current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 5xil_A mol:protein length:512 Putative prolyl-tRNA synthetase, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510
# Score Template Links and tools%idFirst GAMGIAAKREENFSAWYIDVITKAEMIEYYDVSGCYIIRPWAYYVWKCVQRFLGGKIEKLGVEDCYFPMFVSRSCLEREKDHIEGFAPEVAWVTRAGDTELEQPVAVRPTSETVMYPYYAKWIRSHRDLPVRLNMWNNVIRWEFSHPTPFIRTREFLWQEGHCAWAKAEECAKEVLEILECYASVYEQLLAVPVVRGRKTEKEKFAGGDYTTTVETFIEAVGRGCQGATSHNLGQNFGKMFDIRFQDPENNEQTLIPWQNSWGLSTRVIGVMIMVHGDNRGMVMPPRVASTQVIIIPVGITKDTTEEARQELLASCWRLESELCEGGVRARCDLRDNYSPGWRFNHWEVKGVPLRVELGPRELAERSLAVAVRHSGARHSVAWDAQTPAAVAALLEDVHAQMYARAKETMETHRVRVTEWTEFVPTLNRKCLILAPWCGAMECENQVKKDSAEESKVAQAQETREDARAPSMGAKTLCIPFEQPEEPAEGHECICKGCTKPATTWVLFGRSYLast
1 -157.0005xil_A mol:protein length:512 Putative prolyl-tRNA synthetase  ali model  100  1GAMGIAAKREENFSAWYIDVITKAEMIEYYDVSGCYIIRPWAYYVWKCVQRFLGGKIEKLGVEDCYFPMFVSRSCLEREKDHIEGFAPEVAWVTRAGDTELEQPVAVRPTSETVMYPYYAKWIRSHRDLPVRLNMWNNVIRWEFSHPTPFIRTREFLWQEGHCAWAKAEECAKEVLEILECYASVYEQLLAVPVVRGRKTEKEKFAGGDYTTTVETFIEAVGRGCQGATSHNLGQNFGKMFDIRFQDPENNEQTLIPWQNSWGLSTRVIGVMIMVHGDNRGMVMPPRVASTQVIIIPVGITKDTTEEARQELLASCWRLESELCEGGVRARCDLRDNYSPGWRFNHWEVKGVPLRVELGPRELAERSLAVAVRHSGARHSVAWDAQTPAAVAALLEDVHAQMYARAKETMETHRVRVTEWTEFVPTLNRKCLILAPWCGAMECENQVKKDSAEESKVAQAQETREDARAPSMGAKTLCIPFEQPEEPAEGHECICKGCTKPATTWVLFGRSY 512
2 -141.0004hvc_A mol:protein length:519 Bifunctional glutamate/proline--tRNA ligase  ali model follow..  56  13TRLGLEAKKEENLADWYSQVITKSEMIEYHDISGCYILRPWAYAIWEAIKDFFDAEIKKLGVENCYFPMFVSQSALEKEKTHVADFAPEVAWVTRSGKTELAEPIAIRPTSETVMYPAYAKWVQSHRDLPIKLNQWCNVVRWEFKHPQPFLRTREFLWQEGHSAFATMEEAAEEVLQILDLYAQVYEELLAIPVVKGRKTEKEKFAGGDYTTTIEAFISASGRAIQGGTSHHLGQNFSKMFEIVFEDPKIPGEKQFAYQNSWGLTTRTIGVMTMVHGDNMGLVLPPRVACVQVVIIPCGITNALSEEDKEALIAKCNDYRRRLLSVNIRVRADLRDNYSPGWKFNHWELKGVPIRLEVGPRDMKSCQFVAVRRDTGEKLTVAENEAETKL-QAILEDIQVTLFTRASEDLKTHMVVANTMEDFQKILDSGKIVQIPFCGEIDCEDWIKKTTARDQ--------DLEPGAPSMGAKSLCIPFKPLCELQPGAK--CVCGKNPAKYYTLFGRSY 513
3 -140.0005f9y_A mol:protein length:511 Aminoacyl-tRNA synthetase  ali model follow..  49  8SLLGITADKITSFADWYSQVIVKSEMIEYYDISGCYILRPWSYFIWETIQSVFDQKIKQHDVQNAYFPIFVTQKKLETEKDHVEGFSPEVAWVTKSGKSDLAEPIAIRPTSETIMYPYFAKWIRSHRDLPLKINQWTSIVRWEFKHPTPFIRTREFLWQEGHTAHSTRKEALEMVDIILNEYASIYEDLLATPVVKGTKSENEKFPGGDITKSIEGFIPEIGRAVQAATSHLLGQNFSKMFGVEFEDEKGNKE--YAHQTSWGLTTRAIGVMIMTHGDNKGLVLPPKVAPVQVIIIPIIFKTVI----TEEQKKICNEVECILKKAGVRVKIDDRSNYTPGWKYNHWEVKGVCLRFEVGPRDIEKRSVRVVVRDNMEKMDIPISELESKI-PKLLEEFQNRLLFKAKQRQNESIIRVDTFDKVMDTLNQKKMVIAPWCEDVSCEEEIKKETARLSLD------NEDNQSMTGAMKSLCIPNDQIFKIEE-GKTKCFFCDKLAKKFTLFGRSY 505
