current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 5x5t_A mol:protein length:505 Alpha-ketoglutaric semialdehyde dehydrogenase, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .
# Score Template Links and tools%idFirst MSYYDYDIPTTENIYFQGAANVTYTDTQLLIDGEWVDAASGKTIDVVNPATGKPIGRVAHAGIADLDRALAAAQSGFEAWRKVPAHERAATMRKAAALVRERADAIAQLMTQEQGKPLTEARVEVLSAADIIEWFADEGRRVYGRIVPPRNLGAQQTVVKEPVGPVAAFTPWNFPVNQVVRKLSAALATGCSFLVKAPEETPASPAALLRAFVDAGVPAGVIGLVYGDPAEISSYLIPHPVIRKVTFTGSTPVGKQLASLAGLHMKRATMELGGHAPVIVAEDADVALAVKAAGGAKFRNAGQVCISPTRFLVHNSIRDEFTRALVKHAEGLKVGNGLEEGTTLGALANPRRLTAMASVIDNARKVGASIETGGERIGSEGNFFAPTVIANVPLDADVFNNEPFGPVAAIRGFDKLEEAIAEANRLPFGLAGYAFTRSFANVHLLTQRLEVGMLWINQPATPWPEMPFGGVKDSGYGSEGGPEALEPYLVTKSVTVMAVLast
1 -141.0005x5t_A mol:protein length:505 Alpha-ketoglutaric semialdehyde dehydrogenase  ali model  100  1MSYYDYDIPTTENIYFQGAANVTYTDTQLLIDGEWVDAASGKTIDVVNPATGKPIGRVAHAGIADLDRALAAAQSGFEAWRKVPAHERAATMRKAAALVRERADAIAQLMTQEQGKPLTEARVEVLSAADIIEWFADEGRRVYGRIVPPRNLGAQQTVVKEPVGPVAAFTPWNFPVNQVVRKLSAALATGCSFLVKAPEETPASPAALLRAFVDAGVPAGVIGLVYGDPAEISSYLIPHPVIRKVTFTGSTPVGKQLASLAGLHMKRATMELGGHAPVIVAEDADVALAVKAAGGAKFRNAGQVCISPTRFLVHNSIRDEFTRALVKHAEGLKVGNGLEEGTTLGALANPRRLTAMASVIDNARKVGASIETGGERIGSEGNFFAPTVIANVPLDADVFNNEPFGPVAAIRGFDKLEEAIAEANRLPFGLAGYAFTRSFANVHLLTQRLEVGMLWINQPATPWPEMPFGGVKDSGYGSEGGPEALEPYLVTKSVTVMAV 499
2 -137.0003ek1_A mol:protein length:504 Aldehyde dehydrogenase  ali model follow..  41  1MAMGTLEAQTQGPGSMLALKDPSLLKSQCLVNGRWIDAADGTTIKVTNPADGSVIGTVPSLSVATIKEAIDASAKALSGWAAKTAKERAGILRKWFDLIIANADDIALIMTSEQGKPLAEARGEVLYAASFIEWFAEEAKRVYGDTIPAPQNGQRLTVIRQPVGVTAAITPWNFPAAMITRKAAPALAAGCTMIVRPADLTPLTALALGVLAEKAGIPAGVLQIVTGKAREIGAELTSNDTVRKLSFTGSTEVGRLLMAQCAPTIKRISLELGGNAPFIVFDDADLDAAVDGAMVSKYRNAGQTCVCANRIYVQRGVYDKFAEKLAAKVKELKVGNGTEPGVVIGPMIEEKAITKVKAHIEDAVSKGAKLITGGKELG--GLFFEPGILTGVTSDMLVAKEETFGPLAPLFAFDTEEEVIAQANDTIFGLAAYFYTENFSRAIRVSEALEYGMVGHNTGLISNEVAPFGGVKQSGLGREGSKYGIEEYLETKYICSA.. 495
3 -137.0003rh9_A mol:protein length:506 Succinate-semialdehyde dehydrogenase (NAD(P)(+))  ali model follow..  32  1...............MVMIESPLLENLTGYIGGRWKDSAGGATFDVYNPATGSVIAKVPSMPEEDVVAAVEAGQSALRLTNPWPIETRRKWLEDIRDGLKENREEIGRILCMEHGKPWKEAQGEVDYAAGFFDYCAKHISALDSHTIPEKPKDCTWTVHYRPVGVTGLIVPWNFPIGMIAKKLSAALAAGCPSVIKPASETPLTMIAFFSVMDKLDLPDGMVNLVMGKASVIGKVLCEHKDVPMLSFTGSTEVGRKLIVDTAEQVKKLALELGGNAPFIVFDDADLEAAADNLIANKFRGGGQTCVCANRIFVHEKVADAFGQKLAERVNKMTVGDGMNDGIDIGPLINKQGFDKVKRHLQDALDKGASLVAGKQPAEGDGLFFPPTVVQGVDREMCCYQEETFGPLVPMALFRTEEEVIDAGNDTEFGLASYVFTADAERAQRVAAGLRFGHVGWNTGTGPTPEAPFGGMKASGIGREGGLEGLFEFVEAQTVPRG.. 483
4 -136.0004v6h_A mol:protein length:484 Succinate-semialdehyde dehydrogenase (NADP+)  ali model follow..  42  4.................SMKDPSLLRHQAYIGGEWQAADSDATFEVFDPATGESLGTVPKMGAAETARAIEAAQAAWAGWRMKTAKERAAILRRWFDLVIANSDDLALILTTEQGKPLAEAKGEIAYAASFIEWFAEEGKRVAGDTLPTPDANKRIVVVKEPIGVCAAITPWNFPAAMIARKVGPALAAGCPIVVKPAESTPFSALAMAFLAERAGVPKGVLSVVIGDPKAIGTEITSNPIVRKLSFTGSTAVGRLLMAQSAPTVKKLTLELGGNAPFIVFDDADLDAAVEGAIASKYRNNGQTCVCTNRFFVHERVYDAFADKLAAAVSKLKVGRGTESGATLGPLINEAAVKKVESHIADALAKGASLMTGGKRHALGHGFFEPTVLTGVKPDMDVAKEETFGPLAPLFRFASEEELVRLANDTEFGLAAYLYSRDIGRVWRVAEALEYGMVGINTGLISNEVAPFGGVKQSGLGREGSHYGIDDYVVIKYLCVA.. 483
5 -136.0005vbf_A mol:protein length:478 NAD-dependent succinate-semialdehyde dehydrogenase  ali model follow..  50  3......................DYAPLRLYIDGRFHDADGRRTQPVVDPGTTRVLGELPHATAHDIDAAVQAAHRAFVTWRHESPLVRSDLLRRAAALARERAETIGRHITMDQGKPLREAIAEVVSAAEQLEWHAEEGRRTYGRVVPARSPDVMQTVLREPIGVCAAFSPWNFPFSQAMHKIAAALASGCTLVLKGPEESPSAIVALAQLFHDAGLPPGCLNIVWGVPGDVSKQLIEAPQVRKISFTGSVPVGKQLAALAASLMKRMTMELGGHAPVLVCADADVERAAAMLAAYKFRNAGQVCVSPTRFFVQRAAFDRFVCAYLDAVGTIRVGYGLDAGVTMGPLAHARRVDEIDAFVADATAKGAQIATGGMRLPGPGHYFAPTVVLGPTRDTRLMNDEPFGPIVGIVPFDDLDDALAEANRLPFGLASYAFTTSARNAHRISRALEAGMVNINHFGMGPAEIPFGGVKDSGFGSEGGMEAFDGYLVTKFVTQMN. 478
6 -136.0003jz4_A mol:protein length:481 Succinate-semialdehyde dehydrogenase [NADP+]  ali model follow..  40  1.................KLNDSNLFRQQALINGEWLDANNGEAIDVTNPANGDKLGSVPKMGADETRAAIDAANRALPAWRALTAKERATILRNWFNLMMEHQDDLARLMTLEQGKPLAEAKGEISYAASFIEWFAEEGKRIYGDTIPGHQADKRLIVIKQPIGVTAAITPWNFPAAMITRKAGPALAAGCTMVLKPASQTPFSALALAELAIRAGVPAGVFNVVTGSAGAVGNELTSNPLVRKLSFTGSTEIGRQLMEQCAKDIKKVSLELGGNAPFIVFDDADLDKAVEGALASKFRNAGQTCVCANRLYVQDGVYDRFAEKLQQAMSKLHIGDGLDNGVTIGPLIDEKAVAKVEEHIADALEKGARVVCGGKAHERGGNFFQPTILVDVPANAKVSKEETFGPLAPLFRFKDEADVIAQANDTEFGLAAYFYARDLSRVFRVGEALEYGIVGINTGIISNEVAPFGGIKASGLGREGSKYGIEDYLEIKYMCIG.. 480
7 -135.0003k2w_A mol:protein length:497 Betaine-aldehyde dehydrogenase  ali model follow..  33  1..............MSLTVQDLHFKNKVNFIGGQYVPSNESDTIDILSPSTGKVIGEIPAGCKADAENALEVAQAAQKAWAKLTARTRQNMLRTFANKIRENKHILAPMLVAEQGKLLSVAEMEVDVTATFIDYGCDNALTIEGDILPSDNQDEKIYIHKVPRGVVVGITAWNFPLALAGRKIGPALITGNTMVLKPTQETPLATTELGRIAKEAGLPDGVLNVINGTGSVVGQTLCESPITKMITMTGSTVAGKQIYKTSAEYMTPVMLELGGKAPMVVMDDADLDKAAEDALWGRFANCGQVCTCVERLYVHASVYDEFMAKFLPLVKGLKVGDPMDADSQMGPKCNQREIDNIDHIVHEAIKQGATVATGGKTATEGGCWYEPTVLVDVKQDNIVVHEETFGPILPIVKVSSMEQAIEFCNDSIYGLSAYVHTQSFANINQAISDLEVGEVYINRGMGEQHQGFHNGWKQSGFGGEDGKFGLEQYLEKKTVYIN.. 487
8 -134.0002hg2_A mol:protein length:479 Aldehyde dehydrogenase A  ali model follow..  32  6.........................QHPMYIDGQFVTWRGDAWIDVVNPATEAVISRIPDGQAEDARKAIDAAERAQPEWEALPAIERASWLRKISAGIRERASEISALIVEEGGKIQQLAEVEVAFTADYIDYMAEWARRYEGEIIQSDRPGENILLFKRALGVTTGILPWNFPFFLIARKMAPALLTGNTIVIKPSEFTPNNAIAFAKIVDEIGLPRGVFNLVLGRGETVGQELAGNPKVAMVSMTGSVSAGEKIMATAAKNITKVCLELGGKAPAIVMDDADLELAVKAIVDSRVINSGQVCNCAERVYVQKGIYDQFVNRLGEAMQAVQFGNPAERDIAMGPLINAAALERVEQKVARAVEEGARVAFGGKAVEGKGYYYPPTLLLDVRQEMSIMHEETFGPVLPVVAFDTLEDAISMANDSDYGLTSSIYTQNLNVAMKAIKGLKFGETYINRENFEAMQGFHAGWRKSGIGGADGKHGLHEYLQTQVVYLQS. 479
