current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 5w25_A mol:protein length:616 Aspartate--tRNA(Asp/Asn) ligase, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .  540    .  550    .  560    .  570    .  580    .  590    .  600    .  610
# Score Template Links and tools%idFirst MGSSSSGLVPRGSHVFVLRSHAAGLLREGDAGQQVTLAGWVARRRDHGGVIFIDLRDASGIAQVVFRDPQDTEVLAQAHRLRAEFCVSVAGVVEIRPEGNANPEIATGEIEVNATSLTVLGECAPLPFQLDEPAGEELRLKYRYLDLRRDDPAAAIRLRSRVNAAARAVLARHDFVEIETPTITRSTPEGARDFLVPARLHPGSFYALPQSPQLFKQLLMVAGMERYYQIARCYRDEDFRADRQPEFTQLDMEMSFVDAEDIIAISEEVLTELWALIGYRIPTPIPRIGYAEAMRRFGTDKPDLRFGLELVECTDFFSDTTFRVFQAPYVGAVVMPGGASQPRRTLDGWQDWAKQRGHRGLAYVLVAEDGTLGGPVAKNLTEAERTGLADHVGAKPGDCIFFSAGPVKSSRALLGAARVEIANRLGLIDPDAWAFVWVVDPPLFEPADEATAAGEVAVGSGAWTAVHHAFTAPKPEWEDRIESDTGSVLADAYDIVCNGHEIGGGSVRIHRRDIQERVFAVMGLDKAEAEEKFGFLLEAFMFGAPPHGGIAFGWDRTTALLAGMDSIREVIAFPKTGGGVDPLTDAPAPITAQQRKESGIDAQPKRVQQALast
1 -209.0005w25_A mol:protein length:616 Aspartate--tRNA(Asp/Asn) ligase  ali model  100  1MGSSSSGLVPRGSHVFVLRSHAAGLLREGDAGQQVTLAGWVARRRDHGGVIFIDLRDASGIAQVVFRDPQDTEVLAQAHRLRAEFCVSVAGVVEIRPEGNANPEIATGEIEVNATSLTVLGECAPLPFQLDEPAGEELRLKYRYLDLRRDDPAAAIRLRSRVNAAARAVLARHDFVEIETPTITRSTPEGARDFLVPARLHPGSFYALPQSPQLFKQLLMVAGMERYYQIARCYRDEDFRADRQPEFTQLDMEMSFVDAEDIIAISEEVLTELWALIGYRIPTPIPRIGYAEAMRRFGTDKPDLRFGLELVECTDFFSDTTFRVFQAPYVGAVVMPGGASQPRRTLDGWQDWAKQRGHRGLAYVLVAEDGTLGGPVAKNLTEAERTGLADHVGAKPGDCIFFSAGPVKSSRALLGAARVEIANRLGLIDPDAWAFVWVVDPPLFEPADEATAAGEVAVGSGAWTAVHHAFTAPKPEWEDRIESDTGSVLADAYDIVCNGHEIGGGSVRIHRRDIQERVFAVMGLDKAEAEEKFGFLLEAFMFGAPPHGGIAFGWDRTTALLAGMDSIREVIAFPKTGGGVDPLTDAPAPITAQQRKESGIDAQPKRVQQA 610
2 -194.0004rmf_A mol:protein length:609 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  81  1................MLRTHAAGSLRPADAGQTVTLAGWVARRRDHGGVIFIDLRDASGVSQVVFREG---DVLAAAHRLRAEFCVAVTGVVEVRPEGNENPEIPTGQIEVNATELTVLGESAPLPFQLDEQAGEEARLKYRYLDLRREGPGNALRLRSKVNAAARSVLAEHDFVEIETPTLTRSTPEGARDFLVPARLQPGSFYALPQSPQLFKQLLMVAGMERYYQIARCYRDEDFRADRQPEFTQLDMEMSFVEADDVIAISEQVLKAVWATIGYDLPLPLPRISYEEAMRRFGSDKPDLRFGIELVECTEYFKDTTFRVFQAPYVGAVVMPGGASQPRRTLDGWQEFAKQRGHKGLAYVLVGEDGTLGGPVAKNLSDAERDGLVAHVGANPGDCIFFAAGPAKGARALLGATRIEIAKRLDLIDPNAWAFTWVVDFPMFEAADEATAAGDVAVGSGAWTAMHHAFTAPKPDSVDTFDSDPGNALSDAYDIVCNGNEIGGGSIRIHRRDIQERVFAMMGIDHDEAQEKFGFLLDAFSYGAPPHGGIAFGWDRITALLAGVDSIREVIAFPKSGGGVDPLTDAPAPITPQQRKESGIDAKPREDKPK 591
3 -193.0004o2d_A mol:protein length:620 Aspartate--tRNA ligase  ali model follow..  80  5.TLEAQTQGPGS---MVLRTHAAGSLRPADAGQTVTLAGWVARRRDHGGVIFIDLRDASGVSQVVFREG---DVLAAAHRLRAEFCVAVTGVVEVRPEGNENPEIPTGQIEVNATELTVLGESAPLPFQLDEQAGEEARLKYRYLDLRREGPGNALRLRSKVNAAARSVLAEHDFVEIETPTLTRSTPEGARDFLVPARLQPGSFYALPQSPQLFKQLLMVAGMERYYQIARCYRDEDFRADRQPEFTQLDMEMSFVEADDVIAISEQVLKAVWATIGYDLPLPLPRISYEEAMRRFGSDKPDLRFGIELVECTEYFKDTTFRVFQAPYVGAVVMPGGASQPRRTLDGWQEFAKQRGHKGLAYVLVGEDGTLGGPVAKNLSDAERDGLVAHVGANPGDCIFFAAGPAKGARALLGATRIEIAKRLDLIDPNAWAFTWVVDFPMFEAADEATAAGDVAVGSGAWTAMHHAFTAPKPDSVDTFDSDPGNALSDAYDIVCNGNEIGGGSIRIHRRDIQERVFAMMGIDHDEAQEKFGFLLDAFSYGAPPHGGIAFGWDRITALLAGVDSIREVIAFPKSGGGVDPLTDAPAPITPQQRKESGIDAKPREDKPK 607
4 -181.0004ah6_A mol:protein length:617 ASPARTATE--TRNA LIGASE, MITOCHONDRIAL  ali model follow..  38  2.......IPEFSS--FVVRTNTCGELRSSHLGQEVTLCGWIQYRRQNT---FLVLRDFDGLVQVIIPQDEAASVKKILCEAPVESVVQVSGTVISRPAGQENPKMPTGEIEIKVKTAELLNACKKLPFEIFVKKTEALRLQYRYLDLRSFQMQYNLRLRSQMVMKMREYLCNLGFVDIETPTLFKRTPGGAKEFLVPSR-EPGKFYSLPQSPQQFKQLLMVGGLDRYFQVARCYRDEGSRPDRQPEFTQIDIEMSFVDQTGIQSLIEGLLQYSWPNDKDPVVVPFPTMTFAEVLATYGTDKPDTRFGMKIIDISDVFRNTEIGFLQDALSKPHGTEGAKYLKRKDIESIRNFAADHFNQEILPVFLNANRNWNSPVANFIMESQRLELIRLMETQEEDVVLLTAGEHNKACSLLGKLRLECADLVVLRDPTLFSFLWVVDFPLFLP---------KEENPRELESAHHPFTAPHPSDIHLLYTEPKKARSQHYDLVLNGNEIGGGSIRIHNAELQRYILATLL---KEDVKMLSHLLQALDYGAPPHGGIALGLDRLICLVTGSPSIRDVIAFPKSFRGHDLMSNTPDSVPPEELKPYHIRVSKPTDSKA 602
5 -180.0001eqr_A mol:protein length:590 ASPARTYL-TRNA SYNTHETASE  ali model follow..  45  1.................MRTEYCGQLRLSHVGQQVTLCGWVNRRRDLGSLIFIDMRDREGIVQVFFDPDR-ADALKLASELRNEFCIQVTGTVRARDEKNINRDMATGEIEVLASSLTIINRADVLPLDSNHVNTEEARLKYRYLDLRRPEMAQRLKTRAKITSLVRRFMDDHGFLDIETPMLTKATPEGARDYLVPSRVHKGKFYALPQSPQLFKQLLMMSGFDRYYQIVKCFRDEDLRADRQPEFTQIDVETSFMTAPQVREVMEALVRHLWLEVKGVDLGDFPVMTFAEAERRYGSDKPDLRNPMELTDVADLLKSVEFAVFAGPANDPKGRPGGASLTRKQIDEYGNFVKIYGAKGLAYIKVNELEGINSPVAKFLNAEIIEDILDRTAAQDGDMIFFGADNKKIVADAMGALRLKVGKDLGLTDESKWAPLWVIDFPMFEDD-----------GEGGLTAMHHPFTSPKDMTAAELKAAPENAVANAYDMVINGYEVGGGSVRIHNGDMQQTVFGILGINEEEQREKFGFLLDALKYGTPPHAGLAFGLDRLTMLLTGTDNIRDVIAFPKTTAAACLMTEAPSFANPTALAELSIQVVKKAENN. 590
6 -177.0004wj3_M mol:protein length:599 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  46  3................MMRSHYCGQLNESLDGQEVTLCGWVHRRRDHGGVIFLDVRDREGLAQVVFDPDR-AETFAKADRVRSEFVVKITGKVRLRPEGARNPNMASGSIEVLGYELEVLNQAETPPFPLYSDVGEETRLRYRFIDLRRPEMAAKLKLRARITSSIRRYLDDNGFLDVETPILGRPTPEGARDYLVPSRTYPGHFFALPQSPQLFKQLLMVAGFDRYYQIAKCFRDEDLRADRQPEFTQIDIETSFLDESDIIGITEKMVRQLFKEVLDVEFDEFPHMPFEEAMRRYGSDKPDLRIPLELVDVADQLKEVEFKVFSGPANDPKGRPGAASMPRSQIDDYTKFVGIYGAKGLAYIKVNEREGLQSPIVKFIPEANLNVILDRVGAVDGDIVFFGADKAKIVCDALGALRIKVGHDL-KLLTREWAPMWVVDFPMFEEN------------DDGSLSALHHPFTSPKCTPAELEANPGAALSRAYDMVLNGTELGGGSIRIHDKSMQQAVFRVLGIDEAEQEEKFGFLLDALKYGAPPHGGLAFGLDRLVMLMTGASSIREVIAFPKTQSAGDVMTQAPGSVDGKALRELHIRLREQPKAE. 593
7 -173.0001efw_A mol:protein length:580 ASPARTYL-TRNA SYNTHETASE  ali model follow..  49  1................MRRTHYAGSLRETHVGEEVVLEGWVNRRRDLGGLIFLDLRDREGLVQLVAHPA--SPAYATAERVRPEWVVRAKGLVRLRPEP--NPRLATGRVEVELSALEVLAEAKTPPFPVEKEASEELRLKYRYLDLRRRRMQENLRLRHRVIKAIWDFLDREGFVQVETPFLTKSTPEGARDFLVPYRHEPGLFYALPQSPQLFKQMLMVAGLDRYFQIARCFRDEDLRADRQPDFTQLDLEMSFVEVEDVLELNERLMAHVFREALGELPLPFPRLSYEEAMERYGSDKPDLRFGLELKEVGPLFRQSGFRVFQEAESVKALAL-PKALSRKEVAELEEVAKRHKAQGLAWARVEEGG--FSGGVAKFLEPVREALLQATEARPGDTLLFVAGPRKVAATALGAVRLRAADLL-GLKREGFRFLWVVDFPLLEWDEE----------EEAWTYMHHPFTSPHPEDLPLLEKDPGRVRALAYDLVLNGVEVGGGSIRIHDPRLQARVFRLLGIGEEEQREKFGFFLEALEYGAPPHGGIAWGLDRLLALMTGSPSIREVIAFPKNKEGKDPLTGAPSPVPEEQLRELGLMVVRP..... 580