4 -140.0004k86_A mol:protein length:535 Proline--tRNA ligase  ali model follow..  56  29TRLGLEAKKEENLADWYSQVITKSEMIEYHDISGCYILRPWAYAIWEAIKDFFDAEIKKLGVENCYFPMFVSQSALEKEKTHVADFAPEVAWVTRSGKTELAEPIAIRPTSETVMYPAYAKWVQSHRDLPIKLNQWCNVVRWEFKHPQPFLRTREFLWQEGHSAFATMEEAAEEVLQILDLYAQVYEELLAIPVVKGRKTEKEKFAGGDYTTTIEAFISASGRAIQGGTSHHLGQNFSKMFEIVFEDPKIPGEKQFAYQNSWGLTTRTIGVMTMVHGDNMGLVLPPRVACVQVVIIPCGITNALSEEDKEALIAKCNDYRRRLLSVNIRVRADLRDNYSPGWKFNHWELKGVPIRLEVGPRDMKSCQFVAVRRDTGEKLTVAENEAETKL-QAILEDIQVTLFTRASEDLKTHMVVANTMEDFQKILDSGKIVQIPFCGEIDCEDWIKKTTARDQ--------DLEPGAPSMGAKSLCIPFKPLCELQPGAK--CVCGKNPAKYYTLFGRSY 529
5 -138.0005xif_A mol:protein length:500 Prolyl-tRNA synthetase (ProRS)  ali model follow..  52  2..AMVTAKKDENFSEWYTQAIVRSEMIEYYDISGCYIMRPWAFHIWEKVQRFFDDEIKKMGVENSYFPMFVSRHKLEKEKDHVEGFSPEVAWVTHYGDSPLPEKIAIRPTSETIMYPAYAKWIRSHRDLPLKLNQWCSVVRWEFKQPTPFLRTREFLWQEGHTAHATEEEAWELVLDILELYRRWYEECLAVPVIKGEKSEGEKFAGGKKTTTVEAFIPENGRGIQAATSHLLGTNFAKMFEIEFEDEEGHKR--LVHQTSWGCTTRSLGVMIMTHGDDKGLVIPPRVASVQVVIIPILFKDEN----TGEILGKCRELKTMLEKADIRVRIDDRSNYTPGWKYNHWEVKGVPLRLELGPKDLAKGTARVVRRDTGEAYQISWADLAPKL-LELMEGIQRSLFEKAKARLHEGIEKISTFDEVMPALNRKHLVLAPWCEDPESEEQIKKETQKLSEIQAIEA-GDSEQVMTGAMKTLCIPFDQPPMP---EGTKCFYTGKPAKRWTLWGRSY 500
6 -138.0004ncx_A mol:protein length:506 Proline--tRNA ligase  ali model follow..  47  4NILGITSKKIENFSDWYTQVIVKSELIEYYDISGCYILRPAAYYIWECVQAFFNKEIKKLNVENSYFPLFVTKNKLEKEKNHIEGFSPEVAWVTKYGDSNLPEEIAIRPTSETIMYSVFPKWIRSYRDLPLKLNQWNTVVRWEFKQPTPFIRTREFLWQEGHTAHKNEEEAVKLVFDILDLYRRWYEEYLAVPIIKGIKSEGEKFGGANFTSTAEAFISENGRAIQAATSHYLGTNFAKMFKIEFEDENEVKQ--YVHQTSWGCTTRSIGIMIMTHGDDKGLVLPPNVSKYKVVIVPIFYKTTD----ENAIHSYCKDIEKILKNAQINCVYDDRASYSPGYKFNHWELRGIPIRIEVGPKDLQNNSCVIVRRDNNEKCNVKKESVLLET-QQMLVDIHKNLFLKAKKKLDDSIVQVTSFSEVMNALNKKKMVLAPWCEDIATEEEIKKETQRLSL-----NQTNSETTLSGAMKPLCIPLDQPPM---PPNMKCFWSGKPAKRWCLFGRSY 500
7 -136.0005xip_A mol:protein length:498 Prolyl-tRNA synthetase, putative  ali model follow..  53  1GAMGVTAKKSTNFADWYTQVIVRGELVEYYDISGCYIIRPWAYRIWEAVQKFFDDGIKRLGVENCYFPMFVSQAKLEKEKDHVEGFKPEVAWVTHYGDSELPEKVAIRPTSETIMYPAYAKWIRSHRDLPLKLNQWNNVVRWEFKQPTPFLRTREFLWQEGHTAHATEEEAYTLVLEILELYRQWYEDYLAVPVIKGEKSENEKFAGGKKTTTIEGIIPDTGRGIQAATSHLLGQNFSRMFSIEFEDEKGAKQLV--HQTSWGCTTRSLGVMIMTHGDDKGLVLPPRVVAVQAVIIPIIFKETG----GMEIVAKCRELERLLNAAGVRVKVDDRTNYTPGWKFNDWELKGVPLRLEIGPRDVESCQTRVVRRDTSEARNVPWAEAASTI-PAMLETMQKDLFNKAKAKFEASIEQITTFDEVMPALNRRHVVLAPWCEDPETETQIKRETQRLSEIQARE----NADGMTGAMKPLCIPFDQPPMP---EGTRCFFTGRPAKRWCLFGRSY 498
8 -127.0001h4q_A mol:protein length:477 PROLYL-TRNA SYNTHETASE  ali model follow..  42  2AKEKGLTPQSQDFSEWYLEVIQKAELADYGPVRGTIVVRPYGYAIWENIQQVLDRMFKETGHQNAYFPLFIPMSFLRKEAEHVEGFSPELAVVTHAGGEELEEPLAVRPTSETVIGYMWSKWIRSWRDLPQLLNQWGNVVRWEMR-TRPFLRTSEFLWQEGHTAHATREEAEEEVRRMLSIYARLAREYAAIPVIEGLKTEKEKFAGAVYTTTIEALMKD-GKALQAGTSHYLGENFARAFDIKFQDRDLQVK--YVHTTSWGLSWRFIGAIIMTHGDDRGLVLPPRLAPIQVVIVPIYKDESR-----ERVLEAAQGLRQALLAQGLRVHLDDRDQHTPGYKFHEWELKGVPFRVELGPKDLEGGQAVLASRLGGKE-TLPLAALPEAL-PGKLDAFHEELYRRALAFREDHTRKVDTYEAFKEAVQEG-FALAFHCGDKACERLIQEET---------------------TATTRCVPFEAEP-----EEGFCVRCGRPSAKRVVFAKAY 477