9 -133.0003iwj_A mol:protein length:503 Putative aminoaldehyde dehydrogenase  ali model follow..  33  2....................DIPIPTRQLFINGDWKAPVLNKRIPVINPATQNIIGDIPAATKEDVDVAVAAAKTALTRWATASGAVRARYLRAIAAKVTEKKPELAKLESIDCGKPLDEAAWDIDDVAGCFEYYADLAEKLDARQKAPVSDTFKSHVLREPIGVVGLITPWNYPMLMATWKVAPALAAGCAAILKPSELASLTCLELGEICKEVGLPPGVLNILTGLGPEAGAPLATHPDVDKVAFTGSSATGSKIMTAAAQLVKPVSLELGGKSPLVVFEDVDLDKAAEWAIFGCFWTNGQICSATSRLILHESIATEFLNRIVKWIKNIKISDPLEEGCRLGPVVSEGQYEKILKFVSNAKSEGATILTGGSRPEKKGFFIEPTIITDVTTNMQIWREEVFGPVLCVKTFSTEEEAIDLANDTVYGLGAAVISNDLERCERVTKAFKAGIVWVNCSQPCFTQAPWGGVKRSGFGRELGEWGLDNYLSVKQVTQY.. 488
10 -133.0005izd_A mol:protein length:508 D-glyceraldehyde dehydrogenase (NADP(+))  ali model follow..  35  2.........................DTKLYIDGQWVNSSSGKTVDKYSPVTGQVIGRFEAATRDDVDRAIDAAEDAFWAWNDLGSVERSKIIYRAKELIEKNRAELENIIMEENGKPVKEAKEEVDGVIDQIQYYAEWARKLNGEVVEGTSSHRKIFQYKVPYGIVVALTPWNFPAGMVARKLAPALLTGNTVVLKPSSDTPGSAEWIVRKFVEAGVPKGVLNFITGRGSEIGDYIVEHKKVNLITMTGSTATGQRIMQKASANMAKLILELGGKAPFMVWKDADMDNALKTLLWAKYWNAGQSCIAAERLYVHEDIYDTFMSRFVELSRKLALGDPKN--ADMGPLINKGALQATSEIVEEAKESGAKILFGGSQPSRNGYFFLPTIIGNADQKSKIFQEEIFAPVIGARKISSVEEMYDLANDSKYGLASYLFTKDPNIIFEASERIRFGELYVNMPGPEASQGYHTGFRMTGQAGEGSKYGISEYLKLKNIYVD.. 476
11 -132.0002w8n_A mol:protein length:487 SUCCINATE-SEMIALDEHYDE DEHYDROGENASE, MITOCHONDRIAL  ali model follow..  40  4.................AGLSAALLRTDSFVGGRWLPA--AATFPVQDPASGAALGMVADCGVREARAAVRAAYEAFCRWREVSAKERSSLLRKWYNLMIQNKDDLARIITAESGKPLKEAHGEILYSAFFLEWFSEEARRVYGDIIHTPAKDRRALVLKQPIGVAAVITPWNFPSAMITRKVGAALAAGCTVVVKPAEDTPFSALALAELASQAGIPSGVYNVIPCNAKEVGEAICTDPLVSKISFTGSTTTGKILLHHAANSVKRVSMELGGLAPFIVFDSANVDQAVAGAMASKFRNTGQTCVCSNQFLVQRGIHDAFVKAFAEAMKNLRVGNGFEEGTTQGPLINEKAVEKVEKQVNDAVSKGATVVTGGKRHQLGKNFFEPTLLCNVTQDMLCTHEETFGPLAPVIKFDTEEEAIAIANAADVGLAGYFYSQDPAQIWRVAEQLEVGMVGVNEGLISSVECPFGGVKQSGLGREGSKYGIDEYLELKYVCYGGL 487
12 -132.0004v37_A mol:protein length:497 BETAINE ALDEHYDE DEHYDROGENASE, CHLOROPLASTIC  ali model follow..  31  2....................AFPIPARQLFIDGEWREPIKKNRIPVINPSTEEIIGDIPAATAEDVEVAVVAARRAFRRWSATSGAHRATYLRAIAAKITEKKDHFVKLETIDSGKPFDEAVLDIDDVASCFEYFAGQAEALDGKQKAPPMERFKSHVLRQPLGVVGLISPWNYPLLMATWKIAPALAAGCTAVLKPSELASVTCLEFGEVCNEVGLPPGVLNILTGLGPDAGAPLVSHPDVDKIAFTGSSATGSKVMASAAQLVKPVTLELGGKSPIVVFEDVDIDKVVEWTIFGCFWTNGQIASATSRLLVHESIAAEFVDKLVKWTKNIKISDPFEEGCRLGPVISKGQYDKIMKFISTAKSEGATILYGGSRPEKKGYYIEPTIVTDISTSMQIWKEEVFGPVLCVKTFSSEDEAIALANDTEYGLAAAVFSNDLERCERITKALEVGAVWVNCSQPCFVQAPWGGIKRSGFGRELGEWGIQNYLNIKQVTQD.. 485
13 -132.0002d4e_A mol:protein length:515 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase  ali model follow..  31  1MRYADRVAGISWETIEEVRRRLKERPALHFIAGEFVPSESGETFPSLDPATNEVLGVAARGGEREVDRAAKAAHEAFQRWSRTKAKERKRYLLRIAELIEKHADELAVMECLDAGQVLRIVRAQVARAAENFAFYAEYAEHAMEDRTFPVDRDWLYYTVRVPAGPVGIITPWNAPLMLSTWRIAPALAFGNTVVLKPAEWSPFTATKLAEILKEADLPPGVFNLVQGFGEEAGAALVAHPLVPLLTLTGETETGKIVMRNAADHLKRLSPELGGKSPALVFADADLERALDAVVFQIFSFNGERCTASSRLLVEEKIFEDFVGKVVERARAIRVGHPLDPETEVGPLIHPEHLQRVLGYVEAGKREGARLLVGGERAKSRGNYLLPTVFVGEN-HMKIAQEEIFGPVLVAIPFKDEEEALRKANDTKYGLAAYVFTRDLERAHRLALELEAGMVYLNSHNVRHLPTPFGGVKGSGDRREGGTYALDFYTDLKTIALP.. 504
14 -131.0003iwk_A mol:protein length:503 Aminoaldehyde dehydrogenase  ali model follow..  33  2....................AITVSSRQLFIDGEWRVPILNKRIPNINPSTENIIGDIPAATKEDVDLAVDAAKRAISRWSAASGSLRARYLRAIAAKIKEKKDELGKLESIDCGKPLEEALADLDDVVACFEYYAGLAEELDSKQKAPPMDTFKSYILKEPIGVVALITPWNYPFLMATWKIAPALAAGCAAILKPSELASVTCLELGEICKEVGLPRGVLNIVTGLGHEAGASLASHPDVDKISFTGSSATGSKIMTTAAQLVKPVSLELGGKSPIVVFEDVDLDKVAEWTVFGCFFTNGQICSATSRLIVHESIAVEFVDKLVKWAENIKISDPLEEGCRLGPIVSEAQYKKVLNCISSAKSEGATILTGGRRPEKKGYFVEPTIITDVTTSMQIWREEVFGPVLAVKTFSTEEEAINLANDTHYGLGSAVMSNDLERCERLSKALQAGIVWINCAQPSFIQAPWGGIKRSGFGRELGEWGLENYLSVKQVTRY.. 488
15 -131.0004i8p_A mol:protein length:520 Aminoaldehyde dehydrogenase 1  ali model follow..  32  2.........GSSSQDPNSASPAMVPLRQLFVDGEWRPPAQGRRLPVVNPTTEAHIGEIPAGTAEDVDAAVAAARAALKRWARAPGAVRAKYLRAIAAKVIERKPELAKLEALDCGKPYDEAAWDMDDVAGCFEYFADQAEALDKRQNSLPMETFKCHLRREPIGVVGLITPWNYPLLMATWKIAPALAAGCTAVLKPSELASVTCLELADICKEVGLPSGVLNIVTGLGPDAGAPLSAHPDVDKVAFTGSFETGKKIMASAAPMVKPVTLELGGKSPIVVFDDVDIDKAVEWTLFGCFWTNGQICSATSRLLIHTKIAKKFNERMVAWAKNIKVSDPLEEGCRLGPVVSEGQYEKIKKFISNAKSQGATILTGGVRPAEKGFFIEPTIITDITTSMEIWREEVFGPVLCVKEFSTEDEAIELANDTQYGLAGAVISGDRERCQRLSEEIDAGCIWVNCSQPCFCQAPWGGNKRSGFGRELGEGGIDNYLSVKQVTEY.. 499
16 -131.0001wnb_A mol:protein length:495 Putative betaine aldehyde dehydrogenase  ali model follow..  31  1.........SYYLESTSLYKKAGLMQHKLLINGELVSG-EGEKQPVYNPATGDVLLEIAEASAEQVDAAVRAADAAFAEWGQTTPKVRAECLLKLADVIEENGQVFAELESRNCGKPLHSAFNEIPAIVDVFRFFAGAARCLNGLAAGEYLEGHTSMIRRDPLGVVASIAPWNYPLMMAAWKLAPALAAGNCVVLKPSEITPLTALKLAELAKDI-FPAGVVNILFGRGKTVGDPLTGHPKVRMVSLTGSIATGEHIISHTASSIKRTHMELGGKAPVIVFDDADIEAVVEGVRTFGYYNAGQDCTAACRIYAQKGIYDTLVEKLGAAVATLKSGAPDDESTELGPLSSLAHLERVGKAVEEAKATGHIKVIGGEKRKGNGYYYAPTLLAGALQDDAIVQKEVFGPVVSVTPFDNEEQVVNWANDSQYGLASSVWTKDVGRAHRVSARLQYGCTWVNTHFMLVSEMPHGGQKLSGYGKDMSLYGLEDYTVVRHVMVK.. 488
17 -130.0003r64_A mol:protein length:508 NAD dependent benzaldehyde dehydrogenase  ali model follow..  32  1..............MVVTATFAGIDATKHLIGGQWVEGNSDRISTNINPYDDSVIAESKQASIADVDAAYEAAKKAQAEWAATPAAERSAIIYRAAELLEEHREEIVEWLIKESGSTRSKANLEITLAGNITKESASFPGRVHGRISPSNTPGKENRVYRVAKGVVGVISPWNFPLNLSIRSVAPALAVGNAVVIKPASDTPVTGGVIARIFEEAGVPAGVISTVAGAGSEIGDHFVTHAVPKLISFTGSTPVGRRVGELAINPMKTVALELGGNAPFVVLADADIDAAAQAAAVGAFLHQGQICMSINRVIVDAAVHDEFLEKFVEAVKNIPTGDPSAEGTLVGPVINDSQLSGLKEKIELAKKEGATVQVEGPI---EGRLVHPHVFSDVTSDMEIAREEIFGPLISVLKADDEAHAAELANASDFGLSAAVWSKDIDRAAQFALQIDSGMVHINDLTVNDPHVMFGGSKNSGLGRFNGDWAIEEFTTDRWIGIK.. 484
18 -130.0005kj5_A mol:protein length:520 2-aminomuconate 6-semialdehyde dehydrogenase  ali model follow..  29  8LVPRGSHMNTLPSQVWRTNIGSAPSQLLNYIDGNFVTS--ASSFANINPVNGKLISDVFEADAKQVNEAVVAAQNALKGWGKLSVQDRAALIHKIADGIQARFEEFVAAEVADTGRPVHQARTDIPRAIANFRTFADLAKTSHTDLFEMSTSGALNYTVRKPLGVIGVISPWDLPLLLFTWKVAPALACGNTVVAKPSEESPSSATLLAEVMHDAGVPPGVFNLIHGFGKDAGEFLTQHPGISALTFTGESKTGSTIMKAVADGVKEVSFELGGKNAAVVFADADLDAAIEGVLRSSFTNSGQVCLCSERVYVHRSIFDEFVSGLKVEAERLVVGYPDQDGVNMGPLISHGHRDKVLSYYRLAVDEGATVVTGGGVPKDQGAYVQPTIWTGLSDKARCVTEEIFGPVCHISPFDDEDEVINRVNDSNYGLACAIWTTNLSRAHRVSRQIHVGLVWVNTWYLRDLRTPFGGVKLSGLGREGGRFSMDFYSDIANICIK.. 513
