDFLNHLG----------------IDFKIVGDSCMVFGDTLDVMHGDLELSSAVVGPRPLDREWGID-------------------------KPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGIST.................................................................................. 283
36 -39.3004lns_A mol:protein length:351 Asparagine synthetase a  ali model follow..  12  4..................................................................................................................................................................DGYSSYV--LLQEQILTVKRSFSEALEKEL---NLVEVRAPILFRVGDGTQDNLSGFEKAIPNASFEVVHSLAKWLANYKFAPGHGLYTHMTALRDDVLDNIHSVVVDQWDWEMVMKDDQRNLAFLKEVVCKVYAAIRKTELAVCEKKQKPILPETIQFVHAEHLLLAY---NLTAKEREREIAREYGAVFLIGIGAVLSSGDRHDARAPDYDDWTSPVEASQVVFPRTSKPIPTMNSLSSLKGLNGDILLYNPTLDDSL-EVSSMGIRVNAEALRHQISLTGDDSLLKSE--HQQLLNGEFPQTVGGGIGQSRMVMFMLRKHIGEVQVWP....... 341
37 -36.8002e3c_A mol:protein length:291 Pyrrolysyl-tRNA synthetase  ali model follow..  17  6...........................................................................................................SGLVPRGSHMASAPALTKSQTDRLEVLLNPKDEISLNS---GKPFRELSELLSRRKKDLQQIYAEEREN---YLGKLEREITRFFVDRGFLEIKSPILIPLMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLLPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCENLESIITDFLNHLGIDFKIVGDSCMVYGDTLDVMHGDLELSGPIPLDREWGIDKPWIGAGFGLERLLK...................................................................................................................................................... 260
38 -35.9004tqd_A mol:protein length:291 Pyrrolysine--tRNA ligase  ali model follow..  17  6...........................................................................................................SGLVPRGSHMASAPALTKSQTDRLEVLLNPKDEISLNS---GKPFRELSELLSRRKKDLQQIYAEEREN---YLGKLEREITRFFVDRGFLEIKSPILIPLMGIDNDTELSKQIFRVDKNFCLRLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLSFIQMGSGRENLESIITDFLNHLGIDFKIVGDSCMVYGDTLDVMHGDLELSGPIPLDREWGIDKPWIGAGFGLERLL....................................................................................................................................................... 259
39 -34.00011as_A mol:protein length:330 ASPARAGINE SYNTHETASE  ali model follow..  12  1.....................................................................................................................................................................MKTAYIAKQRQISFVKSHFSRQLEERL---GLIEVQAPILSRVGDGAEKAVQVKVKALPDAQFEVVHSLAKWKRQTLFSAGEGLYTHMKALREDRLSPLHSVYVDQWDWERVMGDGERQFSTLKSTVEAIWAGIKATEAAVSEEGLAPFLPDQIHFVHSQELLSR-----YPDLDAKGRERAIAKDLGA-----------FLVGIGGKLSDRHDVRAPDYDDWSTPSELGHAGLNGD--ILVWNPVLEDAFELSSMGIRVDADTLKHQLALTGDEDRLE---------EWHQALLRGEMPQTIGGGIGQSRLTMLLLQPHIGQVQVWP....... 319
40 -26.5003qtc_A mol:protein length:290 Pyrrolysyl-tRNA synthetase  ali model follow..  15  3...........................................................................................................GGLVPRGSHGASAPALTKSQTDRLEVLLNPKDEISLN-----SGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLMGIDNDTELSKQIFRVDKNFCLRPMLTPNLYNYLRK---KIFEIGPCYRKESDGKEHLEEFTMLVFWQMGSGRENLESIITDFLNHLG----------------IDFKIVGDSCMVFGDTLDVMHGDLELSSALVGPIPLDREWGID-------------------------KPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGIST.................................................................................. 280
41 -25.0005k1p_A mol:protein length:274 Pyrrolysine--tRNA ligase  ali model follow..  21  32...........................................................................................................................................................ELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLLPDPIKIFEIGPCYRKESDGKEHLEEFTMLAFAQMGSGRENLESIITDFLNHL............................................................................................................................................................................................................. 184
42 -24.1004q6g_A mol:protein length:267 Pyrrolysine--tRNA ligase  ali model follow..  20  31...........................................................................................................................................................ELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLMGIDNDTELSKQIFRVDKNFCLRPMVAPNIFNYARKLDRKIFEIGPCYRKESDGKEHLEEFTMLNFFQMGSGRENLESIITDFLNHL............................................................................................................................................................................................................. 183