9 -126.0003ial_A mol:protein length:518 Prolyl-tRNA synthetase  ali model follow..  27  12......TKTRDTFADWFDAIMDAAELVDRYPVKGCVVFRPYGFFMENAIMRLCEEEYAKVGISQILFPTVIPESFLKKESDHIKGFEAECFWVEKGGLQPLEERLALRPTSETAIYSMFSKWVRSYKDLPLKIHQTCTIFRHETKNTKPLIRVREIHWNEAHCCHATAEDAVSQLSDYWKVIDTIFSDELCFKGQKLRRVCWDRFPGADYSEVSDVVM-PCGRVLQTAGIHNLGQRFSSTFDILYANKANESVHPYL--TCAGISTRVLACALSIHGDSGGLVLPPLIAPIHVVIIPIGCGKKNNQESDQQVLGKVNEIADTLSKLGLRVSIDDDFSKSMGDKLYYYELKGVPLRIEVGQRDLANGQCIVVPRDVGKDQVIPITEVMKVSIKDELDAYKARLKEKAFAFHNSMVTNCKSFDEIVACIENKGLARFPFYTTEADGEVWDKKLKDA-----------------CSAEIRGHNPDENVL----PGEVCALSGKPAVCYMYCAKSY 512
10 -119.0001nj1_A mol:protein length:501 Proline-tRNA Synthetase  ali model follow..  32  28......GEKMTEFSEWFHNILEEAEIIDRYPVKGMHVWMPHGFMIRKNTLKILRRILDR-DHEEVLFPLLVPEDELAKEAIHVKGFEDEVYWVTHGGLSKLQRKLALRPTSETVMYPMFALWVRSHTDLPMRFYQVVNTFRYETKHTRPIRVREITTFKEAHTIHATASEAEEQVERAVEIYKEFFNSLGI-PYLITRRPPWDKFPGSEYTVAFDTLM-PDGKTLQIGTVHNLGQTFARTFEIKFETPEGDHEYVHQ--TCYGLSDRVIASVIAIHGDESGLCLPPDVAAHQVVIVPIIFKKAA-----EEVMEACRELRSRLEAAGFRVHLDDRDI-RAGRKYYEWEMRGVPLRVEIGPRDLEKGAAVISRRDTGEKVTADLQGIEETL-RELMKDILENLRTRAWERMESEIREAETLEEASRIVDEKRIISFMWCGEEECGMDVEEKV---------------------RVDILGIQEEGSG--------TCINCGREAPYRAYLARTY 495
11 -105.0001nj8_A mol:protein length:459 Proline-tRNA Synthetase  ali model follow..  30  1......GSHMLEFSEWYSDILEKAEIYDRYPIKGCGVYLPYGFKIRRYTFEIIRNLLDESGHDEALFPMLIPEDLLAKEAEHIKGFEDEVYWVTHGGKTQLDVKLALRPTSETPIYYMMKLWVKVHTDLPIKIYQIVNTFRYETKHTRPLIRLREIMFKEAHTAHSTKEEAENQVKEAISIYKKFFDTLGI-PYLISKRPEWDKFPGAEYTMAFDTIF-PDGRTMQIATVHNLGQNFSKTFEIIFETPTGDKDYAYQ--TCYGISDRVIASIIAIHGDEKGLILPPIVAPIQVVIVPLIFKGKE-----DIVMEKAKEIYEKL-KGKFRVHIDDR-DIRPGRKFNDWEIKGVPLRIEVGPKDIENKKITLFRRDTMEKFQVDETQLMEVV-EKTLNNIMENIKNRAWEKFENFITILEDIDEIKNILEKRGVILVPFKEEIYNEELEEKV----------------------EATILGETEYK--------GNKYIAIA----------KTY 459
12 -80.8002i4l_A mol:protein length:458 Proline-tRNA ligase  ali model follow..  19  27ENPKEAEIVSHR-------LMLRAGMLR-QEAAGIYAWLPLGHRVLKKIEQIVREEQNRAGAIELLMPTLQLAD-LWRESGRYDAYGPEMLRIADRHKRE----LLYGPTNEEMITEIFRAYIKSYKSLPLNLYHIQWKFRDEQRPRFGVMRGREFLMKDAYSFDVDEAGARKSYNKMFVAYLRTFARMGLKAIPMRAETGPIGGDLSHEESEVPEANRLNTRGIEVGQIFYFGTKYSDSMKANVTGPDGTDAPIHGGSYGVGVS-RLLGAIIEACHDDNGIIWPEAVAPFRVTILNLKQGD-------AATDAACDQLYRELSAKGVDVLYDDTDQ-RAGAKFATADLIGIPWQIHVGPRGLAEGKVELKRRSDGARENLALADVVARLT......................................................................................................................... 452
13 -76.9002j3l_A mol:protein length:572 PROLYL-TRNA SYNTHETASE  ali model follow..  16  8..IPTLREVPNDAEVLSHQILLRAGYI-RQVAAGIYSYLPLANRVLEKLKTIMREEFEKIDAVEMLMPALLPAE-LWKESGRYETYGPNLYRLKDRNDRD----YILGPTHEETFTELIRDEINSYKRLPLNLYQIQTKYRDEKRSRSGLLRGREFIMKDGYSFHADEASLDQSYRDYEKAYSRIFERCGL-EFRAIIGDGGAMGGKDSKEFMAISEIGEDTKGIEIGHIFKLGTRYSDAMGATVLDENGREKSVIMGCYGIGVS-RLLSAIVEQNADERGINWPTGIAPFDLHVVQMNVKD-------EYQTKLSQEVEAMMTEAGYEVLVDDR-NERAGVKFADADLIGCPIRITVGKKAVD-GVVEVKIKRTGEMLEVRKEELESTL-SILMNTTSEV............................................................................................................... 571