19 -129.0004i9b_A mol:protein length:517 Putative betaine aldehyde dehyrogenase  ali model follow..  31  2..........GSSSQDPANRNVPIPRRQLYIGGEWREPVKKNRIPIINPATEEIIGDIPAATAEDVDIAVEAARKAIARWGSTTGAQRAKYLRAIAAKVLEKKSVLATLESLDSGKTLYESAADMDDVAGCFEYYAGLAEALDSRRMTPVNDSYKSYVLREPLGVVGLITPWNYPLLMAIWKVAPALAAGCAAILKPSELASITCLELGEICREIGLPSGALNILTGLGPEAGGPLASHPHVDKISFTGSGPTGSKIMTAAAQLVKPVSLELGGKSPIVVFDDIDLDIAAEWTLFGIFANTGQVCSATSRLIVQENIASAFMDRLLKWTKNIKISDPLEEDCKLGPVVSAGQYEKVLKFISNAKSEGATILCGGERPQKKGYYVQPTIITDVNTSMEIWKEEVFGPVLCVKTFKTEEQAIELANDTKYGLGAAVMSKDVKRCERFTKAFQTGIIWINCSQPTFNELPWGGKKRSGFGRDLGKWGLENFLNIKQVTEY.. 496
20 -129.0004dal_A mol:protein length:498 Putative aldehyde dehydrogenase  ali model follow..  29  1.......MSSGVDLGTENLYFQSMMDTQLLIGSRFEAG-TEAEEHILNPRTGAGIIDLAEASHAQIDAAVDAAERAFVGWSQTTPAERSNALLKIADAIEKEADEFAALEALNCGKPINAVKNELPAIIDCWRFFAGAVRNLHAPAAGEYLPGHTSMIRRDPIGIVGSIAPWNYPLMMMAWKLAPAIGGGNTVVFKPSEQTPLTALKLARLIADI-LPEGVVNVITGRGETVGNALINHPKVGMVSITGDIATGKKVLAAAAKTVKRTHLELGGKAPVIVYGDADLEAVVNGIRTFGYYNAGQDCTAACRIYAEAGIYEKLVADLTSAVSTIRYNLDDDTENEIGPLISRRQRDRVASFVERAADQKHIEITTGGRTSDEGFFFQPTVVAGATQEDEIVRREVFGPVVSVTRFTGKDDAVAWANDSDYGLASSVWTKDISKAMRAASRLQYGCTWINTHFMLTNEMPHGGIKQSGYGKDMSVYALEDYTAVRHIMIN.. 490
21 -129.0004dng_A mol:protein length:485 Uncharacterized aldehyde dehydrogenase AldY  ali model follow..  30  6.........................LNKSFINGKWTGGESGRTEDILNPYDQSVITTASLATGKQLEDAFDIAQKAQKEWAKSTTEDRKAVLQKARGYLHENRDDIIMMIARETGGTIIKSTIELEQTIAILDEAMTYTGELGGKEVPSDIEGKTNKIYRLPLGVISSISPFNFPMNLSMRSIAPAIALGNSVVHKPDIQTAISGTIIAKAFEHAGLPAGVLNVMLTDVKEIGDGMLTNPIPRLISFTGSTAVGRHIGEIAGRAFKRMALELGGNNPFAVLSDADVDRAVDAAIFGKFIHQGQICMIINRIIVHQDVYDEFVEKFTARVKQLPYGDQTDPKTVVGPLINERQIEKALEIIEQAKTDGIELAVEGKR---VGNVLTPYVFVGADNNSKIAQTELFAPIATIIKAGSDQEAIDMANDTEYGLSSAVFTSDLEKGEKFALQIDSGMTHVNDQSVNDPNIAFGGNKASGVGRFGNPWVVEEFTVTKWISIQ.. 477
22 -128.0004mpb_A mol:protein length:520 Betaine aldehyde dehydrogenase  ali model follow..  33  1MSSGVDLGTENLYFQSNAMELLKHLSQRQYIDGEWVESANKNTRDIINPYNQEVIFTVSEGTKEDAERAILAARRAFESWSQETAETRGKKVRAIADKIKEHREALARLETLDTGKTLEESYADMDDIHNVFMYFAGLADKDGGEMIDSPIPDTESKIVKEPVGVVTQITPWNYPLLQASWKIAPALATGCSLVMKPSEITPLTTIRVFELMEEVGFPKGTINLILGAGSEVGDVMSGHKEVDLVSFTGGIETGKHIMKNAANNVTNIALELGGKNPNIIFDDADFELAVDQALNGGYFHAGQVCSAGSRILVQNSIKDKFEQALIDRVKKIKLGNGFDADTEMGPVISTEHRNKIESYMDVAKAEGATIAVGGKRPDKDGLFFEPTVITNCDTSMRIVQEEVFGPVVTVEGFETEQEAIQLANDSIYGLAGAVFSKDIGKAQRVANKLKLGTVWINDFHPYFAQAPWGGYKQSGIGRELGKEGLEEYLVSKHILTN.. 503
23 -128.0004q92_A mol:protein length:517 Betaine aldehyde dehydrogenase  ali model follow..  35  2....GSSSSGRENLYFQGMELLKHLSQRQYIDGEWVESANKNTRDIINPYNQEVIFTVSEGTKEDAERAILAARRAFESWSQETAETRGKKVRAIADKIKEHREALARLETLDTGKTLEESYADMDDIHNVFMYFAGLADKDGGEMIDSPIPDTESKIVKEPVGVVTQITPWNYPLLQASWKIAPALATGCSLVMKPSEITPLTTIRVFELMEEVGFPKGTINLILGAGSEVGDVMSGHKEVDLVSFTGSIETGKHIMKNAANNVTNIALELGGKNPNIIFDDADFELAVDQALNGGYFHAGQVCSAGSRILVQNSIKDKFEQALIDRVKKIKLGNGFDADTEMGPVISTEHRNKIESYMDVAKAEGATIAVGGKRPDKDGLFFEPTVITNCDTSMRIVQEEVFGPVVTVEGFETEQEAIQLANDSIYGLAGAVFSKDIGKAQRVANKLKLGTVWINDFHPYFAQAPWGGYKQSGIGRELGKEGLEEYLVSKHILTN.. 500
24 -128.0006c43_A mol:protein length:477 Gamma-aminobutyraldehyde dehydrogenase  ali model follow..  32  1.....................SNAMQYQLLINGVLVDG-EGERQSVYNPATGEVILEIAEASPAQVDAAVQAADNAFAEWGQTTPKARAECLLKLADSIEQNALEFARLESQNCGKPLHCVIDEIPAIVDVFRFFAGAARCLSGLAAGEYLEGHTSMIRRDPIGVVASIAPWNYPLMMAAWKLAPALAAGNCVVIKPSEITPLTALKLAVLA-KDIFPPGVLNVLFGRGQTVGDVLTGHEKVRMVSLTGSIATGEHILRHTAPAIKRTHMELGGKAPVIVFDDADLDAVAQGVRTFGFYNAGQDCTAACRIYAQRGIYDALVEKLGNAVSSLKMGAPEDESTELGPLSSLAHLKRVTAAVEEAKALHIRVITGGSQTEGKGYYFAPTLLADAKQEDAIVQREVFGPVVSITVFDDEDQVLRWANDSRYGLASSVWTQDVGRAHRLSARLQYGCTWINTHFMLVSEMPHGGQKQSGYGKDMSLYGLEDYTLVRHIMVK.. 476
25 -128.0004go3_A mol:protein length:495 Putative gamma-hydroxymuconic semialdehyde dehydrogenase  ali model follow..  35  2.........................QNQLYIDGRFVDAVAGGTIDVVSPHDGSLITRIAAAEAADVDLAVAAAKRAFPAWSALGAAERGRLLLKLADRIEECSEELAQLESLNTGHPIRDSRGDVPRTAACFRYFGGMADKIEGSVIPVD-AGFLNYVQRKPIGVVAQIVPWNFPLMFTSWKMGPALAAGNTIVIKPSEITPLSTLRIVELMTEVGFPKGVVNVVPGYGHTAGQALAEHLDVGKIAFTGSTATGRRIVEASKSNLKRIQLELGGKGANIVFEDANIEAAVNGAAWAIFHNQGQACIAGSRLILHKDIADQFLERFIALAKSIRLGDPMDPETEMGPLTSALRRDRVLSYIDIAIEQGGKVLAGGKAPDANGFYVEPTVV-EAKPQDRVCQEEVFGPFVTVVRFSSDEEALAIANNTEYGLGSGLWTQNLARAHKMANAIHAGMCWINCYKRVSPGSPFGGVGQSGYGREMGFEAIHDYTEARSVWVN.. 476
26 -127.0001bi9_A mol:protein length:499 RETINAL DEHYDROGENASE TYPE II  ali model follow..  32  2.........ASLQLLPSPTPNLEIKYTKIFINNEWQNSESGRVFPVCNPATGEQVCEVQEADKVDIDKAVQAARLAFSLWRRMDASERGRLLDKLADLVERDRATLATMESLNGGKPFLQAFYDLQGVIKTLRYYAGWADKIHGMTIPVD-GDYFTFTRHEPIGVCGQIIPWNFPLLMFTWKIAPALCCGNTVVIKPAEQTPLSALYMGALIKEAGFPPGVVNILPGYGPTAGAAIASHIGIDKIAFTGSTEVGKLIQEAAGSNLKRVTLELGGKSPNIIFADADLDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVKRSVERAKRRIVGSPFDPTTEQGPQIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALMVSSAMQAGTVWINCYNALNAQSPFGGFKMSGNGREMGEFGLREYSEVKTVTVK.. 493
27 -127.0003u4j_A mol:protein length:528 NAD-dependent aldehyde dehydrogenase  ali model follow..  34  4.......LSNFIAPDSNDPRLRIKSRYQMLVDGKSVDAASGSTIDRVSPGAGEVVGTWPEASADDVRKAVAAARKAFDAWPRMSGAERSRLMFKVADLILARQEELALIESLEVGKPIAQARGEIGFCADLWSYAAGQARALEGQTHNNIGDDRLGLVLREPVGVVGIITPWNFPFIIASERVPWAIGSGCTVVLKPSEFTSGTSIRLAELAREAGIPDGVFNVVTGYGDPAGQVLAEDPNVDMVAFTGSVRVGTKLGEIAARTVKRVGLELGGKGPQIVFADADLDAAADGIAYGVYHNAGQCCISGSRLLVQEGIRDALMERLLDISRKVAFGDPLNERTKIGAMISEAHAEKVHSYVTAGITSGAELLLGGERIGEAGLYYAPTVFAGVTPDMSIAREEIFGPVLSTLTFKTADEAVALANATEFGLSASVWSTNLETALQTIRRIRAGRCWINSVIDGTPELPIGGYKKSGLGRELGRYGFDEYSQFKGVHVT.. 497
28 -127.0006fk3_A mol:protein length:536 Aldehyde dehydrogenase  ali model follow..  31  1.............MRKAAGKYGNTLEFGHLVGGEEVL--EGPLLERRNPSDREVVARFPEADKDLVRKAALKAREAFAEWSRTPAPIRGQVLFNLVKILEREKPTLTRLMVREVGKTPKEAAGDVQEAIDTALFFASEGRRLYGQTVPSEMRDKELFTFRRPLGVVGIITAGNFPIAVPSWKLIPAVLTGNTVVWKPSEDAPTLSFVFAKLFEEAGLPPGVLNVVFGGGKQWMVELMDEGLFQKFAFTGSTQVGRWIGEVAGRNLIRPTLELGGKNPLVVMRDADLDLAVEGAWWSAFATGGQRCTSAGNILVDAPIYEEFKRRFLERVEATLVGNPLHPEVTYGPFINERFFARWQEHYRVGEAEGARLLFGRGRITEAGLYGWPTVW-EVRPGTRLFTEEVFGPTINLVKVDGIEEAIAVANSTPYGLSSAIYTNHRHWAYLFKVGIRAGMTSINNATVAEAHLPFGGVKASGNGRESGIWVLEEYTYWHAVNEE.. 501