8 -118.0004up7_A mol:protein length:777 LYSINE--TRNA LIGASE  ali model follow..  19  17.EYQKAGHNPWPHKF--NVSITVPEFIAQVSDDIVSVAGRVLSKRSSSSLMFIDLHDSQTKLQIMLNKSAYENK----EDFVSLTKMIYRGDICGFTGH--PTRTKTGELSLIPISGMILSPCLMLPSMHYGLGDQETRFRKRYLDLINPESVKNFVLRTKVVKAVRKYLDDKGFLEVETPILTIPGGATARPFITHHNQLDIQMY-MRIAPELYLKELVVGGINRVYEIGRLFRNEGIDQTHNPEFTTCEFYMAYADYNDIMKMTEELLGNMVKD-----------ITGGSTKLEIKDRLMDINNEEDIKMLEKFFKEPIPRPFNSAECSKVIEKHCTELNYYYDGNNEKAMKKLFADFVTEKKMVLD----------FTAPFKRISYVHALEEKFGEKIPRPLDGPEALTFLKKQAIRFNAIC-AEPQTTARVMDKLFGDLIEVD----------LVQPTFVCDQPQLMSPLAKY-----HRSEPELTERFELFILKREIANAYTELNNPIVQRSNFEQQAKGDDEAQLVDEVFLDAIEHAFPPTGGWGLGIDRLAMLLADVDNIKEVILFPTMRPEDELEKKAREAKEDAMVAQELAATEEKGGKKV 595
9 -90.8004j15_A mol:protein length:521 Aspartate--tRNA ligase, cytoplasmic  ali model follow..  22  30.EIMDAAEDYAKERY-DRVLVRVRDLTIQKADEVVWVRARVHTSRAKGKQCFLVLRQQQFNVQALVAVGDSKQMVKFAANINKESIVDVEGVVRKVNQKI--GSCTQQDVELHVQKIYVISLAPRLPLQLDDTVNQDTRLDNRVIDLRTSTSQAVFRLQSGICHLFRETLINKGFVEIQTPKIISAASEGGANVFTVSYFKNNAY--LAQSPQLYKQMCICADFEKVFSIGPVFRAEDSNTHRHTEFVGLDIEMAFNYYHEVMEEIADTMVQIFKGLQERFQTEIQTVNKQFPCEPFKFLEPTLR--LEYCEALAMLREAGVEM----------------------------------------------------------GDEDDLSTPNEKLLGHLV---------------------------KEKYDTDFYILDKYPL----------------------AVRPFYT--------MPDPRNPKQSNSYDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEK----IKAYIDSFRFGAPPHAGGGIGLERVTMLFLGLHNVRQTSMFPRDPK................................ 511
10 -88.3001b8a_A mol:protein length:438 PROTEIN (ASPARTYL-TRNA SYNTHETASE)  ali model follow..  28  1................MYRTHYSSEITEELNGQKVKVAGWVWEVKDLGGIKFLWIRDRDGIVQITAPKKKDPELFKLIPKLRSEDVVAVEGVVNFTPKAKLG-------FEILPEKIVVLNRAEPLPLDPTGKVELDTRLNNRFMDLRRPEVMAIFKIRSSVFKAVRDFFHENGFIEIHTPKIIATATEGGTELFPMKYFEEDAF--LAESPQLYKEIMMASGLDRVYEIAPIFRAEEHNTTRHNEAWSIDSEMAFIDEEEVMSFLERLVAHAINYVREHPKLPFPRVSYDKALEILGDLGKEIPWGEDIDT---------------------------------------------------------------------------------------------------------EGERLLGKYMMENENAPLYFLYQYP----------------------SEAKPFYI--------MKYDNKPEICRAFDLEYRGVEISSGGQREHRHDILVEQIKEKGLNPES----FEFYLKAFRYGMPPHGGFGLGAERLIKQMLDLPNIREVILFPRDRRRLTP............................ 438
11 -86.6001wyd_A mol:protein length:429 hypothetical aspartyl-tRNA synthetase  ali model follow..  29  1................MYRSHFIADVTPEYDGKEVIWAGWVHLLRDLGGKKFIILRDKTGLGQVVVDKN--SSAFGISQELTQESVIQVRGIVKADKRA-------PRGIELHAEEITLLSKAAPLPLDVSGKVKADTRLRERVLDLRRQEMQAVIKIQSLALKAFRETLYKEGFIEIFTPKIIASATEGGAQLF--PVIYFGKEAFLAQSPQLYKE-LMAGVVERVFEVAPAWRAEESDTPFHAEFISMDVEMAFADYNDVMQLLEKILHNIVKTIKEEVKIPIKRLKYTEAIEILRSKGYNIKFGDDIGT-------------------------------------------------------------------------------------------------------------PELRILNEELKEDLYFIVDWPS------------------------------DARPFYTKSKSENPELSESFDLIYKFLEIVSGSTRNHKREVLEEALKKKGLKPES----FEFFLKWFDYGMPPHAGFGMGLARLMVMLTGIQSVKEIVPFPRDKKRLTP............................ 429
12 -86.5001asy_A mol:protein length:490 ASPARTYL-tRNA SYNTHETASE  ali model follow..  22  3TAKDNYGKLPLIQSRDSKRVKFVDLDEAKDSDKEVLFRARVHNTRQQGALAFLTLRQQASLIQGLVKANKSKNMVKWAGSLNLESIVLVRGIVKKVDEPIKSAT--VQNLEIHITKIYTISETEALPILLEDVVNLDTRLDYRVIDLRTVTNQAIFRIQAGVCELFREYLATKKFTEVHTPKLLGAPSEGGSSVFEVTYFKGKAY--LAQSPQFNKQQLIVADFERVYEIGPVFRAENSNTHRHTEFTGLDMEMAFEEYHEVLDTLSELFVFIFSELPKRFAHEIELVRKQYPVEEFKLPKDGKMVRLTYKEGIEMLRAAGKEIGDFEDLSTENEKFLGKLVRDKYDT-------------------------------------------------------------------------------------DFYILDKFPL---------------------EIRPFYTMPDPANPKY---------SNSYDFFMRGEEILSGAQRIHDHALLQERMKAHGLSPED--PGLKDYCDGFSYGCPPHAGGGIGLERVVMFYLDLKNIRRASLFPRDPK................................ 486
13 -85.2003bju_A mol:protein length:521 Lysyl-tRNA synthetase  ali model follow..  17  18.QLKVNGEDPYPHKF--HVDISLTDFIQKYTDITLKVAGRIHAKRASGKLIFYDLRGEGVKLQVMANSRNEEEFIHINNKLRRGDIIGVQGNPG---------KTKKGELSIIPYEITLLSPCHMLPHLHFGLKDKETRYRQRYLDLLNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHNELDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKMVSGMVKHITGSY-----KVTYHPDGPEGQAYDVDFTPPFRRINMVEELEKALGMKLPET---------------------------------------NLFETEETRKILDDICVAKAVECPPPRTTARLL---------------------------------------------------DKLVGEFLEVTCINPTFICDHPQIMSPLAKWHRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKGDDEAMFIDENFCTALEYGLPPTAGWGMGIDRVAMFLTDSNNIKEVLLFPAMKP................................ 507
14 -84.9005hgq_A mol:protein length:524 Lysine--tRNA ligase  ali model follow..  18  20.ERRSKGINPYPHKF--HVSISLADFIAKYNDIVQSVAGRVFSKRESGKLIFYDLHGEGTRLQVLANARFDEAFDNLHDRIKRGDIIGVNGYPA---------RSKSGELSIIPYEIIQLTPCHMLPHTHFGLKNQETRYRMRYLDLMNPDVKNRFVTRSRMISFLRRYLDNLGFLEVETPMMNLIAGGATAKPFITHHNDLDMDLYLRVAPELYLKMLVVGGIDRVYEIGRVFRNEGIDQTHNPEFTSCEFYMAYADYEDLMKITEDMLARMVYYMHGTYKIQYH----PNGIVENPVYEVDFTPPFRKVNIYDGLQEKLGIQFPPA---------------------------------------DTLDTDEANKFFDKLAVENNVECPAPRTTARLL---------------------------------------------------DKLIGEFLEPTFISPTFLTGHPQIMSPLAKWHRSIPGLTERFELFVVTKEIVNAYTELNDPLTQRLRFDEQAKGDDEAQNIDENYCTALEYGLPPTAGWGMGIDRLAMILTDSNNIKEVLFFPAMRPDEKGTNVLDEGGNA.................. 524
15 -84.7005eln_A mol:protein length:535 Lysine--tRNA ligase  ali model follow..  17  27.CIKDAGRPFYPHKF--KISMSLPAYALKYKDTTLSLSGRVTSIRSSSKLIFYDIFCEEQKVQIIANIMETGEFSVSHSEIRRGDVVGFTGFPG---------KSKRGELSLFSKSVVLLSPCHMLPTAISGLKDQEVRYRQRYLDLLNEESRKVFKLRSRAIKYIRNYFDRLGFLEVETPMLNMIYGGAAARPFITYHNELETQLYMRIAPELYLKQLIVGGLDKVYEIGKNFRNEGIDLTHNPEFTAMEFYMAYADYYDLMDLTEELISGLVLEIHGSL-----KIPYHPDGPEGKCIEIDFTTPWKRFSFVEEIESGL------------------------------------------EKLKRPLDSQENIDFMVEMCEKHEIELPHPRTAAKLL---------------------------------------------------DKLAGHFVETKCTNPSFIIDHPQTMSPLAKWHREKPEMTERFELFVLGKELCNAYTELNEPLQQRKFFEQQADGDVEACPIDETFCLALEHGLPPTGGWGLGIDRLIMFLADKNNIKEVILFPAMRNVKQNAQHSNQHSG................... 528