14 -76.8004p3n_A mol:protein length:415 Threonine--tRNA ligase, cytoplasmic  ali model follow..  14  1..MGSSSSGDHRKIGRDQELYFFHEL-----SPGSCFFLPKGAYIYNALIEFIRSEYRKRGFQEVVTPNIFNSR-LWMTSGHWQHYSENMFSFEVE-----KELFALKPMNCPGHCLMFDHRPRSWRELPLRLADFGVLHRNELSGATGLTRVRRFQQDDAHIFC-AMEQIEDEIKGCLDFLRTVYSVFGFSFKLFGEKWELNSGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLTYVSHDGDDRPVIVHRAILGSVERMIAILTENYGGK----WPFWLSPRQVMVVPVG----------PTCDEYAQKVRQQFHDAKFMADIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKISGTVNIRTRDNKVHGERTISETIERLQQLKEFRSKQ................................................................................................................ 404
15 -74.9004hwt_A mol:protein length:413 Threonine--tRNA ligase, cytoplasmic  ali model follow..  14  2.......ARDHRKIGRDQELYFFHEL-----SPGSCFFLPKGAYIYNALIEFIRSEYRKRGFQEVVTPNIFNSR-LWMTSGHWQHYSENMFSFEVE-----KELFALKPMNCPGHCLMFDHRPRSWRELPLRLADFGVLHRNELSGATGLTRVRRFQQDDAHIFC-AMEQIEDEIKGCLDFLRTVYSVFGFSFKLFGEKWELNSGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLTYVSHDGDKRPVIVHRAILGSVERMIAILTENYGGK----WPFWLSPRQVMVVPVG----------PTCDEYAQKVRQQFHDAKFMADIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKISGTVNIRTRDNKVHGERTISETIERLQQLKEFRSKQ................................................................................................................ 400
16 -72.0003a31_A mol:protein length:471 Probable threonyl-tRNA synthetase 1  ali model follow..  16  14YELDITVKPDSRVPVFNREFATFTG-------AGVPLFSLGGGPIRYALAEVLAKFHARRGYYVVETPIIASTE-LFKVSGHIEFYRNNMYLFDIE-----GHEFAVKPMNCPYHILLFLNEVASKLPLPFKVFEFGRVHRYEPSGSYGLLRVRGFTQDDAHIIV-PGGRVIDVVYDVFEEMKLVLERLFKL-EKYGIDIVELEGEAAFYGPKLDFIEESGVSKEWQMGTIQFDFNLPRRFRLYDVVREEIEEVYIIHRALLGSIERFLGVYLEHRRGR----MPFTLAPIQFAVIAV----KTGGEVDREIEDLASSIAKGLLDKGFRVAVKGSSKTGLSSDVRHIESTAKPAVVFIGAKEVREKVLDVRVFDLESMKRRRLAIAYGDAADAVENLAAV................................................................................................................ 445
17 -71.9005ucm_A mol:protein length:579 Proline--tRNA ligase  ali model follow..  19  10..LSTLKETPADAVVISHQLLLRAGMI-RRLASGLYTWLPMGLRVLRKVETIVREEMNAAGALEVLMPAVQPAE-LWQESGRWEQYGPELLRLKDRHERE----FCVGPTHEEVITDLARNELNSYKQLPINFYQIQTKFRDEIRPRFGLMRGREFIMKDAYSFHLSQDSLQQTYDGMYQAYSKIFSRLGLDFRPVQADNGSIGGSGSHYAANIEKAELVIKRGIEVGHIFQLGTKYSEAMKLSVLSEQGKPVNLIMGCYGIGVS-RVVAAAIEQNHDERGILWPSALAPFQIALVPLKYET-------ESVKQATDKLYAELTAAGFEVLLDDRDKKSPGVKFADMELIGIPHRIVISDRGLSEGVLEYKGRRDSESQNLPIGELMSFITEKLSR.................................................................................................................... 573