29 -127.0004u3w_A mol:protein length:505 2-aminomuconate 6-semialdehyde dehydrogenase  ali model follow..  30  2..........AMVTTQLNSTSRDRQLLRHYINGEFVAS--GTTFPNLSPVDGRKLADVCEADAALVDSAVQAAHAAQKAWRDTTPAQRAAWLHKIADGIEARFDEFVAAEVADTGRPVAQARTDIARGIANFRTFADLVRTASGEYFETHASELINYVTRKPLGVIGIISPWNLPLLLFTWKVAPALAMGNCVVAKPSEETPSSATLLAEVMHDVGLPPGVFNLIHGHGQNAGEFLTRHPDISAITFTGESRTGSTIMKAVADGVKEVSFELGGKNAAVVFADADFDAAVAGVLRSSFTNAGQVCLCSERVYVERPIFERFVAALKEQAQALRVGAPEDPATTMGPLISRGHRDKVLSYFRLAVEEGATVVTGGGAPSDDGAFVMPTIWTGLPDSARCVREEIFGPVCHIAPFDDEAEVVKRVNDSAYGLAASIWTTQLARGHRVAKQIETGIVWVNAWFVRDLRTPFGGTKLSGLGREGGRHSLDFYSELTNVCVR.. 497
30 -126.0004x2q_A mol:protein length:504 Retinal dehydrogenase 2  ali model follow..  32  1.........ASLHLLPSPTPNLEIKYTKIFINNEWQNSESGRVFPVYNPATGEQVCEVQEADKADIDKAVQAARLAFSLWRRMDASERGRLLDKLADLVERDRAVLATMESLNGGKPFLQAFVDLQGVIKTFRYYAGWADKIHGMTIPVD-GDYFTFTRHEPIGVCGQIIPWNFPLLMFAWKIAPALCCGNTVVIKPAEQTPLSALYMGALIKEAGFPPGVINILPGYGPTAGAAIASHIGIDKIAFTGSTEVGKLIQEAAGSNLKRVTLELGGKSPNIIFADADLDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVRRSVERAKRRVVGSPFDPTTEQGPQIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALTVSSAMQAGTVWINCYNALNAQSPFGGFKMSGNGREMGEFGLREYSEVKTVTVK.. 492
31 -126.0003vz2_A mol:protein length:470 Succinate-semialdehyde dehydrogenase  ali model follow..  32  1...............................SSGLVPRGSHMAIATINPTTGEICQRFKALTPAEIDAKLAKAQEAFQAYRRTSFSQRRQWLENAAAILERDTSKFAEIMTTEMGKTHQSAIAEAEKSALVCRYYAEHGEQFLANEYTET-QATESYVCYQPLGILLAVMPWNFPFWQVFRFAAPALMAGNVAVLKHASNVPQCALAVEAILEAAGFPEGVFQTLLI-GASQVEQVIKDPRVKAATLTGSEPAGASLASLAGQEIKPTLLELGGSDPFVVFPSADLDEAVEVGTVARTMNNGQSCIAAKRFILHEAIAAEFLEKLHLKFASLKIGDPMAPETDIGPLATEGILQDISRQVDQAVAAGAKILLGGRPLDRAGYFYPPTILTEIPPGAKILQEELFAPVAMVFTVKDLDQAIALANDIPFGLGASAWTNDPAEQQRFIQELDAGAVFINGMVKADPRLPFGGTKRSGYGRELGLAGIRTFVNAKTVWLK.. 464
32 -126.0003prl_A mol:protein length:505 NADP-dependent glyceraldehyde-3-phosphate dehydrogenase  ali model follow..  30  1...............MVMALQTEQFNANILRNGEWVESRTGERISISAPASGVALGSIPALSQEEVNDAIQGAKDAQKIWKIRPIHERVDLLYAWADLLEERKEIIGELIMHEVAKPKKSAIGEVSRTADIIRHTADEALRLNGETLKGDSSKKIALVEREPLGVVLAISPFNYPVNLAAAKIAPALVTGNTVVFKPATQGSLSGIKMVEALADAGAPEGIIQVVTGRGSVIGDHLVEHPGIDMITFTGGTTTGERISEKA--KMIPVVLELGGKDPAIVLDDADLKLTASQIVSGAFSYSGQRCTAIKRVFVQDSVADQLVANIKELVEQLTVGSPEDD-ADITPVIDEKSAAFIQGLIDDALENGATLLSGNKR---QGNLLSPTLLDDVTPAMRVAWEEPFGPVLPIIRVKDANEAISLSNQSDYGLQASIFTKDTDRAINIGKHLEVGTVHINAKTERGPHFPFLGVKKSGLGVQGIKPSLLSMTRERVTVLN.. 482
33 -126.0001o9j_A mol:protein length:501 ALDEHYDE DEHYDROGENASE, CYTOSOLIC 1  ali model follow..  32  3........SSGMPDLPAPLTNIKIQHTKLFINNEWHESVSGKTFPVFNPATEEKICEVEEADKEDVDKAVKAAREAFQMWRTMDASERGQLIYKLADLIERDRLLLATLESINAGKVFASAYMDLDYCIKALRYCAGWADKIQGRTIPVD-GEFFSYTRHEPIGVCGLIFPWNAPMILLACKIGPALCCGNTVIVKPAEQTPLTALHVASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDVDKVAFTGSTEVGKMIQEAAASNLKRVTLELGAKNPCIVFADADLDSAVEFAHQGVFTNQGQSCIAASKLFVEEAIYDEFVQRSVERAKKYVFGNPLTPGVNHGPQINKAQHNKIMELIESGKKEGAKLECGGGPWGNKGYFIQPTVFSNVTDDMRIAKEEIFGPVQQIMKFKSLDEVIKRANNTYYGLVAGVFTKDLDKAVTVSSALQAGTVWVNCYLAASAQSPAGGFKMSGHGREMGEYGIHEYTEVKTVTMK.. 495
34 -126.0001a4z_A mol:protein length:499 ALDEHYDE DEHYDROGENASE  ali model follow..  32  1........SAATQAVPTPNQQPEVLYNQIFINNEWHDAVSKKTFPTVNPSTGDVICHVAEGDKADVDRAVKAARAAFQLWRRMDASERGRLLNRLADLIERDRTYLAALETLDNGKPYIISYVDLDMVLKCLRYYAGWADKYHGKTIPID-GDYFSYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNVIPGFGPTAGAAIASHEDVDKVAFTGSTEVGHLIQVAAGSNLKRVTLEIGGKSPNIIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYAEFVERSVARAKSRVVGNPFDSRTEQGPQVDETQFKKVLGYIKSGKEEGLKLLCGGGAAADRGYFIQPTVFGDLQDGMTIAKEEIFGPVMQILKFKSMEEVVGRANNSKYGLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVFGAQSPFGGYKLSGSGRELGEYGLQAYTEVKTVTVR.. 493
35 -126.0003ros_A mol:protein length:484 NAD-dependent aldehyde dehydrogenase  ali model follow..  29  2.......................................VMSKYQSVNPYTNEAFASYDNPTSKQIDEAINLAHALYKKWRHEEPASRAEILHDIANALKEHEDELAKMMTLEMGKLLSESKEEVELCVSICNYYADHGPEMLKPTKLNS-DLGNAYYLKQSTGVIMACEPWNFPLYQVIRVFAPNFIVGNPILLKHAHNVPGSAALTAKIIKRAGAPEGSLINLYPSY-DQLADIIADPRIQGVALTGSERGGSAVAEAAGKNLKKSTMELGGNDAFIVLDDADPQVLRNVLNDARTYNDGQVCTSSKRIIVEKSRYDEVLHELKNVFSNLKAGDPLEADTTLPPMNSEKAKEKLEAQVKEAIDAGAKVFYQYPEIDSKGAFFRPTILTDIAKDNPVFDKEVFGPIAEVFVVEDDNAAIQLANDSSYGLGSSVIGSDIDRAKKVSAQIETGMTVINGRWITSGELPFGGIKKSGYGRELSGLGLMAFVNEHLVIDV.. 457
36 -126.0005gt6_A mol:protein length:508 Betaine-aldehyde dehydrogenase  ali model follow..  34  3.SSSQDPMLKTNIELKPKVEAFLNEEIKMFINGEFVSAIGGKTFETYNPATEDVLAVVCEAQEEDIDAAVKAARSAFESWAEMTTAERAHLIYKLADLIEEHREELAQLEALDNGKPYQVALDDISATVENYRYYAGWTTKIIGQTIPIS-KDYLNYTRHEPVGVVGQIIPWNFPLVMSSWKMGAALATGCTIVLKPAEQTPLSLLYAAKLFKEAGFPNGVVNFVPGFGPEAGAAIVNHHDIDKVAFTGSTVTGKYIMRQSAEMIKHVTLELGGKSPNIILEDADLEEAINGAFQGIMYNHGQNCSAGSRVFVHRKHYETVVDALVKMANNVKLGAGMEKETEMGPLVSKKQQERVLNYIEQGKKEGATVAAGGERALEKGYFVKPTVFTDVTDDMTIVKEEIFGPVVVVLPFDSTEEVIERANNSSYGLAAGVWTQNIKTGHQVANKLKAGTVWINDYNLENAAAPFGGYKQSGIGRELGSYALDNYTEVKSVWVN.. 500
37 -126.0004ywe_A mol:protein length:487 Putative aldehyde dehydrogenase  ali model follow..  31  1.....................MAMEEAKHFIAGEWTLPAQLETIPVVDPSDGQPFATIARGTAPDIERAVAAARDAFAGWGAASAAERGRVLMRLSARVTDSIEELAAIEARDTGKPLKQARADAAALARYFEFYAGAADKLHGETLPYQ-AGYTVLTVREPHGVTGHIVPWNYPMQIFGRSVGAALAAGNACVVKPAEDACLSVLRVAELAAEAGLPAGALNIVTGYGHEAGAALARHPGIDHISFTGSPATGKLVTQMAAENHVPVTLELGGKSPQIVFADADLDAALPVLVSAIVQNGGQTCSAGSRVLIERAVYEPLVERLATAFNGLRVG-PSRADLDCGPLINAKQQQRVWDFLSDAQHDGIPMAAHGQVVADSGFYQAPALLRDVPPSHRLAQEEVFGPVLAAMRFVDEDEAVALANGTPYGLVAGIWTRDGARQMRLARRLRAGQVFINNYGAGGVELPFGGVGHSGHGREKGFEALYGFTALKTIAIR.. 479