16 -83.9003m4p_A mol:protein length:456 Asparaginyl-tRNA synthetase, putative  ali model follow..  22  8...........EATTTPVETPIVCNIRDGLEGKLVTFKGWAYHIRKARKLIFVELRDGSGYCQCVIFGKELCE-PEKVKLLTRECSLEITGRLNAYAGKNHPPEIADLNLEMQVTEWKVIGESIDLENIINKDSSIPQKMQNRHIVIRSEHTQQVLQLRSEIQWYFRKYYHDNHFTEIQPPTIVKTQCEGGSTLFKLQYFNEPAY--LTQSSQLYLE-SVIASLGKSFCMLSSYRAEQSRTVRHAEYLHLEAELPFISFEDLLNHLEDLVCTVIDNVMAVPTRPFKRMTYADAIKYCNDHGILNKDKPFEYG---------------------------------------------------------------------------------------------------------EDISEKPERQMTDEIGCPIFMIHFP----------------------SKMKAF---------MSKVPGHPDLTESVDLLMPGVEIVGGSMRIWNYDELMGAYKANGLNPDP----YYWYTQQRKYGSCPHGGYGLGVERLVMWLLGEDHIRKVCLYPRYLERCEP............................ 456
17 -83.6003a74_A mol:protein length:493 Lysyl-tRNA synthetase  ali model follow..  20  18.KIEELGVDPFGKRF--ERTHKAEELFELYQQIEVAVAGRIMTKRGMGKAGFAHIQDVTGQIQIYVRQDDGEQQYELFKISDLGDIVGVRGTMF---------KTKVGELSIKVSSYEFLTKARPLPEKYHGLKDIEQRYRQRYLDLMNPESKKTFITRSLIIQSMRRYLDSHGYLEVETPMMHAVAGGAAARPFITHHNALDMTLYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGISTRHNPEFTMLELYEAYADFRDIMKLTENLIAHIATEVLGTTKIQYGEHLVDLTPEWRRLHMVDAIKEYVGVDFWRQMSDEEARELAKEHG------------------------------------------------------------------------------------------------------------VEVAPHMTFGHIVNEFFEQKVEDKLIQPTFIYGHPVEISPLAKKNPDDPRFTDRFELFIVGREHANAFTELNDPIDQRQRFEEQLKGNDEAHEMDEDFLEALEYGMPPTGGLGIGVDRLVMLLTNSPSIRDVLLFPQMRH................................ 492
18 -82.5001x54_A mol:protein length:434 Asparaginyl-tRNA synthetase  ali model follow..  25  1................MIEKVYCQEVKPELDGKKVRLAGWVYTNMRVGKKIFLWIRDSTGIVQAVVAKNVGEETFEKAKKLGRESSVIVEGIVKADERA-------PGGAEVHVEKLEVIQAVSEFPIPEPEQASPELLLDYRHLHIRTPKASAIMKVKETLIMAAREWLLKDGWHEVFPPILVTGAVEGGATLFKLKYF--DKYAYLSQSAQLYLEAA-IFGLEKVWSLTPSFRAEKSRTRRHTEFWHLELEAAWMDLWDIMKVEEELVSYMVQRTLELTEPPFPRISYDEAIDILQSKGVNVEWGDDLGADEERVLTEEFD--------------------------------------------------------------------------------------------------------------RPFFVYGYP----------------------KHIKAFYMKEDPN------DPRKVLASDMLAPEGYGEIIGGSQREDDYDKLLNRILEEGMDPKD----YEWYLDLRRYGSVPHSGFGLGVERLVAWVLKLDHIRWAALFPRTPA................................ 430
19 -81.7006aqh_A mol:protein length:508 Lysine--tRNA ligase  ali model follow..  21  26.DLLAQGRQPYPVDV--PRTHTLLEIRQAYTGEIVGVTGRVVFARNSGKLCFATLQEGDGQLQAMISLAEQEALDNWKTYVDIGDIVFVHGEVI---------TSKRGELSVLADSWQMAAKARPLPVAHKEM-SEESRVRQRYVDLVRDQARKVARQRIAVMRAIRSALERRGFLEVETPMLQTLAGGAAARPFVTHSNALDTELYLRIAPELFLKRCLVGGFERVFELNRVFRNEGADSTHSPEFVMLETYQAYGTYDDSAVVTRELIQEVADEAIGTRQ-----------VPLPDGTVYDLDGEWESIQMYPSLSEA-------------------------------------------LGEEITPDTPAETLWAIADRLGLDIPRDRGYGHGKLV---------------------------------------------------EELWEHTVGAKLWAPTFVKDFPVETTPLTRSHRSIPGVTEKWDLYVRRIELATGYSELTDPIIQRERFEAQARGDDEAMALDEDFLAALEYGMPPSTGTGMGIDRLMMTLTGL-SIRETVLFPIVKP................................ 501
20 -81.5001e1o_A mol:protein length:504 LYSYL-TRNA SYNTHETASE, HEAT INDUCIBLE  ali model follow..  21  27.ALRQQG-VAFPNDF--RRDHTSDQLHEEFLNIEVSVAGRMMTRRIMGKASFVTLQDVGGRIQLYVARDSEGVYNDQFKKWDLGDIIGARGTLF---------KTQTGELSIHCTELRLLTKARPLPDKFHGLQDQEVRYRQRYLDLANDKSRQTFVVRSKILAAIRQFMVARGFMEVETPMMQVIPGGASARPFITHHNALDLDMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYHDLIELTESLFRTLAQEVLGTTKVT------------YGEHVFDFGKPFEKLTMREAIKK---------------------------------------------------------------------------YRPETDMADLDNFDAAKALAESIGITVEKSWGL--------------------GRIVTEIFDEVAEAHLIQPTFITEYPAEVSPLARRNDVNPEITDRFEFFIGGREIGNGFSELNDAEDQAERFQEQVNGDDEAMFYDEDYVTALEYGLPPTAGLGIGIDRMIMLFTNSHTIRDVILFPAMRPQK.............................. 504
21 -81.2005vl1_A mol:protein length:506 Lysine--tRNA ligase  ali model follow..  20  23.RLLAEGYDPYPVAI--ERTHTLAEIRATYTEDIVGVAGRVVFARNTGKLCFATLQDGDGTLQAMISLDERESLDRWKADVDIGDVVYVHGTVI---------SSRRGELSVLADSWRMAAKARPLPVAHKEM-SEESRVRQRYVDLVRPQAREVARQRIAVIRAVRNALERRGFLEVETPMLQTLAGGAAARPFVTHSNALDIDLYLRIAPELFLKRCIVGGFDRVFELNRVFRNEGSDSTHSPEFSMLETYQTYGTYDDSALITRELIQEVADEAIGTRQLEWATMEMYSSLSEA-----QITPETTVARLRDIASGLDVEIDNSVFGHGKLV--------------------------------------------------------------------------------------------------------------------EELWEHAVGNKLTAPTFVKDFPVETTPLTRQHRSIPGVTEKWDLYVRGVELATGYSELNDPVVQRDRFADQARGDDEAMQLDEDFLTALEYGMPPCTGTGMGIDRLLMCLTGL-SIRETVLFPIVRPHSN............................. 500
22 -80.9004ex5_A mol:protein length:529 Lysine--tRNA ligase  ali model follow..  20  43.ALRDQG-IAYPNDF--QPTHHAADLQTAYKSLEVAIAGRMMLKRVMGKASFATVQDGSGQIQFFVTPADGAETYDAFKKWDLGDIVAARGVLF---------RTNKGELSVKCTQLRLLAKARPLPDKFHGLADQETRYRQRYVDLVTPETRTTFRARTKAIASIRKFMGDADFMEVETPMLHPIPGGAAAKPFVTHHNALDMEMFLRIAPELYLKRLIVGGFERVFEINRNFRNEGVSPRHNPEFTMMEFYAAYTDYRWLMDFTERLIRQAAVDALGTATIQYQGRELDLAQPFHRLTITQAIQKYAPSYTDGQLSDDA----------------------------------------------------FLRSELKRLGVDVTQPAFLNAGIGALQ---------------------------------------------------LALFEETAEAQLWEPTFIIDYPIEVSPLARESDTVAGITERFELFITGREIANGFSELNDPEDQAARFKKQVEGDEEAMFFDADYIRALEYGMPPTGGCGIGIDRLVMLLTDSPTIRDVLLFPHLRR................................ 521
23 -80.8004ycv_A mol:protein length:516 Lysine--tRNA ligase  ali model follow..  17  18.DQKDKGINPYPHKF--ERTISIPEFIEKYEDTILNITGRIMRVSASGKLRFFDLVGDGEKIQVLANYSEKGNFAECYDKIRRGDIVGIVGFPG---------KSKKGELSIFPKETILLSACLHMLPMKYGLKDTEIRYRQRYLDLINESSRHTFVTRTKIINFLRNFLNERGFFEVETPMMNLIAGGANARPFITHHNDLDLDLYLRIATELPLKMLIVGGIDKVYEIGKVFRNEGIDNTHNPEFTSCEFYWAYADYNDLIKWSEDFFSQLVYHLFGTY-----KISYNKDGPENQPIEIDFTPPYPKVSIVEEIEK--------------------------------------VTNTILEQPFDSNETIEKMINIIKEHKIELPNPPTAAKLLDQLA-----------------------------------------------------SHFIENKYNDKPFFIVEHPQIMSPLAKYHRTKPGLTERLEMFICGKEVLNAYTELNDPFKQKECFKLQQKGDTEAAQLDSAFCTSLEYGLPPTGGLGLGIDRITMFLTNKNSIKDVILFPTMRP................................ 506