18 -69.7004hwo_A mol:protein length:411 Threonine--tRNA ligase  ali model follow..  15  2.......ARDHRKIGKQLDLYHMQEE-----APGMVFWHNDGWTIFRELEVFVRSKLKEYQYQEVKGPFMMDRV-LWEKTGHWDNYKDAMFTTSSE-----NREYCIKPMNCPGHVQIFNQGLKSYRDLPLRMAEFGSCHRNEPSGSHGLMRVRGFTQDDAHIFC-TEEQIRDEVNGCIRLVYDMYSTFGFEKIVVKLSTRPEKGEGAFYGPKIEFTLYDCLDRAWQCGTVQLDFSLPSRLSASYVGEDNEKVPVMIHRAILGSMERFIGILTEEFAGF----FPTWLAPVQVVIMNIT----------DSQSEYVNELTQKLSNAGIRVKADLRNE-KIGFKIREHTLRRVPYMLVCGDKEVESGKVAVRTRRGKDLGSMDVNEVIEKLQQEIRSRSLKQLEE............................................................................................................ 403
19 -67.4001nyq_A mol:protein length:645 threonyl-tRNA synthetase 1  ali model follow..  15  233QMLEERKERDHRKIGKELELF----TNSQLVGAGLPLWLPNGATIRREIERYIVDKEVSMGYDHVYTPVLANVD-LYKTSGHWDHYQEDMFPPM---QLDETESMVLRPMNCPHHMMIYANKPHSYRELPIRIAELGTMHRYEASGASGLQRVRGMTLNDSHIFV-RPDQIKEEFKRVVNMIIDVYKDFGFEDYSFGLSYEEAIGEAAFYGPKLDVQVKTAMGKEETLSTAQLDFLLPERFDLTYIGQDGEHRPVVIHRGVVSTMERFVAFLTEETKGA----FPTWLAPKQVQIIPVN---------VDLHYDYARQLQDELKSQGVRVSIDDRNE-KMGYKIREAQMQKIPYQIVVGDKEVENNQVNVRQYGSQDQETVEKDEFIWNLVDEIRLK................................................................................................................... 642
20 -67.1003ugq_A mol:protein length:460 Threonyl-tRNA synthetase, mitochondrial  ali model follow..  15  21NASSATPATMTSMVSQRQDLFMTDPL-----SPGSMFFLPNGAKIFNKLIEFMKLQQKKFGFNEVVTPLIYKKT-LWEKSGHWENYADDMFKVETTDEEK--EEYGLKPMNCPGHCLIFGKKDRSYNELPLRFSDFSPLHRNEASGASGLTRLRKFHQDDGHIFC-TPSQVKSEIFNSLKLIDIVYNKIFPFVKGGGKPWKLNPGDGAFYGPKLDIMVTDHLRKTHQVATIQLDFQLPERFDLKFKDQDNSKRPIMIHRATFGSIERFMALLIDSNEGR----WPFWLNPYQAVIIPVNTKNVQQLDMCTALQKADDMEPVPLNDWHFNVDLDIRNE-PVGYRIKSAILKNYSYLIIVGDEEVQLQKYNIRERDNRKSEKLTMSQIWEKFIELEKNY................................................................................................................... 453
21 -62.4001qf6_A mol:protein length:642 THREONYL-TRNA SYNTHETASE  ali model follow..  16  234QRLEEAAKRDHRKIGKQLDLYHMQEE-----APGMVFWHNDGWTIFRELEVFVRSKLKEYQYQEVKGPFMMDRV-LWEKTGHWDNYKDAMFTTSSE-----NREYCIKPMNCPGHVQIFNQGLKSYRDLPLRMAEFGSCHRNEPSGSHGLMRVRGFTQDDAHIFC-TEEQIRDEVNGCIRLVYDMYSTFGFEKIVVKLSTRPEKGEGAFYGPKIEFTLYDCLDRAWQCGTVQLDFSLPSRLSASYVGEDNEKVPVMIHRAILGSMERFIGILTEEFAGF----FPTWLAPVQVVIMNIT----------DSQSEYVNELTQKLSNAGIRVKADLRNE-KIGFKIREHTLRRVPYMLVCGDKEVESGKVAVRTRRGKDLGSMDVNEVIEKLQQEIRSRSLKQLEE............................................................................................................ 642
22 -44.9001b76_A mol:protein length:442 Glycine--tRNA ligase  ali model follow..  13  1.....AASSLDELVALCKRRGFIFQSSEYGGLQGVYDYGPLGVELKNNLKQAWWRRNERDDMEGLDASVLTHRL-VLHYSGHEATFADPMVDNAKARYGGRGLLAYLRPETAQGIFVNFKNVLDATSKLGFGIAQIGKAFRNEITPRNFIFRVREFEQMEIEYF-VRPGEDEYWHRYWVEERLKWWQEMGLSRENLVPYQQPPESSAHYAKATVDILYRFPHGSLELEGIFDLGSHTKDQEAAYRDPETGKWFVPYVIEPSAGVDRGVLALLAEAFTREE-LKLKPQLAPIKVAVIPL-------VKNRPEITEYAKRLKARLLALGLGRVLYEDTG-NIGKAYRRHDEVGTPFAVTVDYDTIGQSTVTVRDRDTMEQIRLHVDELEGFLRERL...................................................................................................................... 440