38 -126.0005fhz_A mol:protein length:529 Aldehyde dehydrogenase family 1 member A3  ali model follow..  33  18.AVENGQPDRKPPALPRPIRNLEVKFTKIFINNEWHESKSGKKFATCNPSTREQICEVEEGDKPDVDKAVEAAQVAFQRWRRLDALSRGRLLHQLADLVERDRATLAALETMDTGKPFLHAFFDLEGCIRTLRYFAGWADKIQGKTIPTD-DNVVCFTRHEPIGVCGAITPWNFPLLMLVWKLAPALCCGNTMVLKPAEQTPLTALYLGSLIKEAGFPPGVVNIVPGFGPTVGAAISSHPQINKIAFTGSTEVGKLVKEAASSNLKRVTLELGGKNPCIVCADADLDLAVECAHQGVFFNQGQCCTAASRVFVEEQVYSEFVRRSVEYAKKRPVGDPFDVKTEQGPQIDQKQFDKILELIESGKKEGAKLECGGSAMEDKGLFIKPTVFSEVTDNMRIAKEEIFGPVQPILKFKSIEEVIKRANSTDYGLTAAVFTKNLDKALKLASALESGTVWINCYNALYAQAPFGGFKMSGNGRELGEYALAEYTEVKTVTIK.. 517
39 -126.0004wb9_A mol:protein length:501 Retinal dehydrogenase 1  ali model follow..  32  2.......SSSGTPDLPVLLTDLKIQYTKIFINNEWHDSVSGKKFPVFNPATEEELCQVEEGDKEDVDKAVKAARQAFQIWRTMDASERGRLLYKLADLIERDRLLLATMESMNGGKLYSNAYNDLAGCIKTLRYCAGWADKIQGRTIPID-GNFFTYTRHEPIGVCGQIIPWNFPLVMLIWKIGPALSCGNTVVVKPAEQTPLTALHVASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDIDKVAFTGSTEVGKLIKEAAGSNLKRVTLELGGKSPCIVLADADLDNAVEFAHHGVFYHQGQCCIAASRIFVEESIYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQYDKILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLSAGVFTKDIDKAITISSALQAGTVWVNCYGVVSAQCPFGGFKMSGNGRELGEYGFHEYTEVKTVTVK.. 495
40 -126.0001bxs_A mol:protein length:501 ALDEHYDE DEHYDROGENASE  ali model follow..  32  3........SSAMPDVPAPLTNLQFKYTKIFINNEWHSSVSGKKFPVFNPATEEKLCEVEEGDKEDVDKAVKAARQAFQIWRTMDASERGRLLNKLADLIERDRLLLATMEAMNGGKLFSNAYMDLGGCIKTLRYCAGWADKIQGRTIPMD-GNFFTYTRSEPVGVCGQIIPWNFPLLMFLWKIGPALSCGNTVVVKPAEQTPLTALHMGSLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDVDKVAFTGSTEVGKLIKEAAGSNLKRVSLELGGKSPCIVFADADLDNAVEFAHQGVFYHQGQCCIAASRLFVEESIYDEFVRRSVERAKKYVLGNPLTPGVSQGPQIDKEQYEKILDLIESGKKEGAKLECGGGPWGNKGYFIQPTVFSDVTDDMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLSAGIFTNDIDKAITVSSALQSGTVWVNCYSVVSAQCPFGGFKMSGNGRELGEYGFHEYTEVKTVTIK.. 495
41 -126.0004e4g_A mol:protein length:521 Methylmalonate-semialdehyde dehydrogenase  ali model follow..  26  2.......SSGVDLGTENLYFQSMMYELGHFIDGKRVAGTSGRVSNIFNPATGEVQGTVALASDADLAAAVESAKAAQPKWAATNPQRRARVFMKFVQLLNDNMNELAEMLSREHGKTIDDAKGDIVRGLEVCEFVIGIPHLQKSEFTEGAGPGIDMYSIRQPVGIGAGITPFNFPGMIPMWMFAPAIACGNAFILKPSERDPSVPIRLAELMIEAGLPAGILNVVNGDK-GAVDAILTHPDIAAVSFVGSTPIARYVYGTAAMNGKRAQCFGGAKNHMIIMPDADLDQAANALIGAGYGSAGERCMAISAVPVGEETANRLIDKLVPMVESLRIGPYTDEKADMGPVVTKEAEQRIRSLIDSGIEQGAKLVVDGRDFKENGHFIGGCLFDDVTPDMDIYKTEIFGPVLSVVRARNYEEALSLPMKHEYGNGVAIYTRDGDAARDFASRINIGMVGVNVPIPVPAYHSFGGWKSSSFGNQHGTDSIKFWTRTKTITSR.. 498
42 -125.0001t90_A mol:protein length:486 Probable methylmalonate-semialdehyde dehydrogenase  ali model follow..  29  1.....................AEIRKLKNYINGEWVESKTDQYEDVVNPATKEVLCQVPISTKEDIDYAAQTAAEAFKTWSKVAVPRRARILFNFQQLLSQHKEELAHLITIENGKNTKEALGEVGRGIENVEFAAGAPSLMMGDSLASIATDVEAANYRYPIGVVGGIAPFNFPMMVPCWMFPMAIALGNTFILKPSERTPLLTEKLVELFEKAGLPKGVFNVVYGAH-DVVNGILEHPEIKAISFVGSKPVGEYVYKKGSENLKRVQSLTGAKNHTIVLNDANLEDTVTNIVGAAFGSAGERCMACAVVTVEEGIADEFMAKLQEKVADIKIGNGLDDGVFLGPVIREDNKKRTLSYIEKGLEEGARLVCDGRENVDDGYFVGPTIFDNVTTEMTIWKDEIFAPVLSVIRVKNLKEAIEIANKSEFANGACLFTSNSNAIRYFRENIDAGMLGINLGVPAPAFFPFSGWKSSFFGHANGKDSVDFYTRKKVVTAR.. 479
43 -125.0005mz5_A mol:protein length:515 ALDH21)  ali model follow..  32  9.NSSSMTLGHMVQKAKESSGDVTPKKYNIFLASKPVDG-DRKWLDVTNKYTNDVAAKVPQATHKDIDDAIDAAVAAAPAMAAMGAYERKAVLEKVVAELKNRFEEIAQTLTMESGKPIKDARGEVTRTIDTFQVAAEESVRIYGEHIPLDNKGLQGIVKKFPIGPVSMVSPWNFPLNLVAHKVAPAIAVGCPFVLKPASRTPLSALILGEILHKEELPLGAFSILPVSR-EDADMFTVDERFKLLTFTGSGPIGWDMKARAG--KKKVVMELGGNAPCIVDDYVDLDYTIQRLINGGFYQGGQSCIHMQRLYVHERLYDEVKEGFVAAVKKLKMGNPFEEDTYLGPMISESAAKGIEDWVKEAVAKGGKLLTGGNR---KGAFIEPTVIEDVPIEANARKEEIFGPVVLLYKYSDFKEAVKECNNTHYGLQSGIFTKDLNKAFYAFEHMEVGGVILNDSALRVDSQPYGGLKDSGIQREGVKYAMDDMLETKVLVMRNV 506
44 -125.0003i44_A mol:protein length:497 Aldehyde dehydrogenase  ali model follow..  28  1.......MAMGTLEAQTQGPGSMLNKRKFYINGLWDDPSTPHDLYVIDPSTEEACAVISLGSTRDADKAINAAKKAFQTWKTTSPHERLGFVEKILEIYEKRSSDMAKTISMEMGAPIDMALAQTATGSSHIRNFIKAYKEFSFQEALIE-GNEQAILHYDAIGVVGLITPWNWPMNQVTLKVIPALLAGCTMVLKPSEIAPLSAMLFAEILDEAALPSGVFNLINGDGANVGSYLSAHPDLEMISFTGSTRAGKDISKNASNTLKRVCLELGGKGANIIFADADID-ALQRGVRHCFYNSGQSCNAPTRMLVEQAIYDKAIKTAKDIAEKTQVGPGHQTGNHIGPVVSKEQYDKIQDLIQSGIDEGATLVTGGTGLPERGYYVRPTVFADVKPHMRIFREEIFGPVLSLLPFNTEDEAVTLANDTEYGLTNYIQSQDRSKCRRIAAQVRSGMVEVNGHEL-PGGSYFGGVKFSGRAREGGLWGIKEFLDTKAIS.... 489
45 -125.0003efv_A mol:protein length:462 Putative succinate-semialdehyde dehydrogenase  ali model follow..  35  1...................................MTMMTATQALSVNPATGQTLAAMPWANAQEIEHALSLAASGFKKWKMTSVAQRAQTLRDIGQALRAHAEEMAQCITREMGKPIKQARAEVTKSAALCDWYAEHGPAMLNPEPTLV-ENQQAVIEYRPLGVILAIMPWNFPLWQVLRGAVPILLAGNSYLLKHAPNVTGCAQMIARILAEAGTPAGVYGWVNANN-EGVSQMINDPRIAAVTVTGSVRAGAAIGAQAGAALKKCVLELGGSDPFIVLNDADLELAVKAAVAGRYQNTGQVCAAAKRFIVEEGIAQAFTDRFVAAAAALKMGDPLVEENDLGPMARFDLRDELHQQVQASVAEGARLLLGGEKIAGEGNYYAATVLADVTPDMTAFRQELFGPVAAITVAKDAAHALALANDSEFGLSATIFTADDTLAAEMAARLECGGVFINGYSASDARVAFGGVKKSGFGRELSHFGLHEFCNVQTVWKNRV 462
46 -125.0004o6r_A mol:protein length:496 Aldehyde Dehydrogenase  ali model follow..  34  4.........................QTQLFIDGRFVDAVDRGTIDVLNPHDGSVITKIAAATAADVDLAVDAATRAFPAWSAMPAAERGRLLLRLADAIEANTEALAQLESLDTGHPIRDSRADVPRTAACFRYFGGMADKLQGSVIPVD-TGFLNYVQRAPIGVVGQIVPWNFPLMFTSWKMGPALAAGNTVVLKPSEITPLSTLRIVELMAEVGFPAGVVNIVPGYGHTAGQRLAEHPGVGKIAFTGSTATGRRIVEASQGNLKRVQLELGGKGANIVFDDANLDAAINGAAWAIFHNQGQACIAGSRLVLHERIADAFLERFVALASSIRIGNPLDPNTEMGPLTSKQHLDRVLSYVDVAREQGGRVLTGGSAPQANGYYVRPTIVEAKHATDRVAQEEVFGPFVTVLRFGSDDEALAIANATEYGLGSGLWTNDLSRAHRMAARIDAGMCWINCYKRVNPGSPFGGVGKSGYGREMGFEAMHDYTEARSVWVN.. 479
47 -125.0005tjr_A mol:protein length:531 Methylmalonate-semialdehyde dehydrogenase  ali model follow..  28  7..ASMTGGQQMGRDLYDDDDKGSMTLIKHLIGGELIAD-TGRTADVFNPSTGEAVRKVPLADRETMQQAIDAAKAAFPAWRNTPPAKRAQVLFRFKQLLEANEERIVKLISEEHGKTIEDAAGELKRGIENVEYATAAPEILKGEYSRNVGPNIDAWSDFQPIGVVAGITPFNFPAMVPLWMYPLAIACGNTFILKPSERDPSSTLLIAELFHEAGLPKGVLNVVHGDK-GAVDALIEAPEVKALSFVGSTPIAEYIYSEGTKRGKRVQALGGAKNHAVLMPDADLDNAVSALMGAAYGSCGERCMAISAVCVGDQIADALVQKLVPQIKGLKIGAGTSCGLDMGPLVTGAARDKVTGYIDTGVAQGAELVVDGRGYKENGFFLGGTLFDRVTPEMTIYKEEIFGPVLCIVRVNSLEEAMQLINDHEYGNGTCIFTRDGEAARLFCDEIEVGMVGVNVPLVPVAYHSFGGWKRSLFGHAYGPDGVRFYTKRKAITQR.. 507