24 -80.8001bbu_A mol:protein length:504 PROTEIN (LYSYL-TRNA SYNTHETASE)  ali model follow..  20  27.NLREQG-IAFPNDF--RRDHTSDQLHAEFLNIEVAVAGRMMTRRIMGKASFVTLQDVGGRIQLYVARDDEGVYNEQFKKWDLGDILGAKGKLF---------KTKTGELSIHCTELRLLTKARPLPDKFHGLQDQEARYRQRYLDLSNDESRNTFKVRSQILSGIRQFMVNRGFMEVETPMMQVIPGGAAARPFITHHNALDLDMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYKDLIELTESLFRTLAQDILGKTEVTYGDVTLD---------------------------------------------------------------------------------------FGKPFEKLTMREAIKKYRPETDMADLDNFDSAKAIAESIGIHVEKSWGL--------------------GRIVTEIFEEVAEAHLIQPTFITEYPAEVSPLARRNDVNPEITDRFEFFIGGREIGNGFSELNDAEDQAQRFLDQVAGDDEAMFYDEDYVTALEHGLPPTAGLGIGIDRMVMLFTNSHTIRDVILFPAMRPVK.............................. 504
25 -79.7006chd_A mol:protein length:597 Lysine--tRNA ligase  ali model follow..  17  86.QLKVNGEDPYPHKF--HVDISLTDFIQKYTDITLKVAGRIHAKRASGKLIFYDLRGEGVKLQVMANSRNEEEFIHINNKLRRGDIIGVQGNPG---------KTKKGELSIIPYEITLLSPCHMLPHLHFGLKDKETRYRQRYLDLLNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHNELDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKMVSGMVKHITGSY-----KVTYHPDGPEGQAYDVDFTPPFRRINMVEELEKALGMKLPET---------------------------------------NLFETEETRKILDDICVAKAVECPPPRTTARLL---------------------------------------------------DKLVGEFLEVTCINPTFICDHPQIMSPLAKWHRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKGDDEAMFIDENFCTALEYGLPPTAGWGMGIDRVAMFLTDSNNIKEVLLFPAMKPEDKKENVATTDTLESTTVGTSV.......... 597
26 -79.4005xix_A mol:protein length:472 Asparagine--tRNA ligase, cytoplasmic  ali model follow..  22  15.MAKKITIKNDPSLPEPKCVKI--GALEGYRGQRVKVFGWVHRLRRQGKLMFLVLRDGTGYLQCVLADELCQC--YNGVLLSTESSVAVYGMLNLTPKG----KQAPGGHELSCDFWELIGLAAGGADNLIEESDVDVQLNNRHMMIRGENMSKILKARSMVTRCFRDHFFDRGYYEVTPPTLVQTQVEGGATLFKLDYFGEEAF--LTQSSQLYLE-TCLPALGDVFCIAQSYRAEQSRTRRHAEYTHVEAECPFLTFDDLLNRLEDLVCDVVDRILKSPKRPFKRMNYSDAIVWLKEHDVKKEDGTFYEFGEDIPEAPE--------------------------------------------------------------------------------------------------------RLMTDTINEPILLCRFP----------------------VEIKSF---------MQRCPEDSRLTESVDVLMNVGEIVGGSMRIFDSEEILAGYKREGIDPTP----YYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRDVCLYPRFVQ................................ 462
27 -78.9001n9w_A mol:protein length:422 aspartyl-tRNA synthetase 2  ali model follow..  30  9...........................KAHVGQEVELLGFLHWRRDLGRIQFLLLRDRSGVVQVVTGGL---------KLPLPESALRVRGLVVENAK-------APGGLEVQAKEVEVLSPAEPTPVEIEWRANPDTLLEYRYVTLRGEKARAPLKVQAALVRGFRRYLDRQDFTEIFTPKVVRAGAEGGSGLFGVDYFEKRAY--LAQSPQLYKQ-IMVGVFERVYEVAPVWRMEEHHTSRHNEYLSLDVEMGFIDEEDLMRLEEALLAEMLEEALNTFPQDIPRLTHAEAKRILKEELGYPVGQDLSEEAERLLGEY----------------------------------------------------------------------------------------------------------AKERWGSDWLFVTRYP----------------------RSVRPF----------YTYPEEDGTTRSFDLLFRGLEITSGGQRIHRYEELLESLKAKGMDPEA----FHGYLEVFKYGMPPHGGFAIGAERLTQKLLGLPNVRYARAFPRDRH................................ 418
28 -78.8003i7f_A mol:protein length:548 Aspartyl-tRNA synthetase  ali model follow..  20  28.SGENFKVMPMHQSQPCYKTTEIEELVPAMAEKTVTIRARVQAVRGKGNMVFLFLRKGIYTCQALVMKSESKEFVQFCQKISAESICDITGIVKAVEKPI--EKATQQDVEIHVTSIAVVSLAEKASAQKYVKVSQDTRLDNRMLDLRTVTNIAIFRIQSACCGLFREFLTSQKFVEIHTPKLIGCSSEGGSNIFEVKYFDRKAY--LAQSPQLYKQMAIMGDFRKVFEVGPVFRAENSNTRRHTEFEGLDIEMEIVNYHECIDVMEKLFTFIFDEIPKRIYRPFLRLTYKEAIEMLRASGETIGDYDDF----------------------------------------------------------TTPQEVKLGELIKAKYNTD-----------------------------------------------FYILDKFP----------------------AAIRPF---------TMPDIDDPNYSNSYDVFVRGQEITSGAQRIHDPEFLMKRCIEKGVDPAT----LKDYIESFRFGSWPHAGCGIGLERITMLYLGIPNIRKVTLFPRDPI................................ 544
29 -78.0002xti_A mol:protein length:437 ASPARAGINYL-TRNA SYNTHETASE, CYTOPLASMIC, PUTATIVE  ali model follow..  24  9...........................VKHRNERVCIKGWIHRMRRQGKLMFFILRDGTGFLQVLLMDKLCQT--YDALTVNTECTVEIYGAIKEVPEG----KEAPNGHELIADFWKIIGNAPPIDNVLNEEASVDKMLDNRHLVIRGENAAALLRLRAAATRAMREHFYNAGYVEVAPPTLVQTQVEGGSTLFNLDYFGEQSF--LTQSSQLYLETC-IPTLGDVFCIAQSYRAEKSRTRRHAEYAHVEAECPFITLDDLMEKIEELVCDTVDRLLADPERPFLRMEYKDAIKWLQEHNVENEFGNTFTYGEDIAEAAE--------------------------------------------------------------------------------------------------------RFMTDTINKPILLNRFP----------------------SEIKAFYM--------QRDAKDNTLTESVDLLMPGVEIVGGSMRIWKFDELSKAFKNVEIDPKP----YYWYLDQRLYGTCPHGGYGLGLERFICWLTNTNHIRDVCLYPRFVG................................ 433
30 -62.4003p8t_A mol:protein length:294 AsnS-like asparaginyl-tRNA synthetase related protein  ali model follow..  20  2..............................................................................................................................................NAVEIISRDIYKAIDIQTKILDYMTKFFTDRGFKWLLPIMLSPITPDPAGEGIRPAEVD-GVRMRLTHSMILHKQLAIAMGLEKIFVLSPNIRLESRRKDHSYEFTQLDFEIEGAKMKDVMRLIEELIYGLFRKAEEPRARHFKVYDYKDILEEFGSDEK-----------------------------------------------------------------------------------------------------------------------------ASMEMEEPFWIVNIPREFYD----------------------------------REENGVWKNYDLILPYGYGEVSSGGEREWEYEKIVAKIRAAGLKEDS----FRPYLEIARAGLKPSAGAGIGVERLVRFIVGAKHIAEVQPFPRVPGIPAVI........................... 294
31 -61.1003a5y_A mol:protein length:345 Putative lysyl-tRNA synthetase  ali model follow..  18  2...................................................................................................................................GSSSSGLVPRGSHMSEQPSASIPNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIETRFVGPGHSQGMNLWLMTSPEYHMKRLLVAGCGPVFQLCRSFRNEEMGRYHNPEFTMLEWYRPHYDMYRLMNEVDDLLQQVLDC------PAAESLSYQQAFLRY---------------------------------------LEIDPLSADKTQLREVAAKLDLSNVADTEEDRDTLLQLLFTFGVEPNIGK-----------------------------------------------------------------------------EKPTFVYHFPASQASLAQISTEDHRVAERFEVYYKGIELANGFHELTDAREQQQRFEQDNRRGLPQHPIDQNLIEALKVGMPDCSGVALGVDRLVMLALGAETLAEVIAFSVDRA................................ 339