23 -39.1002cim_A mol:protein length:522 SERYL-TRNA SYNTHETASE  ali model follow..  16  183NLLWQREPMEHPFKEDPTQAMMKEGWLKRGSSRGQWIHGPQSARIFRTFEKIVLEELEPLGYREMIFPKLVTWEVW-MKSGHAKGVYPEIYYVCPPQTRDPDYIGGMCYAQCPPFWMYVAGETLPNEEIPVKVFDRGTSHRYESGGIHGIERVDEFHRIEIVWI-GTKEEVLKCAEELHDRYMHIFNDILDIEWRKQEGLLGLAEENTVGTTDYEACLPPDGEWLEFQNVSINGDKYPKGFNVKLQSGD----ELWSGCSGVGL-ERWAAVFLAQKGLDPA-NWP---EEFRNRVGEM...................................................................................................................................................................................................................... 509
24 -37.1001ati_A mol:protein length:505 GLYCYL-TRNA SYNTHETASE  ali model follow..  12  1.........AASSLDELVALCKRRGFI-YGGLQGVYDYGPLGVELKNNLKQAWWRRNERDDMEGLDASVLTHRL-VLHYSGHEATFADPMVDNRITKKGGRGLLAYLRPETAQGIFVNFKNVLDATSRLGFGIAQIGKAFRNEITPRNFIFRVREFEQMEIEYFVRP-GEDEYWHRYWVEERLKWWQEMGLSRENLVPYQQPPESSAHYAKATVDILYRFPHGSLEEGIAQRTDFDLGSHTKDQRDPETGKWFVPYVIEPSAGVDRGVLALLAEAFTREE-LKLKPQLAPIKVAVIPL-------VKNRPEITEYAKRLKARLLALGLGRVLYEDTG-NIGKAYRRHDEVGTPFAVTVDYDTIGQSTVTVRDRDTMEQIRLHVDELEGFLRERL...................................................................................................................... 503
25 -35.7002pme_A mol:protein length:693 Glycyl-tRNA synthetase  ali model follow..  14  55.ELALQPKDDIVDRAKMEDTLKRRFFY-YGGVSGLYDFGPVGCALKNNIIQTWRQHFQEEQILEIDCTMLTPEP-VLKTSGHVDKFADFMVKDVKNGEGGNMPGYLRPETAQGIFLNFKRLLEFNQGKLPFAAAQIGNSFRNEISPRSGLIRVREFTMAEIEHFVDPSEKDHPKFQNVADLHLYLYSAKAYKKDAKLVMEYLAICDECYITEMEMLLNEKGEFTIETEGKTFQLTKDMINVKRFQKTLYVEEVVPNVIEPSFGLGRIMYTVFEHTFHVREGFSFPAVVAPFKCSVLPLSQN--------QEFMPFVKELSEALTRHGVSHKVDDSSG-SIGRRYARTDEIGVAFGVTIDFDTVNKTTATLRDRDSMRQIRAEISELPSIVQDLANGNITADVEARYPLFEGQETGKKETIEELE........................................................................................ 687
26 -34.8003qne_A mol:protein length:485 Seryl-tRNA synthetase, cytoplasmic  ali model follow..  12  144AATGAPAKLSHHEVLLRLDGYDPERGVR-IVGHRGYFLRNYGVFLNQALINYGLSFLSSKGYVPLQAPVMMNKE-VMAKTAQLSQFDEELYKVI----DGEDEKYLIATSEQPISAYHAGEWFSPAEQLPVRYAGYSSCFRREAKDAWGIFRVHAFEKIEQFVL-TEPEKSWEEFDRMIGCSEEFYQSLGLPYRVVGIVSG-ELNNAAAKKYDLEAWFPFQQEYKELVSCSNCTDYQSRNLEIRCGQNQQEKKYVHCLNSTLSATERTICCILENYQKEDGLVIPEVLRKY---------------PGEPEFIPYIKELPKNTTSVKKAKGKNPKNT-TSVKKAKGKNGSR................................................................................................................................................................. 479