48 -125.0004lih_A mol:protein length:504 Gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase  ali model follow..  34  1.....MAMNKLTLADWQHKAASLEIEGRAFIDGASRDAHGGRTFDCVSPIDGRVLAKVADCGEADVNAAVAAARRAFDAWAGLNPRARKAVLLRWAALMREHLDELSLLETLDAGKPIGDTTTDVPGAAYCVEWFAEAIDKVGGEVAPAD-HHLVGLVTREPVGVVAAVVPWNFPILMAAWKFGPALAAGNSVVLKPSEKSPLTAIRVAQLAFEAGIPAGVFNVVPGAG-EPGKLLALHRDVDCIAFTGSTAVGKLIMQYAAQNLKRAWLELGGKSPNIVLPDCDLDRAAQTAAGAIFYNMGEMCTAGSRLLVHRDIKDAFIEKLVAAARAYVPGNPLDPSVSMGAIVDGIQLERVLGYIEAGRGEGRLVTGGARVNATGGFYVEPTVF-EVKPDAKIAREEIFGPVLSVIVFDDVDEAVRIANDTEYGLAAAVWTSNLTTAHDVSRRLRAGTVWVNCYDGGDMNFPFGGYKQSGNGRDKSLHALEKYTELKSTLIR.. 496
49 -125.0004o5h_A mol:protein length:511 Phenylacetaldehyde dehydrogenase  ali model follow..  33  1..AMVNMETNETFALLDATRAFLAKPKQMLIGAEWSDAASGRQLDVVNPADGTVIARVPEADERDVQQAVAAARRAFDAWRTAKTTDRERLMLVLADLIEANARELAEIESLDNGKPVMVAQGDVAMAAQCFRYMAGWATKIEGSVIDAGMPEIFAYTRKEPVGVVGAIIPWNFPLLMAAWKIAPALATGCTVVLKPAEDTPLSALRLGELIQAAGFPDGVVNIVTGYGHTAGAALSRDPRIDKIAFTGSTQTGKTIGHAALDNMTRMSLELGGKSPVIVLPDVDLDKAAQGVANAIFFNQGQVCTAGSRAYIHSKVFDGVIERVAKIAASLKIGPGMDPATQIGPLVSAKQRERVCGYIDSGFGEGARAAAGGRAIDGPGFFVEPTVLVDTTQAMRVVREEIFGPVLVAMPFDDVDTAVQLANDTPYGLGASIWSNDLSAIHKLVPRIAAGTVWVNCHSLLDNALPFGGMKQSGFGRELGRAVIDQYTESKSVMMN.. 503
50 -124.0003ty7_A mol:protein length:478 Putative aldehyde dehydrogenase SAV2122  ali model follow..  35  1...................SNAMRDYTKQYINGEWVESNSNETIEVINPATEEVIGKVAKGNKADVDKAVEAADDVYLEFRHTSVKERQALLDKIVKEYENRKDDIVQAITDELGAPLSLSER--VHYQMGLNHFVAARDALDNYEFEE--RRGDDLVVKEAIGVSGLITPWNFPTNQTSLKLAAAFAAGSPVVLKPSEETPFAAVILAEIFDKVGVPKGVFNLVNGDGAGVGNPLSEHPKVRMMSFTGSGPTGSKIMEKAAKDFKKVSLELGGKSPYIVLDDVDIKEAAKATTGKVVNNTGQVCTAGTRVLVPNKIKDAFLAELKEQFSQVRVGNPREDGTQVGPIISKKQFDQVQNYINKGIEEGAELFYGGPGKPEKGYFARPTIFINVDNQMTIAQEEIFGPVMSVITYNDLDEAIQIANDTKYGLAGYVIGKDKETLHKVARSIEAGTVEINEAGR-KPDLPFGGYKQSGLGREWGDYGIEEFLEVKSIAGY.. 476
51 -124.0006dbb_A mol:protein length:511 Putative aldehyde dehydrogenase family protein  ali model follow..  27  3........................MQFNDILAALDIDLAKGNALTARSPLDGATLATLAVDTPADAERKIDAAHDAFLKWRTVPAPVRGELVRVFGNVLREHKAELGRLVTLEAGKITSEGLGEVQEMIDICDFAVGLSRQLYGLTIASERPGHRMMETWHPIGVCGVISAFNFPVAVWAWNAALAFVCGDSVVWKPSEKTPLTAIACHVLLQKAVAPAELGQLVLG-MRDVGEVLTASKKVPVVSATGSVRMGQEVAKVLSQRLARGILELGGNNGMIVAPSADLDLVVRAVTFAAVGTAGQRCTTLRRLIVHRSLVEQLLPRIEKAYASVKVGNPLEEGTLVGPLVDRASFDAMQKALADAREQGGEVKGGERVDVGADAYYVRPAIVRMPKQSAVVERETFAPILYVMVYDNFDDAIDVHNAVPQGLSSAIFTNDMREAEQFAAGSDCGIVNVNIGTSAEIGGAFGGEKETGGGRESGSDAWKAYMRRATNTIN.. 490
52 -124.0004x0t_A mol:protein length:513 Alpha-aminoadipic semialdehyde dehydrogenase  ali model follow..  28  24.........................ENEGVYNGSWGG--RGEVITTYCPANNEPIARVRQASVADYEETVKKAREAWKIWADIPAPKRGEIVRQIGDALREKIQVLGSLVSLEMGKILVEGVGEVQEYVDICDYAVGLSRMIGGPILPSERSGHALIEQWNPVGLVGIITAFNFPVAVYGWNNAIAMICGNVCLWKGAPTTSLISVAVTKIIEDNKLPGAICSLTCG-GADIGTAMAKDERVNLLSFTGSTQVGKQVGLMVQERFGRSLLELGGNNAIIAFEDADLSLVVPSALFAAVGTAGQRCTTARRLFIHESIHDEVVNRLKKAYAQIRVGNPWDPNVLYGPLHTKQAVSMFLGAVEEAKKEGGTVVYGGKVMDRPGNYVEPTIVTGLGHDASIAHTETFAPILYVFKFKNEEEVFAWNNEVKQGLSSSIFTKDLGRIFRWPKGSDCGIVNVNIPTSAEIGGAFGGEKHTGGGRESGSDAWKQYMRRSTCTIN.. 499
53 -124.0004h73_A mol:protein length:491 Aldehyde dehydrogenase  ali model follow..  28  1..................MIDLNIMKVANYINGEFKEPSTGAFQVKTSPVDGSKIAEVPRSGREDAREAIDSAFEALKAWANIPAIRRAEYLYKMLEVFRQMKEDFMKILTVEGGGTYRKVWGEVVFTERLIQNAAELARHYQGRVLQSDSESTISVVFKRSKGVVGVITPWNYPLSISMKKIAHTLAVGNTVVYKPASDTPVTGWLIAQMVAKAGLPKGVFNLVIGPGPVVGEEIVTHKRVAHVTFTGESSTGREIAAKAAGTLKTVTLELGGSDPLIILDDVDVDYAARLAVFASLFHQGQICTSAKRIIVHKAVADKFIERYVHYVKMLRIDDPRDEKVDLGPLINERQVALMKEFVDDAVSRGGRLLIGGRS---WGNFFEPAIFVDVDRNFRIMREEVFGPVRPIVVVENDDQAVEVANDTDYGLSGAVLTNNVNRAFRIAEAVESGMFHINDVTFEESHVPFGGIKASGVGREGGEWSFHETTYDRWVTVT.. 478
54 -124.0004qyj_A mol:protein length:516 Aldehyde dehydrogenase  ali model follow..  33  4.SSSGLVPRGSHMNSSLSAIDGLRLPHQMLIGGQWVSAQSGKTLNVYNPATGDILTEVPDGDVEDVNAAVESAAATLRSWRRMPPSARERILLRLADLLEVHGDELARLETLNNGKLLIYSKMEVGASAQWLRYMAGWATKLTGSTLDLSLPRSRASTQRVPVGVVAAIIPWNFPLLMAVWKIAPALACGNTVVLKPAEETPLTALRLAELAMEAGLPAGALNVVTGRGETAGDALVRHPKVAKVAFTGSTEVGRIIGSACGRSLKAVSLELGGKSPVIVLADCDPQEAAEGAAAAIFFNHGQVCTAGSRLYVHESIYEDVIQRLAVIGESIVVGSGLEQGVHMGPMVSKKHHENVLRHIRNGIEDGADLICGGTEAPAQGFFVKPTIFANRKKDIRLLSQEVFGPVLVATPFSDIAEVVNEANRSVYGLGASIWTNDLSAALRINDELEAGTVWVNTHNMVDPNLPFGGFKDSGVGREHGAAAIEHYTTTRSLVIA.. 509
55 -123.0004pxl_A mol:protein length:517 Cytosolic aldehyde dehydrogenase RF2C  ali model follow..  32  5SQDPNSATANGSSKGSFEVPKVEVRFTKLFIDGKFVDAVSGKTFETRDPRTGEVIASIAEGDKADVDLAVKAAREAFDNWPRMTGYERGRILHRFADLIDEHVEELAALDTVDAGKLFAVGKADIPGAAHLLRYYAGAADKVHGATLKMA-QRMHGYTLKEPVGVVGHIVPWNYPTTMFFFKVGPALAAGCAVVVKPAEQTPLSALFYAHLAREAGVPAGVLNVVPGFGPTAGAAVAAHMDVDKVSFTGSTEVGRLVMRAAAENLKPVSLELGGKSPVIVFDDADLDMAVNLVNFATYTNKGEICVAGTRIYVQEGIYDEFVKKAAELASKSVVGDPFNPSVSQGPQVDKDQYEKVLRYIDIGKREGATLVTGGKPCGDKGYYIEPTIFTDVKDDMTIAQDEIFGPVMALMKFKTVEEVIQKANNTRYGLAAGIVTKNIDVANTVSRSIRAGAIWINCYFAFDPDAPFGGYKMSGFGKDMGMDALDKYLQTKTVVTP.. 504
56 -123.0004zz7_A mol:protein length:501 Methylmalonate-semialdehyde dehydrogenase  ali model follow..  27  2.....................SHMTTIGHLINGQLVTE-NTRSQNVFNPATGEIGKQLDLASTKTVEQAISAAQHAFPTWRNTPPLKRARVMFRFKELLEQHADEICRLIGEEHGKIAHDAMGELQRGIENVEYACGAPELLKGEHSRNVGPGIDSWSEFQPMGVVAGITPFNFPVMVPLWMFPMAIVCGNCFVLKPSERDPSSTLYIAQLLQEAGLPDGVMNVVNGDK-EAVDALLHDDRVKAVSFVGSTPIAEYIYRTASANGKRCQALGGAKNHAIVMPDADMDNAVNQLLGAAFGSSGERCMALSAVAVGDAAGDALVSKMTQAMQKLKVGPSTDSGNDFGPVITRQHQEKVIGYINSAEQQGATIVVDGRQPKENGFFVGGTLIDHVTPEMTSYQEEIFGPVLQVVRVATMQDAMDLIDAHEYGNGTCIFTRDGEAARYFSDNIQVGMVGINIPLPVPAYHSFGGWKRSLFGHAYGPDAVRFYTKRKTVTQR.. 483