32 -58.8001nnh_A mol:protein length:294 asparaginyl-tRNA synthetase-related peptide  ali model follow..  19  2..............................................................................................................................................NAVEIISREISPTLDIQTKILEYMTDFFVKEGFKWLLPVIISPITPDPAGEGMEPAEVE-GVKMRLTHSMILHKQLAIAMGLKKIFVLSPNIRLESRQKDHAYEFTQLDFEVERAKMEDIMRLIERLVYGLFRKAEEPKTKRFEVFEYSEVLEEFGSDEK-----------------------------------------------------------------------------------------------------------------------------ASQEMEEPFWIINIPREFYDR----------------------------------EVDGFWRNYDLILPYGYGEVASGGEREWEYEKIVAKIRKAGLNEDS----FRPYLEIAKAGLKPSAGAGIGVERLVRFIVGAKHIAEVQPFPRIPGIPAVI........................... 294
33 -57.5003g1z_A mol:protein length:326 Putative lysyl-tRNA synthetase  ali model follow..  19  9...................................................................................................................................................QPSASIPNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIETRFVGPGHSQGINLYLMTSPEYHMKRLLAAGCGPVFQLCRSFRNEEMGRHHNPEFTMLEWYRPHYDMYRLMNEVDDLLQQVLDC------QPAESLSYQQAFQRH---------------------------------------LEIDPLSADKTQLREAAAKLDLSNIADTEEDRDTLLQLLFTMGVEPHIGK-----------------------------------------------------------------------------EKPTFIYHFPASQASLAQISTEDHRVAERFEVYYKGIELANGFHELTDAREQQQRFEQDNRRGLPQQPIDQNLLDALAAGLPDCSGVALGVDRLVMLALGAESLADVIAFTVDRA................................ 326
34 -44.30011as_A mol:protein length:330 ASPARAGINE SYNTHETASE  ali model follow..  14  1.......................................................................................................................................................MKTAYIAKQRQISFVKSHFSRQGLIEVQAPILSRVGDGTQDNLSVKVKALPDAQFEVVHSLAKWKRQTLFSAGEGLYTHMKALRDEDRLSPLH-YVDQWDWERVMGDGERQFSTLKSTVEAIWAGIKATLPDQIHFVHSQELLSRYPDLDAKGRERAIAKDLGAVF---------------------------------------------------------------------------------------------------------------------------------LVGIGGKLSDGHRHDVRAPDYDDWSTPSELGHAGLNGD----ILVWNPVLEDAFELSSMGIRVDADTLKHQLALT----GDEDRLELEWHQALLRGEMPQTIGGGIGQSRLTMLLLQLPHIGQVQAWPAAVR................................ 323
35 -44.3004lns_A mol:protein length:351 Asparagine synthetase a  ali model follow..  13  4.............................................................................................................................................DGYSSYV-LLQEQILTVKRSFSEALEKEL---NLVEVRAPILFRVGDGTQDNLSVPVKAIPNASFEVVHSLAKWKRRTLFAPGHGLYTHMTALRDDVLDNIHSVVVDQWDWEMVMKDDQRNLAFLKEVVCKVYAAIRKTELAVCEKYKQKPILPE----------------------------------------------------------------------TIQFVHAEHLLLAYPNLTAKEREREIAREYGAVFLIGIGAVLS-------------------------------------SGDRHDARAPDYDDWTSPVEASQVVFPRTSKPIPTMNSLSSLKGLNGDILLDSLEVSSMGIRVNAEALRHQ----ISLTGDDSLLKSEWHQQLLNGEFPQTVGGGIGQSRMVMFMLRKKHIGEVQCWPEEIRKKHNLL.......................... 351
36 -43.3005gro_A mol:protein length:115 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  38  2.............AVGTMRSHFCTEISEKDVGKIVKVAGWCNTYRDHGGVVFIDLRDKSGLVQLVCDPS--SKAYEKALEVRSEFVLVAKGKVRLRGAGLENPKLKTGKIEIVLEELIIENKS....................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 109
37 -40.6004gn5_A mol:protein length:113 OBody AM3L15  ali model follow..  23  2...............SPKKTHWTAEITPNLHGSEVVVAGWVAHLGDYGRVKIVKVSDREGGAAVPVYLERPDHLFKVFAELSREDVVVIKGIVEAGWPVAL-----DTGVEIFPSEIWILNKAKPLPID................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 113
38 -38.6004gn3_B mol:protein length:113 OBody AM1L10  ali model follow..  22  3............GSVYPKKTHWTAEITPNLHGTEVVVAGWVASLGDYGRVKIVKVSDREGGAAVSVYLEYPDHLFKVFAELSREDVVVIKGIVEASKA---AADMHNG-VEIFPSEIWILNKAK...................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 113
39 -38.4004gla_C mol:protein length:109 OBody NL8  ali model follow..  22  2.............SVYPKKTHWTAEITPNLHGTEVVVAGWVASLGDYGRVKIVKVSDREGGAAVPVYLEAPDHLFKVFAELSREDVVVIKGIVEASK-------GVGRGVEIFPSEIWILNKAKA..................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 109
40 -38.4004gn4_B mol:protein length:108 OBody AM2EP06  ali model follow..  22  1.............AVYPKKTHWTAEITPNLHGSEVVVAGWVAHLGDYGRVKIVKVSDREGGAAVPVYLERPDHLFKVFAELSREDVVVIKGIVEASEQYGS-----ATGVEIFPSEIWILNKA....................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 108
41 -37.5004glv_B mol:protein length:107 OBody AM3L09  ali model follow..  21  2...............SPKKTHWTAEITPNLHGSEVVVAGWVAHLGDYGRVKIVKVSDREGGAAVPVYLERPDHLFKVFAELSREDVVVIKGIVEATTVTRW-----DTGVEIFPSEIWILNKA....................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 107
42 -35.8002zni_A mol:protein length:308 Pyrrolysyl-tRNA synthetase  ali model follow..  15  3..........................................................................SSSSGLVPRGSHMFLTRRDPPLSSFTKVQYQRLKELNASGEQLEMGFSDLSRDRAFQGIEHQLMSQGKRHLELRTVKHRPAL---LELEEKLAKALHQQGFVQVVTPTILAKMTIGEDHPLFSQVFWLDGKKCLRLAPNLYTLWRLWDKPIRIFEIGTCYRKESQGAQHLNEFTMLNLTELGTPLEERHQRLEDMARWVLEAAG------IREFELVTESSVVYGDTVDVM................................................................................................................................................................................................................................................................................................................. 238
43 -25.8004bw9_A mol:protein length:291 PYRROLYSINE--TRNA LIGASE  ali model follow..  13  3..........................................................................SSSSGLVPRGSHMASAPALT---------KSQTDRLEVLLNPKDEISLNS--GKPFRELESELLSRRKKDLQQIYAE--ERENYLGKLEREITRFFVDRGFLEIKSPILIERMGIDNDTELSKQIFRVDKNFCLPMLAPNLGNYLRLPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQ--MGSGCTRENLESIITDFLNHL............................................................................................................................................................................................................................................................................................................................................. 201