27 -30.4004h2w_A mol:protein length:346 Amino acid--[acyl-carrier-protein] ligase 1  ali model follow..  14  17IAVLPNSPDTAPQIADPLDHLADKLFH-SMGSDGVYARTALYESIVERLAALITS-HREAGTEALRFPPVMSRAQL-EKSGYLKSFPNLLGCVCGLHGTEREADLVLSPAACYPVYPIAASRGPL-PKGGLRFDVAADCFRRE--PSKHLDRLQSFRMRE-YVCIGTPDDVSDFRERWMVRAQAIARDLGLTFRVDAGKMLANNQRDQQLKFELLIPLRSEEQPTACMSFNYHREHFGTTWGIQDANGE----PAHTGCVAFGM-DRLAVAMFHTHGTDLS-AWPAKVRDI............................................................................................................................................................................................................................. 323
28 -30.2003mey_A mol:protein length:346 Bll0957 protein  ali model follow..  14  17IAVLPNSPDTAPQIADPLDHLADKLFH-SMGSDGVYARTALYESIVERLAALITS-HREAGTEALRFPPVMSRAQL-EKSGYLKSFPNLLGCVCGLHGTEREADLVLSPAACYPVYPIAASRGPL-PKGGLRFDVAADCFRRE--PSKHLDRLQSFRMRE-YVCIGTPDDVSDFRERWMVRAQAIARDLGASDPFFGRVGQMKAVSQKQQQLKFELLLRSEEQPTACMSFNYHREHFGTTWGIQDANGE----PAHTGCVAFGM-DRLAVAMFHTHGTDLS-AWPAKVRDI............................................................................................................................................................................................................................. 323
29 -27.4005c51_B mol:protein length:485 DNA polymerase subunit gamma-2, mitochondrial  ali model follow..  57....PEAPGSGEGSEALLEICQRRHFLSGSLSGCHPGFGPLGVELRKNLAAEWWTSVVVFREQVFPV-LHHKPGPLLPGDSAFRLVSAETLQLVAFLENVLKTSGKLRENLLHGALEHYVNCLDLVNRLPYGLAQIGVCFHPVFDTKQIVKSIGEKTEASLVWF-TPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNKLYYNF--KELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQLTENLKLHPCLAPIKVALDVGRGPT-------LELRQVCQGLFNELLENGISVGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSA................................................................................................................... 482
30 -27.1002g4c_A mol:protein length:474 DNA polymerase gamma subunit 2  ali model follow..  40....PEAPGSGEGSEALLEICQRRHFLSGSKSGCHPGFGPLGVELRKNLAAEWWTSVVVFREQVFPV-LHHKPGPLLPGDSAFRLVSAETLREILQDKNVLKTSGKLRENLLHGALEHYVNCLDLVNRLPYGLAQIGVCFHPVFDTKQGVKSIGEKTEASLVWF-TPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNKLYYNF--KELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQLTENLKLHPCLAPIKVALDVGRGPT-------LELRQVCQGLFNELLENGISVGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSA................................................................................................................... 465
31 -26.8004ztu_B mol:protein length:472 DNA polymerase subunit gamma-2, mitochondrial  ali model follow..  33....PEAPGSGEGSEALLEICQRRHFLSGSLSGCHPGFGPLGVELRKNLAAEWWTSVVVFREQVFPV-LHHKPGPLLPGDSAFRLVSAETLREILQDKNVLKTSGKLRENLLHGALEHYVNCLDLVNRLPYGLAQIGVCFHPVFDTKNGVKSIGEKTEASLVWF-TPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNKLYYNF--KELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQLTENLKLHPCLAPIKVALDVGRGPT-------LELRQVCQGLFNELLENGISVGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKN................................................................................................................. 460