57 -123.0003vz0_A mol:protein length:459 Putative NAD-dependent aldehyde dehydrogenase  ali model follow..  31  1.....................................GSHMIVYQTLNPTTETVERSFDLHTPAQMKDITDRAEHVWKTWKLRSIAQRKEIVSRAADLLRRDRQHHASLIATEMGKALPDALEEIDVTADILSFYANGAEEFLAPTPLKV-KTGQAKIINQPLGIIYCIEPWNFPYYQLARVAGPNLMAGNVVIAKHAPNVPQCALAFEKLFHDAGAPVGAYANIFLDN-DQSAELIKDERIRGVALTGSERAGQAVAAQAGAALKKDTMELGGSDAFIVLDDADLDLAVKWAVWGRFANNGQVCTAAKRMIVHEKVYDAFLDGLKTAITRFRIGNPLDRDTTHGPMSSLRAMELALDQTAEAVKGGATLVAGGKRMDRKGFFMEPTILTDVSKDNPVFYQEIFGPVAVVHKVASEQAAIDLANDSPYGLGGAVFSRDIARAEKVAEQVETGMVFINTATAAAPELPFGGIKNSGFGRELSFLGIEEFINRKLVRIG.. 459
58 -123.0001a4s_A mol:protein length:503 BETAINE ALDEHYDE DEHYDROGENASE  ali model follow..  33  1.......AQLVDSMPSASTGSVVVTDDLNYWGGRRIKSKDGATTPVFEPATGRVLCQMVPCGAEEVDQAVQSAQAAYLKWSKMAGIERSRVMLEAARIIRERRDNIAKLEVINNGKTITEAEYDIDAAWQCIEYYAGLAPTLSGQHIQLP-GGAFAYTRREPLGVCAGILAWNYPFMIAAWKCAPALACGNAVVFKPSPMTPVTGVILAEIFHEAGVPVGLVNVVQG-GAETGSLLCHHPNVAKVSFTGSVPTGKKVMEMSAKTVKHVTLELGGKSPLLIFKDCELENAVRGALMANFLTQGQVCTNGTRVFVQREIMPQFLEEVVKRTKAIVVGDPLLTETRMGGLISKPQLDKVLGFVAQAKKEGARVLCGGEPLTKNGYFMSPCVLDNCRDDMTCVKEEIFGPVMSVLPFDTEEEVLQRANNTTFGLASGVFTRDISRAHRVAANLEAGTCYINTYSISPVEVPFGGYKMSGFGRENGQATVDYYSQLKTVIVE.. 495
59 -123.0002wme_A mol:protein length:490 BETAINE ALDEHYDE DEHYDROGENASE  ali model follow..  35  2.....................ARFEEQKLYIGGRYVEASSGATFETINPANGEVLAKVQRASREDVERAVQSAVEGQKVWAAMTAMQRSRILRRAVDILRERNDELAALETLDTGKPLAETRSDIVTGADVLEYYAGLVPAIEGEQIPLR-ETSFVYTRREPLGVVAGIGAWNYPVQIALWKSAPALAAGNAMIFKPSEVTPLTALKLAEIYTEAGVPDGVFNVLTGSGREVGQWLTEHPLIEKISFTGGTSTGKKVMASASSSLKEVTMELGGKSPLIIFPDADLDRAADIAVMANFFSSGQVCTNGTRVFIHRSQQARFEAKVLERVQRIRLGDPQDENTNFGPLVSFPHMESVLGYIESGKAQKARLLCGGERVTGKGAYVAPTVFTDCRDDMTIVREEIFGPVMSILVYDDEDEAIRRANDTEYGLAAGVVTQDLARAHRAIHRLEAGICWINTWGESPAEMPVGGYKQSGVGRENGLTTLAHYTRIKSVQVE.. 482
60 -123.0005l13_A mol:protein length:517 Aldehyde dehydrogenase, mitochondrial  ali model follow..  32  13..GRRLLSAAATQAVPAPNQQPEVFCNQIFINNEWHDAVSRKTFPTVNPSTGEVICQVAEGDKEDVDKAVKAARAAFQLWRRMDASHRGRLLNRLADLIERDRTYLAALETLDNGKPYVISYVDLDMVLKCLRYYAGWADKYHGKTIPID-GDFFSYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPGFGPTAGAAIASHEDVDKVAFTGSTEIGRVIQVAAGSNLKRVTLELGGKSPNIIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYDEFVERSVARAKSRVVGNPFDSKTEQGPQVDETQFKKILGYINTGKQEGAKLLCGGGIAADRGYFIQPTVFGDVQDGMTIAKEEIFGPVMQILKFKTIEEVVGRANNSTYGLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVFGAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTVK.. 511
61 -123.0003qan_A mol:protein length:538 1-pyrroline-5-carboxylate dehydrogenase 1  ali model follow..  31  24............EEALGLVEKELGKEYPLIINGERVT--TEDKIQSWNPARDQLVGSVSKANQDLAEKAIQSADEAFQTWRNVNPEERANILVKAAAIIRRRKHEFSAWLVHEAGKPWKEADADTAEAIDFLEYYARQMIELNRGKEILSRPGEQNRYFYTPMGVTVTISPWNFALAIMVGTAVAPIVTGNTVVLKPASTTPVVAAKFVEVLEDAGLPKGVINYVPGSGAEVGDYLVDHPKTSLITFTGSKDVGVRLYERAANHLKRVIVEMGGKDTVVVDRDADLDLAAESILVSAFGFSGQKCSAGSRAVIHKDVYDEVLEKTVALAKNLTVGDPTNRDNYMGPVIDEKAFEKIMSYIEIGKKEGR-LMTGGEGDSSTGFFIQPTIIADLDPEAVIMQEEIFGPVVAFSKANDFDHALEIANNTEYGLTGAVITRNRAHIEQAKREFHVGNLYFNRNCTGAGYHPFGGFKMSGTDSKGGPDYLALHMQAKTVSEM.. 515
62 -123.0004ogd_A mol:protein length:465 Succinate-semialdehyde dehydrogenase  ali model follow..  30  2..........................................AYQTIYPYTNEVLHTFDNMTDQGLADVLERAHLLYKKWRKEDHEERKAQLHQVANILRRDRDKYAEIMTKDMGKLFTEAQGEVDLCADIADYYADKADEFLMSTPLET-DSGQAYYLKQSTGVILAVEPWNFPYYQIMRVFAPNFIVGNPMVLKHASICPRSAQSFEELVLEAGAEAGSITNLFISYDQVSQ-VIADKRVVGVCLTGSERGGASIAEEAGKNLKKTTLELGGDDAFIILDDADWDQLEKVLYFSRLYNAGQVCTSSKRFIVLDKDYDRFKELLTKVFKTAKWGDPMDPETTLAPLSSAQAKADVLDQIKLALDHGAELVYGGEAIDHPGHFVMPTIIAGLTKDNPIYYQEIFGPVGEIYKVSSEEEAIEVANDSNYGLGGTIFSSNQEHAKAVAAKIETGMSFINSGWTSLPELPFGGIKHSGYGRELSELGFTSFVNEHLIYIP.. 455
63 -123.0001euh_A mol:protein length:475 NADP DEPENDENT NON PHOSPHORYLATING GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE  ali model follow..  31  3........................KQYKNYVNGEWKLS--ENEIKIYEPASGAELGSVPAMSTEEVDYVYASAKKAQPAWRALSYIERAAYLHKVADILMRDKEKIGAILSKEVAKGYKSAVSEVVRTAEIINYAAEEGLRMEGEVLEGGSKKKIAVVRREPVGLVLAISPFNYPVNLAGSKIAPALIAGNVIAFKPPTQGSISGLLLAEAFAEAGLPAGVFNTITGRGSEIGDYIVEHQAVNFINFTGSTGIGERIGKMAG--MRPIMLELGGKDSAIVLEDADLELTAKNIIAGAFGYSGQRCTAVKRVLVMESVADELVEKIREKVLALTIGNPEDD-ADITPLIDTKSADYVEGLINDANDKGATALTEIKR---EGNLICPILFDKVTTDMRLAWEEPFGPVLPIIRVTSVEEAIEISNKSEYGLQASIFTNDFPRAFGIAEQLEVGTVHINNKTQRGDNFPFLGAKKSGAGIQGVKYSIEAMTTVKSVVFD.. 473
64 -122.0001ky8_A mol:protein length:501 glyceraldehyde-3-phosphate dehydrogenase  ali model follow..  28  2.........RAGLLEGVIKEKGGVPVYPSYLAGEWGGS--GQEIEVKSPIDLATIAKVISPSREEVERTLDVLFKRGRSARDMPGTERLAVLRKAADIIERNLDVFAEVLVMNAGKPKSAAVGEVKAAVDRLRLAELDLKKIGGDYIPGDTLETEGLVRREPLGVVAAITPFNYPLFDAVNKITYSFIYGNAVVVKPSISDPLPAAMAVKALLDAGFPPDAIALLNLPG-KEAEKIVADDRVAAVSFTGSTEVGERVVKVGG--VKQYVMELGGGDPAIVLEDADLDLAADKIARGIYSYAGQRCDAIKLVLAERPVYGKLVEEVAKRLSSLRVGDPRDPTVDVGPLISPSAVDEMMAAIEDAVEKGGRVLAGGRRLG--PTYVQPTLVADRVKDMVLYKREVFAPVASAVEVKDLDQAIELANGRPYGLDAAVFGRDVVKIRRAVRLLEVGAIYINDMPRHGGYYPFGGRKKSGVFREGIGYAVEAVTAYKTIVFN.. 491
65 -122.0002jg7_A mol:protein length:510 ANTIQUITIN  ali model follow..  27  21.........................DNPGVYNGSWGG--SGEVITSYCPANNEPIARVTQATLAEYEETVQKTREAWKMWADIPAPKRGEIVRQIGDALRKKIKVLGSLVSLEMGKIYVEGVGEVQEYVDVCDYAVGLSRMIGGPVLPSERPGHALIEQWNPVGLVGIITAFNFPVAVYGWNNAIALTCGNVCLWKGAPTTPLTSVAVTKIVAENNLPGAICSMTCG-GADIGTAMAKDERVDLLSFTGSTHVGKMVAMMVQERFGRKLLELGGNNAIIVFEDADLNLVVPSAVFASVGTAGQRCTTTRRLMLHESVHDAVVERIAKAYKQVRIGDPWDPSTLYGPLHTKQAVDQYLAAIEQAKQQGGTLVCGGKVMDRPGNYVEPTIITGLAHDAPIVHTETFVPILYVLKFKTEEEAFAWNNEVQQGLSSSIFTKDLGRVFRWPKGSDCGIVNVNIPTSAEIGGAFGGEKHTGGGRESGSDSWKQYMRRSTCTIN.. 496
66 -122.0002o2p_A mol:protein length:517 Formyltetrahydrofolate dehydrogenase  ali model follow..  32  31.........................PYQLFIGGEFVDAEGSKTYNTINPTDGSVICQVSLAQVSDVDKAVAAAKEAFENWGKINARDRGRLLYRLADVMEQHQEELATIEALDAGAVYTLALKHVGMSIQTFRYFAGWCDKIQGATIPINQARNLTLTKKEPVGVCGIVIPWNYPLMMLSWKTAACLAAGNTVVIKPAQVTPLTALKFAELTLKAGIPKGVVNILPGSGSLVGQRLSDHPDVRKIGFTGSTEVGKHIMKSCASNVKKVSLELGGKSPLIIFADCDLNKAVQMGMSSVFFNKGENCIAAGRLFVEESIHNQFVQKVVEEVEKMKIGNPLERDTNHGPQNHEAHLRKLVEYCQRGVKEGATLVCGGNQVPRPGFFFQPTVFTDVEDHMYIAKEESFGPIMIISRFGDVDAVLSRANATEFGLASGVFTRDINKALYVSDKLQAGTVFINTYNKTDVAAPFGGFKQSGFGKDLGEAALNEYLRIKTVTFE.. 511