44 -25.6002e3c_A mol:protein length:291 Pyrrolysyl-tRNA synthetase  ali model follow..  14  7..............................................................................GLVPRGSHMASAPALT---------KSQTDRLEVLLNPKDEISLN--SGKPFRELESELLSRRKKDLQQIYAE--ERENYLGKLEREITRFFVDRGFLEIKSPILIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLLPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCENLESIITDFLNHLLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFK................................................................................................................................................................................................................................................................................................. 266
45 -24.6004tqd_A mol:protein length:291 Pyrrolysine--tRNA ligase  ali model follow..  16  7..............................................................................GLVPRGSHMASAPALT---------KSQTDRLEVLLNPKDEISLN--SGKPFRELESELLSRRKKDLQQIYAE--ERENYLGKLEREITRFFVDRGFLEIKSPILIERMGIDNDTELSKQIFRVDKNFCLRLAPNLYNYLRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLSFIQMGSGRENLESIITDFLNHLLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLL........................................................................................................................................................................................................................................................................................................ 259
46 -21.1003qtc_A mol:protein length:290 Pyrrolysyl-tRNA synthetase  ali model follow..  19  3.........................................................................................GGLVPRGSHGASATKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKK----DLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIERMGIDNDTELSKQIFRVDKNFCLRPTPNLYNYLRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLVFWQMGSGRENLESIITDFLNHL................................................................................................................................................................................................................................................................................................................................................. 198
47 -20.9005k1p_A mol:protein length:274 Pyrrolysine--tRNA ligase  ali model follow..  16  2.................................................................................................PALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYA------EERENYLGKLEREITRFFVDRGFLEIKSPILIERMGIDNDTELSKQIFRVDKNFCLRPAPNLYNYLRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLAFAQMGSGRENLESIITDFLNHLLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLL........................................................................................................................................................................................................................................................................................................ 242
48 -20.3004q6g_A mol:protein length:267 Pyrrolysine--tRNA ligase  ali model follow..  15  1................................................................................................PALTKSQTDRLEVLLNPKDEISL---------SGKPFRELESELLSRRKKLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIERMGIDNDTELSKQIFRVDKNFCLRVAPNIFNYARKLDR--KIFEIGPCYRKESDGKEHLEEFTMLNFFQM-CTRENLESIITDFLNHLLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKV...................................................................................................................................................................................................................................................................................................... 243
49 -19.2004cs2_A mol:protein length:274 PYRROLYSINE--TRNA LIGASE  ali model follow..  17  3..............................................................................................................ALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKK-EERENYLGKLEREITRFFVDRGFLEIKSPILSKQIFRVDKNFCLRPMLAPNLANYLRKLDRALPDPI------KIFEIGPCYRKESDGKEHLEEFTMLNFCQSGCTRENLESIITDFLNHL................................................................................................................................................................................................................................................................................................................................................. 184
50 -14.1002j3l_A mol:protein length:572 PROLYL-TRNA SYNTHETASE  ali model follow..  13  1..............................................................................................MKQSKMLIPTLREVPNDAEVLSHQILLRAGYIRQVAAGI--------YSYLPL-------ANRVLEKLKTIMREEFEKIDAVEMLMPALYRLKDRNDRDYILGPTHEETFTELIRDEINSYKRLPL-----NLYQIQTKYRDE-----RGREFIMKDGYSFHADEASLDQSYRDY-EKAYSRIFERCGLEFRAII-GDGGAMGGKDSKEFMAISEIGEDTICYSTESDYAANLEMATSLYTPKKSHETQLDLEKIATPEVGTIAEVANFFEVEPQRIIKSVLFIADEEPVMVLVRGDHDVNDVKLKNFLGADFLDEATEEDARRVLGAGFGSIGPVNVSEDVKIYADLAVQDLANAIVGANEDGYHLTNVNPDRDFQPISYEDLRFVQEGDPSPDGNGVLAFTKGIEIG------HIFKLGTRYSDAMGATVLDENGR-----KSVIMGC-----YGIGVSRLLSAIVEQNADERGINWPTG---------APFDLH-AMMTEAGYEVLVDDRNER 511