43 -19.3004cs2_A mol:protein length:274 PYRROLYSINE--TRNA LIGASE  ali model follow..  21  32...........................................................................................................................................................ELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLMGIDNDTELSKQIFRVDKNFCLRPMLAPNLANYLRKLDRKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGRENLESIITDFLNHL............................................................................................................................................................................................................. 184
44 -18.9004gla_C mol:protein length:109 OBody NL8  ali model follow..  23  2.............................SVYPKK---THWTAEITPNL--------HGTEVVVAGWVASLGDYGRVKIVKVSDREGGAAVPVYLEAGKTPDHLFKVFAELSREDVVVIKGIVEASKGRGVEIFPSEIWILNKA.................................................................................................................................................................................................................................................................................................................................................................... 107
45 -16.9004gn5_A mol:protein length:113 OBody AM3L15  ali model follow..  22  3...................................PKKTHWTAEITP--------NLHGSEVVVAGWVAHLGDYGRVKIVKVSDREGGAAVPVYLERGKTPDHLFKVFAELSREDVVVIKGIVEAGWDTGVEIFPSEIWILNKA-KPLP............................................................................................................................................................................................................................................................................................................................................................... 111
46 -16.8004glv_B mol:protein length:107 OBody AM3L09  ali model follow..  20  3...................................PKKTHWTAEITPNL--------HGSEVVVAGWVAHLGDYGRVKIVKVSDREGGAAVPVYLERGKTPDHLFKVFAELSREDVVVIKGIVEATTVTRWDIFPSEIWILNKA.................................................................................................................................................................................................................................................................................................................................................................... 107
47 -16.3004gn4_B mol:protein length:108 OBody AM2EP06  ali model follow..  22  5....................................KKTHWTAEITP--------NLHGSEVVVAGWVAHLGDYGRVKIVKVSDREGGAAVPVYLERGKTPDHLFKVFAELSREDVVVIKGIVEASEATGVEIFPSEIWILNKA.................................................................................................................................................................................................................................................................................................................................................................... 108
48 -14.5005gro_A mol:protein length:115 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  20  15.....................................................SEKDVGKIVKVAGWCNTYRDHGGVVFIDLRDKSGL-VQLVCDPSSKAYEKALE----VRSEFVLVAKGKV-KLKTGKIEIVLEELIIENKS.................................................................................................................................................................................................................................................................................................................................................................... 109
49 -14.4004gn3_B mol:protein length:113 OBody AM1L10  ali model follow..  21  8....................................KKTHWTAEITP--------NLHGTEVVVAGWVASLGDYGRVKIVKVSDREGGAAVSVYLEYGKTPDHLFKVFAELSREDVVVIKGIVEASKAAAVEIFPSEIWILNKA.................................................................................................................................................................................................................................................................................................................................................................... 112