67 -122.0005kf0_A mol:protein length:485 Aldehyde dehydrogenase  ali model follow..  30  6........................DTYPYYLANEAVYA--NTDLEVTDKFSGKVATRVALADAQAIDAAIGAAVDAVKPMRELPAYRRQAVLDHCVARFRERFDELAEALCIEAGKPINDSRGEVTRLIDTFRVASEEAVRIDGEVLNLEAQGYTGYTRRVPIGPCSFISPFNFPLNLAAHKVAPALAAGCPFVLKPASRTPVGALIIAEVLAETNLPKGAFSVLPAHR-DGADLFTTDERFRLLSFTGSPAVGWALKEKAG--KKKVVLELGGNAAAIVDADQQLDYVVDRLAFGAYYQSGQSCIGVQRILVHASLYDTLRDKLVAKTRSLKMGDPKDPSTFVGPMISESESRRLSGWMDAAVAAGAKIIAGGKV---DGAMFEATLLEDVGREQDLYRKEAFGPVAILEKFDRFDDALARVNDSDFGLQAGVFTDSLTHAQRAWDELEVGGVVINDVSFRVDNMPYGGVKDSGLGREGIRYAIEDMTEPRLMVVR.. 477
68 -122.0003b4w_A mol:protein length:495 Aldehyde dehydrogenase  ali model follow..  34  1..................MSDSATEYDKLFIGGKWTKPSTSDVIEVRCPATGEYVGKVPMAAAADVDAAVAAARAAFDNWPSTPPHERAAVIAAAVKMLAERKDLFTKLLAAETGQPPTIIETHWMGSMGAMNYFAGAADKVTWTETRTG-SYGQSIVSREPVGVVGAIVAWNVPLFLAVNKIAPALLAGCTIVLKPAAETPLTANALAEVFAEVGLPEGVLSVVPG-GIETGQALTSNPDIDMFTFTGSSAVGREVGRRAAEMLKPCTLELGGKSAAIILEDVDLAAAIPMMVFSGVMNAGQGCVNQTRILAPRSRYDEIVAAVTNFVTALPVGPPSDPAAQIGPLISEKQRTRVEGYIAKGIEEGARLVCGGGRPEDNGFFIQPTVFADVDNKMTIAQEEIFGPVLAIIPYDTEEDAIAIANDSVYGLAGSVWTTDVPKGIKISQQIRTGTYGINWYAF-DPGSPFGGYKNSGIGRENGPEGVEHFTQQKSVLLP.. 481
69 -122.0005jry_A mol:protein length:485 NAD-dependent aldehyde dehydrogenase  ali model follow..  30  6........................ETYPYYLANAAVYA--NTDLEVTDKYSGKVATRVALADAKAIDAAIGAAVDATKPMRELPAYKRQAVLDHCVARFRERFDELAEALCIEAGKPINDAKGEVTRLIDTFRVASEEAVRIDGEVLNLEAQGYTGYTRRVPIGPCSFISPFNFPLNLAAHKVAPALAAGCPFVLKPASRTPVGALIIGEVLAETDLPKGAFSVLPAHR-DGADLFTTDDRFRLLSFTGSPAVGWALKEKAG--KKKVVLELGGNAAAIVDADQRLDYVVDRLAFGAFYQSGQSCIGVQRILAHADIYDALRDKLIAKTRSLKMGDPKDPSTFVGPMISESESRRLSGWMDAAVAAGAKIVAGGKV---DGAMFEATLLENVGRDQDLYRKEAFGPIAILEKFDRFDDALARVNDSDFGLQAGVFTDSLAHTQQAWDELEVGGVVINDVSFRVDNMPYGGVKDSGLGREGIRYAIEDMTEPRLLVVR.. 477
70 -121.0004pxn_A mol:protein length:525 Uncharacterized protein  ali model follow..  26  6QDPNSMGAFAKEEHQFLAELGLAQRNPGAFACGAWGG--SGPTVTSTSPTNNQVIAEVVEASVHDYEEGMRACFDAAKTWMAIPAPKRGEIVRQIGDALRAKLHHLGRLVSLEMGKILPEGIGEVQEIIDMCDYAVGLSRQLNGSIIPSERPNHMMMEVWNPLGVVGVITAFNFPCAVLGWNACIALVCGNCVVWKGAPTTPLITIAMTKIVEKNNLPGAIFTSFCG-GTEIGQAIALDIRIPLVSFTGSTRAGLMVQQQVSARFGKCLLELSGNNAIIVMDDADIQLAVRSVLFAAVGTAGQRCTTCRRLILHENIYQTFLDQLVEVYKQVRIGDPLEKGTLLGPLHTPASKENFLKGIQTIKSQGGKILFGGSAIESEGNFVQPTIV-EITPSAPVVKEELFGPVLYVMKFQTLKEAIEINNSVPQGLSSSIFTKRPDIIFKGPHGSDCGIVNVNIPTNAEIGGAFGGEKATGGGREAGSDSWKQYMRRATCTIN.. 505
71 -121.0005j6b_A mol:protein length:485 Aldehyde dehydrogenase  ali model follow..  30  6........................ETYPYYLANEAVYA--NAELEVTDKYTGKVATRVALADASAIDAAIAAAVGAQKPLRALPAFRRQAILEHCVARFRERFDELAQALCIEAGKPINDSKGEVTRLIDTFRVAAEESVRIEGGLVNLEAQGYSGYYKRVPIGPCSFISPFNFPLNLAAHKVAPALAAGCPFVLKPASRTPIGALIIGEVLAETDLPKGAFSILPAHR-DGADLFTTDERFKLLSFTGSPTVGWELKKKAG--KKKVVLELGGNAAAIVDADQRLDYVVERLAFGAYYQSGQSCIGVQRIIAHADVYDALREKLIAKTRSLKMGDPKDPATFVGPMISESEARRLAGWMEAAVAAGAKIVAGGKV---DGAMFEATLLEGVGRDQDLYRKEAFGPVALLERFSDFDDALARVNDSDFGLQAGVFTDSLSHAQRAWDELEVGGVVINDVSFRVDNMPYGGVKDSGLGREGIRYAIEDMTELRLMVVR.. 477
72 -121.0004kna_A mol:protein length:495 N-succinylglutamate 5-semialdehyde dehydrogenase  ali model follow..  28  1.......................MAMTELFIDGAWVDG-AGPVFASRNPGTNERVWEGASASADDVERAVASARRAFAAWSALDLDARCTIVKRFAALLVERKEALATMIGRETGKPLWEARTEVASMAAKVDISITAYHERTGEKRAPM-ADGVAVLRHRPHGVVAVFGPYNFPGHLPNGHIVPALIAGNTVVFKPSELAPGVARATVEIWRDAGLPAGVLNLVQGEK-DTGVALANHRQIDGLFFTGSSDTGTLLHKQFGGREIVLALEMGGNNPLVVAEVEDIDAAVHHAIQSAFLSAGQRCTCARRILVPRGAFDRFVARLADVASKITASFDADPQPFMGAVISARAASRLVAAQARLVGLGASPIIEMKQRDPALGFVNAAIL-DVTNVRELPDEEHFGPLAQIVRYTDLDDAIARANDTAFGLSAGLLADDEQAWHTFRRAIRAGIVNWNRTNGASSAAPFGGAGRSGNHRPSAYYAADYCAYPMASVES.. 474
73 -121.0003r31_A mol:protein length:517 Betaine aldehyde dehydrogenase  ali model follow..  33  2.............VMTIATPLKAQPKASHFIDGDYVEDNTGTPFESIFPATGEMIAKLHAATPAIVERAIASAKRAQKEWAAMSPMARGRILKRAADIMRERNDALSTLETLDTGKPIQETIADPTSGADAFEFFGGIASALNGDYIPL--GGDFAYTKRVPLGVCVGIGAWNYPQQIACWKAAPALVAGNAMVFKPSENTPLGALKIAEILIEAGLPKGLFNVIQGDR-DTGPLLVNHPDVAKVSLTGSVPTGRKVAAAAAGHLKHVTMELGGKSPMIVFDDADIESAVGGAMLGNFYSSGQVCSNGTRVFVQKKAKARFLENLKRRTEAMILGDPLDYATHLGPLVSKAQQEKVLSYIEKGKAEGATLITGGGIPNGEGAYVQPTVFADVTDDMTIAREEIFGPVMCVLDFDDEDEVLARANATEFGLAGGVFTADLARAHRVVDGLEAGTLWINTYNLCPVEIPFGGSKQSGFGRENSAAALEHYSELKTVYVS.. 487
74 -121.0004pz2_A mol:protein length:534 ZmALDH  ali model follow..  33  20.DRTTAAGEEKEERGQLLFDVPEIRFTKLFINGSFVDAVSGRTFDTRDPRTGGVIASVAEADKEDVDLAVRAARAAFDHWPRMSGSERGRIMARLADLVEEHAGELAALESLDAGKHPAVTRVDVGNAAGSLRYFAGAADKIHGETLKMP-GQFQGHTLREPLGVAGVIIPWNFPSTMFAVKVAPALAAGCALVVKPAEQTPLSALYLAQLAKQAGVPDGVINVVPGFGPTAGAALASHMDVDMVSFTGSTEVGRLIMKASAENLKPVYLELGGKSPLIVFDDADLDMAVELAVGASFFNKGEACVAASRVYVQERVYDRFEERLAERMRSWVVGDPFDPRADQGPQVDKAQYERVLSYIDHGKREGATLLTGGRPCAGKGYYIEPTVFTNVKEDMIIAKEEIFGPVMCLMKFKTVEEAIARANDTRYGLGAGVVTRDLDVANRVVRSVRAGVVWVNCYFAMGSDCPFGGRKMSGFGKDEGMHALDKYLAVKSVVTP.. 521
75 -121.0005u0l_A mol:protein length:497 N-succinylglutamate 5-semialdehyde dehydrogenase  ali model follow..  26  1.....................MANLTGNVYIDGLWLPG-HGAPFESVQPVTGETVWDGNAASLEDVDAAVREARKAFLAWRRKSLAERQAVIEAFGELLEANKEELAHQIGLETGKPLWESRTEVAAMMGKIPISVKAYNERTGHTESDV-AGGHAVLRHRPHGVVAVFGPYNFPGHLPNGHIVPALLAGNTVVFKPSELTPGVAELTVRLWEKAGLPDGVINLVQG-GSDTGKCLARHSLIDGLFFTGSSTVGHLLHEQFGGQEKILALEMGGNNPLIVQNVSDLDGAVHHALQSAFLSAGQRCTCARRLLVPKGKKDEFLARLVEVAARITVAEDADPQPFMGSVISAEAANQLLKAQAAMLEKGATSLLEMKQLKPDTGLLSPGIVDAT--GIELEDQEFFGPLLTVYRYKGFDEALELANNTRYGLSAGILSDDRKLYNRLVEEVRAGIVNWNRLTGASSAAPFGGVGASGNHRPSAYYAAD-YCAWPMASLE.. 474

FFAS is supported by the NIH grant R01-GM087218-01
1 2 5 9 7 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Godzik A. cd-hit: a fast program for clustering and comparing large sets of protein or nucleotide sequences. Bioinformatics. 2006 May 26;