51 -13.4005ucm_A mol:protein length:579 Proline--tRNA ligase  ali model follow..  12  1............................................................................................MAMRTSQYLLSTLKETPADAVVISHQLLLRAGMIRRLASGL--------YTWLPM-------GLRVLRKVETIVREEMNAAGALEVLMPAVQPAE-EQYGPELLRLKDRHEREFCVGPTHEEVITDLARNELNSYYQIQTKFRDE-----RGREFIMKDAYSFHLSQDSLQQTYDGM-YQAYSKIFSRLGLDFRPVQ-ADNGSIGGSGSHEFHVLANSGEDDIVFSDSSDYAANIEKAEAVPRESARGSATEDMRLVDTPNTKTIAALVDGFQLPIEKTIKTLVVHGAEEGTALIVRGDHELNEIKAANQPLVASPLVFASEAEIRAAIGAGPGSLGPVNLPIACIVDRSVALMSDFAAGANIEDKHYFGVNWERD-LPLPEVADLRNVVEGDPSPDGKGTLVIKRGIEVG------HIFQLGTKYSEAMKLSVLSEQGK-----VNLIMGC-----YGIGVSRVVAAAIEQNHDERGILWPSALAPFQIALVPLKYETESELTAAGFEVLLDDRDK. 513
52 -12.7003hri_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  14  1.......................................................................................................................MAMGTLEAQTQGPGSMQMNMVETEPVQGCRDFPPETMRLRKYLFDVFHSTARKFGFEEYDSPLYIRKAGEEITEQMFNFITKGGHRVALPEMTPSLARQLLAKGRSKWYSIPQCWRYEAITRGRRREHYQWNMDISVSSEVELVCAACTAMQSLGLSSKDVGVKINSRKILQTVVEQAGVSADKFAPVCVIVDKME-------------------------------------------------KLPREEVVAQLAAIGLESNVVDAITSTLSLKTIDEIAQRIGEEHEAVRELRDFITQI-EAYGFGDWVIFDASVVRGLAYYT--------------------------------------------GIVFEGFDRDGNFGGG--------------------------RYDNLLTTYGSPTAPCVGFGFGDCVIVELLNEKKLLPDDLVIPFDETMRPHALSILRRLRDAGRS.............. 384
53 -11.7003net_A mol:protein length:465 Histidyl-tRNA synthetase  ali model follow..  12  1..................................................................................................................................SNAMAKNDKINFSTPSGFPEFLPSEKRLELYLLDTIRRVYESYGFTPIETPALEPILPPNRQAEKDKSGDTGSEARALFDQTVPLAAYIARHLNDARYQMDVVFRGERAKDGRFRQFRQCDIDVSLLYDAQMPAIITEIFEAV--NIGDFVIRINNRKVLTGFFQSLNISETQIKSCISIID---------------------------NLEKIGEAKVKLELEKEGINPEQTQKIIDFVKIDGSVDDVLDKLKH--------------LSQTLPESEQFNLGVSELET-----------------------VITGVRNLGVPDKRFCIDLAIARGLNYYT------------------GTVYETTLIGHEICSGG-------------------------RYEELVGTFIGEKMPGVGISIGLTRLISRLLKAGILNQVVVVNMQDELMPTYLKVSQQLRQAGLN.............. 400
54 -11.6003hrk_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  16  1.......................................................................................................................MAMGTLEAQTQGPGSMQKNMVETEPVQGCRDFPPEAMRCRRHLFDVFHATAKTFGFEEYDAPLYIRKAGEEITEQMFNFITKGGHRVALPEMTPSLARLLLGKGRSKWYSIPQCWRYEAITRGRRREHYQWNMDISVSAEVELVCAACWAMRSL------------------------GLSSKDVGIKV-----------NSRKVLQTVVEQAGVTSDKFAPVCVIVDKMEKIPREEVEAQLA--------------VLGLEPTVVDAITTTLSLKSIDEIAQRVGEEHEAVKELRQFFEQVEAY-----------------------------------------------------GDWVLFDASVVRGLAYEGFDREGKFGGG--------------------------RYDNLLTTYGSPTPPCAGFGFGDCVIVELLQEKRLLPDDVVIPFDESMRPHALAVLRRLRDAGRS.............. 384
55 -11.4001nnx_A mol:protein length:109 Protein ygiW  ali model follow..  17  24..................SVTTVESAKSLRDDTWVTLRGNIVERISDDLYVF---KDASGTINVDIDHKRWNG-----VTVTPKDTVEIQGEV----------DKDWNSVEIDVKQIRKVNP........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 109
56 -11.3004g85_A mol:protein length:517 Histidine-tRNA ligase, cytoplasmic  ali model follow..  11  17.......................................................................................ALEELVKLQGERVRGLKQQKASAELIEEEVAKLLKLKAQLGPDESKQKFVLKTPKGTRDY----SPRQMAVREKVFDVIIRCFKRHGAEVIDTPVTLMGKYGEDSKLIYDLKDQGGELLSLYDLTVPFARYLAMNKLTKRYHIAKVYRRDAMTRGRYREFYQCDFDIPMIPDAECLKIMCEILSSL------------------------QIGDFLVKVN-------------DRRILDGMFAICGVSDSKFRTICSSVDKLDKVSWEEVKNEMVGEKGLAPEVADRIGDYVQQHGGVSLVEQLLQDPKLSQNKQALEGLGDLKLLFEYLTLFGIDDKISFDLSLARGLDYYTGVIYEAVLLQTPAQAGEEPLG-------------------------------------GSVAAGG--------------------------RYDGLVGMFDPKGRPCVGLSIGVERIFSIVEQRTTETQVLVASAQKKLLEERLKLVSELWDAGIK.............. 448
57 -10.5004e51_A mol:protein length:467 Histidine--tRNA ligase  ali model follow..  12  1....................................................................................................................MAMGTLEAQTQGPGSMTEQKRKLEKLTGVKGMNDILPQDAGLWEFFEATVKSLLRAYGYQNIRTPIVEHTP--GEVTDIVEKEMYSGENLTLPENTAAVVRAAIEHNMLRLWYIGPMFRHERPQRGRYRQFHQVGVEAGPDADAEIVMMCQRLWEDLIKLEINSLGLAEERAAHRVELIKYLEQHAD-----------------------------------------------------------------------KLDDDAQRRLYTNPLRVLDTKNPALQEIVRNAPKLIDFLGDVSRAHFEGLQRLLKANNVPF----------------------------------------------TINPRLVRGLDYKLGAQGTVAAGG--------------------------RYDPLIEQLGGKPTAACGWAMGIERILELLKEEHLVPDVYVVHQGDAAREQAFIVAERLRDTGLD.............. 377
58 -10.5004g84_A mol:protein length:464 Histidine--tRNA ligase, cytoplasmic  ali model follow..  11  4...................................................................................................................................SEFELRRQFVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFLMGKYGEDSKLIYDLKDQGGELLSLYDLTVPFARYLAMNKLTKRYHIAKVYRRDAMTRGRYREFYQCDFDIPMIPDAECLKIMCEILSSL------------------------QIGDFLVKVN-------------DRRILDGMFAICGVSDSKFRTICSSVDKLDKVSWEEVKNEMVGEKGLAPEVADRIGDYVQQHGGVSLVEQLLQDPKLSQNKQALEGLGDLKLLFEYLTLFGIDDKISFDLSLARGLDYYTGVIYEAVLLQTPAQAGEEPLG-------------------------------------GSVAAGG--------------------------RYDGLVGMFDPKGRPCVGLSIGVERIFSIVEQRTTETQVLVASAQKKLLEERLKLVSELWDAGIK.............. 395
59 -10.4001wu7_A mol:protein length:434 Histidyl-tRNA synthetase  ali model follow..  11  3..........................................................................................................................................RLQIEKIRGFRDFYPEDMDVEKFIFKTAEEAAEAFGFRRIDFPSLRIKSGEELLQQTYSFVDKGGREVTLPEATPSTVRMVTSRKD-RWYSFPKVWRYEEPQAGRYREHYQFNADISPEADAEVIALASSILDRL--GLQDIYEIRINSRKIMEEIIGGMTSSDPFSVFSIIDRYHKISREEFVDQLRSAGIGEDGV--------SMIADLCSGTRGIDEMARITGKSSEEIARMAAVEDLLASYGVKNVRYDFSIVRG-------------------------------------------------------------------------------------------TGIVFEAYDRSGQFGGG--------------------------RYDNLASLMSGESVPAVGFGMGDAVISLLLKREREKKSVYICRVGKINSSIMNEYSRKLRERGMN.............. 361