50 -12.1001b70_A mol:protein length:350 PHENYLALANYL-TRNA SYNTHETASE  ali model follow..  16  1.................................................................................MLEEALAAIQNARDLEELKALKARYLGKKGLLTQEMKGLSALPLEERRKRGQELNAIKALEAALEAREKALEEAALKEALERERVDVSLPGASLFSGGLHTLMERELVEIFRALGYQAVEGPEVESEFFNFDALNIPEHHPARDMRLLLRTHTSPMQVRYMVAHTPRIVVPGRVFRFEQTDATHEAVFHQLEGLVV--GEGIAMAHLKGAIYELAQALFGPDSKVRFQPVYFPFVEP----------------------------------GAQFAVWWPEGGKWLELGGAGMVHPKVFQAVDAYRERLGLPPAYRGVTG-------------------------------------------------------------------AFGLGVERLAMLRYG--IPDIRYF........ 335
51 -11.5002rhq_A mol:protein length:294 Phenylalanyl-tRNA synthetase alpha chain  ali model follow..  14  7..........................................................................................................................................GLVPRGSHMGTELMEKLNQQLAEETIDVTLPSRQISIGSKHPLTRTVEEIEDLFLGLGYEIVDGYEVEQDYYNFEALNLPKSHPAITDEILMRTHTSPVQARTMEKRNGKIICPGKVYRRDSDDATHSHQFTQIEGLVVDKNIK--MSDLKGTLELVAKKLFGADREIRLRPSYFPFTEPSVEVDVSCFKCKGKGCNVCKHTG-----------------------------WIEILGAGMVHPNVL--------------------------------------------------------------EMAGFDSNEYSGF--------AFGMGPDRIAMLKYG--IEDIRYF........ 269
52 -11.3004g85_A mol:protein length:517 Histidine-tRNA ligase, cytoplasmic  ali model follow..  12  33............................................................................................................................KQQKASAELIEEEVAKLLKLKAQLGPDESKQKFVLKTPKGTRDYSPRQ-----MAVREKVFDVIIRCFKRHGAEVIDTPVFELKE-GEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAMN--KRYHIAKVYRRD------NPAMTR-EFYQCDFDIAECLKIMCEILSSL----IGDFLVKVNDRRILDGMFAICGVSDSKFRTICSSVDKLDKVSWEEVKNEMVGEKGLAPEVADRIGDYVQQHGGVSLVEQLLQDPKLSQNKQALEGLGDLKLTLFGIDDKISFLARGLDYYTGYEAVLLQTPAQAGEEPLGVGSVAAGGRYDGLVGMFDPKGR----PCVGLSIGVERIFSIVEQRLE.............. 409
53 -11.2003hri_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  12  35...............................................................................................................................................................................ETMRLRKYLFDVFHSTARKFGFEEYDSPVLESEAGEEITEQMFNFITKGGHRVALRPEMTPSLARQLLAKGRKWYSIPQCWRYEAITRGRRREHYQWNM-SVSSEVE-LVCAACTAMQSLGLS-------------SKDVGVKINSRKILQTVVEQAGVSADKFAPVCVIVDKMEKLPRE---------EVVAQLAAIGLESNVVDAITSTLSLKTIDEIAQRIGEEHEAVRELRDFITQIE-------------------------AYGFGDWVIFDASVVRGLAY---PCVGFGFGDCVIVELLNEKKL.............. 348
54 -10.9003net_A mol:protein length:465 Histidyl-tRNA synthetase  ali model follow..  12  1............................................................................................................................................................SNAMAKNDKINFSTPSGFPEFLRLELYLLDTIRRVYESYGFTPIETPAVERLEPPNRQAEKDKSGDTGSEARALKFDQTVPLAAYIARHLNARYQMDVVFRGERAKDGRFRQFRQCDI---VVGREKLSLLYDAQMPAIITEIFEAVNIG-------DFVIRINNRKVLTGFFQSLNISETQIKSCISIIDNLEKIG--------------EAKVKLELEKEGINPEQTQKIIDFVKIDGSVDDVLDKLKHLSQTLPESEQFNLGVSELETVITGVRNLG---------PDKRFCIDLAIARGLNY---PGVGISIGLTRLISRLLKAGI.............. 363
55 -10.8003rac_A mol:protein length:373 Histidine-tRNA ligase  ali model follow..  13  29.........................................................................................................................................................................MQDGYPDFAKRRRAVETRLLSFVEDAGYEPVTSGLFEYVRSPESSRDWIRLFDGGGDAVALRPEMTPSIARMAAPRVARWCYCERVYRRTDDPASLSWA-KAAESTQVGIER-DVLRLLHEASAAAGVR---------------HHRIVVSHARLVPRLLDALGISASLSRAFLACLTSGNYVQ-------------FRELWQLHAAKDVDLLANLLT--WSPAERDAAKRSREASDRELEALLRDAVDPRAAADVRDAWRYLCRLAEALHDSG--ASDVVTFDLALHRELDYGL-PAVGFAFEVERVMAVLEAQEEGE............ 370