60 -10.4003rac_A mol:protein length:373 Histidine-tRNA ligase  ali model follow..  14  1..........................................................................................................................SNAMNGTRSAWGARAWEAVRGFADR-QDGYPDFAKRRRAVETRLLSFVEDAGYEPVTSGTLLRARSPESSRDWIRLFDGGGDAVALR--PEMTPSIARMAAPRRWCYCERVYRRTDDPASLSWESTQVGIERSVDVDMDVLRLLHEASAAA--------------------------GVRHHRIVVSHARLVPRLLDA------------------LGISASLSRAFLACLTSGNYVQFRELWQLHAAKDVDLLANLLTWSPAERDAAKRSREASDRELEALLRDAVDPRAAADVRDAWRYLCRLAE----------------------------------------ALHDSGLASDVVTFDLALHRELDYGLVFEGAPIAQGG-------------------------RYDELLAQFGAGAPA--GFAFEVERVMAVLEAQEEGEG......................................... 371
61 -9.9604rdx_A mol:protein length:423 Histidine--tRNA ligase  ali model follow..  17  2..........................................................................................................................................PMTARAVRGTKDLFGKELRMHQRIVATARKVLEAAGALELVTPIFEETATDIVRKEMFTFQDRGGRSLTLPEGTAAMVRAYLEHGMKRLWMAGPMFRAERPQKGRYRQFHQVNYEA------------------------------------------LGSENPDAEAVVLLYECLKELGLRRLKVKLSSVGDPEDRARYNAYLREVLSPHREALSEDSKERLELNPMRILDSKSERDQALLKELGVRPMLDFLGEE-------ARAHLKEVERHLERLSVPY------------------------------------------------------------ELEPALVRGLDYEIGAQSALGGGG--------------------------RYDGLSELLGGPRVPGVGFAFGVERVALALEAEEKGPDLYLIPLTEEAVAEAFYLAEALRPRLRAEYALAPRKPAKG.. 371
62 -9.9202el9_A mol:protein length:431 Histidyl-tRNA synthetase  ali model follow..  14  4.....................................................................................................................................YQDPMAKNIQAIRGMNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTP--GEVTDVVEKEMYTGDSLTLPEGTAGCVRAGIEHGLLRLWYIGPMFRHERPQKGRYRQFHQLGCEVGPDIDAELIMLTARWWRAL--GISEHVTLELNSIGSLEARANYRDALVAF-----------------------------------------------------------------EQHKEKLDEDCKRRMYTNPLRVLDSKNPEVQALLNDAPALGDYLDEESREHFAGLCKLLESAGIAY----------------------------------------------TVNQRLVRGLDYSLGSQGTVCAGG--------------------------RYDGLVEQLGGRATPAVGFAMGLERLVLLVQAVDPVVDIYLVASGADTQSAAMALAERLRDEL................ 362
63 -9.8802pi2_A mol:protein length:270 Replication protein A 32 kDa subunit  ali model follow..  13  42...RAQHIVPCTISQLLSATLVDEVFRIGNVESQVTIVGIIRHAEKAPTNIVYKIDDMTAAPMDVRQWVDTDDTSSENTVVPPETYVKVAGHLRS-----------QNKKSLVAFKIMPLEDMNEFTTHILEVINAHMVLSKANSQPSAGRAPISNPGMSEAGNFGGNSFMPANGLTVAQNQVLNLIKACPRPEGLNFQDLKNQLKHMSVSSKQAVDFLSNEG--HIYSTV----DDD-------HFKSTDAE..................................................................................................................................................................................................................................................................................................................................................................... 270
64 -9.8103od1_A mol:protein length:400 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  13  17....................................................................................................................................................RDTLPEWYKTKKNICDQMTEEINLWGYDMIETPTLVGVVSAILDQQLFKLLDQQGNTLVLPDMTAPIARLVASSLKDRLAYQSNVYRAQQNEGGKPAEFEQLGVEL------------------------------------------IGDGTADGEVIALMIAALKRAGLSEFKVAIGHVGYVNALLMDVVGNEQRADRLRRFLYEKNYVGY-----------REHVKSLNLSTIDKSRLMNLLSLRGGRAAIEEARGLIQTEKGKTALAEMTKLYEVLESYGASEYVKFDLTLVLHMSYYTGVVFEGYGNR-------------------------------------GVPLCSGG-------------------------RYDELLSKFHRPAQA--GFGVRIDLLVEALNGEIISNGCILFSNERRFEAIEL-------ARKKRANGEAVVLQDLAGV 373
65 -9.6601z7m_A mol:protein length:344 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  13  1.................................................................................................................................MRGSGSIEGRMEKINYLLSAEMTLNQVKSLRQIEGRLRKLFSLKNYQEVMPPSFESNGKTFNQEKMFQFIKHEGQSITLR--YDFTLPLVRLYS--RYSYFGKIFRKEKRHKGRSTENYQIGIELADKSELEILSLALQVIEQL-------------------GLNKTVFEIGSAKFFQRLCQLADGSTELLTELLLKKDLSGLNAFIEKNNFSKELRGL--------------------------LKEIFITNELSRLENLVTNTKDDVLISSFDQLKEFSEKLSMIKPIIIDLGMVPKMDYYT-------------------------------------------------------DLMFKAYSSAANLSGG--------------------------RYDQLLSNFQEEAFA--GFCCHMDTILKALERQELEED......................................... 336
66 -9.6203kf6_A mol:protein length:159 Protein stn1  ali model follow..  20  48................................RWIQIVGYIAAIDIYEGKHVLTVDDCSGMVLVVFIIQDDFSMSKRAISMSPGNVVCVFGKINS-----------RSEVELIAQSFEELRDPNDEWKAWQ----KRMRYKKNLTKISKN............................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 152
67 -9.5104gnx_B mol:protein length:136 Putative uncharacterized protein  ali model follow..  14  37................................GQLTFVAVVRNISRNATNVAYSVEDGTGQIEVRQWLDSSSDDSSKASEIRNNVYVRVLGTL----------KSFQNRRSISSGHMRPVIDYNEVMFHRLEAVHAHLQVTR.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 136
68 -9.2901qe0_A mol:protein length:420 Histidine--tRNA ligase  ali model follow..  10  9....................................................................................................................................................QDILPEDSKKWRYIENQLDELMTFYNYKEIRTPIFESTSTDVVQKEMYTFKDKGDRSITLPEGTAAVVRSYIEHKMQKLYYNGPMFRYERKQKGRYRQFNQFGVEA------------------------------------------IGAENPSVDAEV-LAMVMHIYQSFGLKHLKLVINSVGDMASRKEYNEALVKHFEPVIHE--------------------FCSDCQSRLHTDPMRILDCKVDRDKEAIKTAPRITDFLNEESKAYYEQVKAYLDD---------------------------------LGIPYTEDPNLVRGLDYYTHTAFELMMDNPNYDGAITTLCGGG-------------------------RYNGLLELLDGPSETGIGFALSIERLLLALEEEEENLDLFIVTMGDQADRYAVKLLNHLRHNGIK.............. 358

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 4 6 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Sasin JM, Godzik A, Bujnicki JM. SURF'S UP! - protein classification by surface comparisons. J Biosci. 2007 Jan;32(1):97-100.