56 -10.6003hrk_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  14  35...............................................................................................................................................................................EAMRCRRHLFDVFHATAKTFGFEEYDAPVLESEAGEEITEQMFNFITKGGHRVALRPEMTPSLARLLLGK--KWYSIPQCWRYEAITRGRRREHYQWNMDIVGVK--ELVCAACWAMRSLGLS---------------DVGIKVNSRKVLQTVVEQAGVTSDKFAPVCVIVDKMEKIPRE-----EVEAQLAVLGLEPTVVDAITTTLSLKSIDEIAQRVGEEHEAVKELRQFFEQVLFDASVVRGLAYYTGIVFEGFDREGKFRALCGGGR------DNLLTTYGSPTPPCAGFGFGDCVIVELLQEKRL.............. 348
57 -10.4003od1_A mol:protein length:400 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  11  16.........................................................................................................................................................................MRDTLPEWYKTKKNICDQMTEEINLWGYDMIETPTLEYYVSAILDQQLFKLLDQQGNTLVLRPDMTAPIARLVASSLKRLAYQSNVYRAQQNEGGKPAEFEQVELIGDGTASADVIALMIAALKRAGLS---------------EFKVAIGHVGYVNALLMDVVGNEQRADRLRRFLYEKNYVGYREHVKSLNLSTIDKSRLMNLLS-----------------------RGGRAAIEEARGLIQTEKGKTALAEMTKLYEVLESY---------GASEYVKFDLTLVLHMSYRPAQATGFGVRIDLLVEALNGEIISN............ 334
58 -10.2004g84_A mol:protein length:464 Histidine--tRNA ligase, cytoplasmic  ali model follow..  12  2..................................................................................................................................................PGSEFELRRQFVLKTPKGTRDYSPRQ-----MAVREKVFDVIIRCFKRHGAEVIDTPVFELKE-GEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAMN--KRYHIAKVYRRDAMTRGRYREFYQCDIAGNFDPMIPDAECLKIMCEILSSLQIGDFLVKVNDRRILDGMFAICGVSDSKFRTICSSVDKLDKVSWEEVKNEMVGEKGLAPEVADRIGDYVQQHGGVSLVEQLLQDPKLSQNKQALEGLGDLKLTLFGIDDKISFLARGLDYYTGYEAVLLQTPAQAGEEPLGVGSVAAGGRYDGLVGMFDPKGR----PCVGLSIGVERIFSIVEQRLE.............. 356
59 -9.8701wu7_A mol:protein length:434 Histidyl-tRNA synthetase  ali model follow..  13  18...............................................................................................................................................................................EDMDVEKFIFKTAEEAAEAFGFRRIDFPSLEYLSGEELLQQTYSFVDKGGREVTLIPEATPSTVRMVTSRKDRWYSFPKVWRYEEPQAGRYREHYQFNA-----------------------DIFGSD----------SPEADAEVIALASSILDRLGLQDIYEIRINSRKIMEEIIGGMTSSDPFSVFSIIDRYHKISREE-------------FVDQLRSAGIGEDGVSMIADLCSGTRGIDEMARITGKSSEEIARMAAVEDLLASYGVKNVRYDFSIVRGLSY---PAVGFGMGDAVISLLLKRENV.............. 326
60 -9.4902el9_A mol:protein length:431 Histidyl-tRNA synthetase  ali model follow..  14  2....................................................................................................................................................PGYQDPMAKNIQAIRGMNDYLPGE-----TAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTVTDVVEKEMYTFEDRNGDSLTLRPEGTAGCVRAGIEH--RLWYIGPMFRHERPQKGRYRQFHQLEVFGLQGPDIDLIMLTARWWRALGISEHVTLELNSIGSLEARANYRDALVAFLEQHKEKLDEDCKRRMYTNPL-RVLDSKNPEVQALLNDAPALGDYLDEESREH-------FAGLCKLLESAGIAYTVNQRLVRGLDYYNR-FEWVTNSLGSQGTVCAGGRY------------------DGLVEQLGGRATPAVGFAMGLERLVLLVQAVNP.............. 328
61 -9.3906FTT Entity 1(prereleased)  ali follow..  13  7.........................................................................................................................................................................VADVLFEDAHKQEVLRHQLTQQLITHGYQLVSPPMIEGASEDLKRQTFKIIDQLTGRLMGIRADITPQILRIDAHHGGRYCYAGDVIHTLPSGLFGSRTPLQAEIFGCESIAADI-----ELIDVLFSMI---NSLDMSAVLHVDLG----HVTIFKRLAELAALSASDTEQLMQLYANKNLPELKQVCQVLPMGSDFYTLARFGHDIANL---------GRLSENAQQDTKIVTAIDELQRLKAHLQVQWQCAVSIDVTELSG-FNGYINSETQPLVRGGRFDGMKSNQLATNQPQATGFSMDVSRLLAHTQLDA............... 323
62 -9.3905m8h_A mol:protein length:388 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  13  7.........................................................................................................................................................................VADVLFEDAHKQEVLRHQLTQQLITHGYQLVSPPMIEGASEDLKRQTFKIIDQLTGRLMGIRADITPQILRIDAHHGGRYCYAGDVIHTLPSGLFGSRTPLQAEIFGCESIAADI-----ELIDVLFSMI---NSLDMSAVLHVDLG----HVTIFKRLAELAALSASDTEQLMQLYANKNLPELKQVCQVLPMGSDFYTLARFGHDIANL---------GRLSENAQQDTKIVTAIDELQRLKAHLQVQWQCAVSIDVTELSG-FNGYINSETQPLVRGGRFDGMKSNQLATNQPQATGFSMDVSRLLAHTQLDA............... 323

FFAS is supported by the NIH grant R01-GM087218-01
1 2 6 4 6 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Rodrigues AP, Grant BJ, Godzik A, Friedberg I. The 2006 automated function prediction meeting. BMC Bioinformatics. 2007 May 22;8 Suppl 4:S1-4.