32 -25.9001g5h_A mol:protein length:454 MITOCHONDRIAL DNA POLYMERASE ACCESSORY SUBUNIT  ali model follow..  10  14...QPDAPEHAVAREALVDLCRRRHFLSGTPLSGCHAFGPLGVELRKNLASQWWSSMVVFREQVFAVDLHQEPGSSQPRDSAFRLVSPESEQLVAFLENLLKTSGKLRATLLHGALEHYVNCLDLVNKLPFGLAQIGVCFHNSNQTPSSVTRVGEKTEASLVWF-TPTRTSSQWLDFWLRHRLLWWRKFAMSPSNFSSADCQDELGRKGSKLYYSF--KEPIETLWNLGDQELLHTYPGNVSTIQGRDGRKNVVPCVLSVSGDVDLGTLAYLYDSFQLAENLKLHPCLAPIKVALDVG-------KGPTVELRQVCQGLLNELLENGISVGYSETVHSSLEQLHSKYDEMSVLFSVLVTETTLENGLIQLRSRDTTMKEMMHISKLRDFLVKYLASASN................................................................................................................. 442
33 -23.5003vbb_A mol:protein length:522 Seryl-tRNA synthetase, cytoplasmic  ali model follow..  14  170................HVDLVVMVDGFEGEKGAVVYFLKGVLVFLEQALIQYALRTLGSRGYIPIYTPFFMRKEVM-QEVAQLSQFDEELYKVIGKGSEKSYDEKYLIATSEQPIAALHRDEWLRPEDLPIKYAGLSTCFRQEVRDTRGIFRVHQFEKIEQFVYSSPHNKSWEMFEEMITTAEEFYQSLGIPYHIVNIVSG-SLNHAASKKLDLEAWFPGSGAFRELVSCSNCTDYQARRLRIRYGQTKKMMDKVEFVHMLNATTTRTICAILENYQTEKGITVPEKLKEFLQELIP-KKQKKQHEGSKKKAAARDVTLENRLQNMEVTDALE................................................................................................................................................................................... 516
34 -23.2003ikl_A mol:protein length:459 DNA polymerase subunit gamma-2, mitochondrial  ali model follow..  67EALLEICQRRHFLSGSKQQLSRDSLLSGCHPGFG-----PLGVELRKNLAAEWWTSVVVFREQVFPVDALHHKP-------------------GPLLPGDSAFRGGLRENLLHGALEHYVNCLDLVNRLPYGLAQIGVCFHPVFDTKQIVKSIGEKTEASLVWF-TPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNKLYYNF--KELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQLTENLKLHPCLAPIKVALDVG-------RGPTLELRQVCQGLFNELLENGISVWPGETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSA................................................................................................................... 450
35 -22.8004g85_A mol:protein length:517 Histidine-tRNA ligase, cytoplasmic  ali model follow..  12  65..........................FVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGE----SKLIYDLKDQGGEL----LSLRY-----LTVPFARYLAMNKLTNIKRYHIAKVYRRD-NPAMTRGRYREFYQCDFDIAGNFDPMIPD--AECLKIMCEILSSLQIGDFLVKVNDKLDKVSWEEVKNEMVKLLFEYLTLFGIDDKISFDLSLARIYEAVLLQTPAQAGEEPLGVGSVGRYDGLVGMFDPKGRKVPCVGLSIGVERIFSIVEQRLEALEEKIRTTKKLLEERLKLVSELWDAGIKAELLYKKNPKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRSVTSREEVDVRREDLVEEIKRRTGQPL.................................................................................................................. 517
36 -22.8001wu7_A mol:protein length:434 Histidyl-tRNA synthetase  ali model follow..  11  4..........................LQIEKIRGFRDFYPEDMDVEKFIFKTAEEAAEAFGFRRIDFPSLEYLDLYRIKSG--EELLQQTYSFVDKGGRE----VTLIPEATPSTVRMVTS--RKDLQRPLRWYSFPKVWRYE-EPQAG--RYREHYQFNADIFGSDSPEADAEVIALLGLQDIYEIRINSRKIMEEIIGGMTSSDPFSVFSIIDRYHKISREEFVD-KNVRYDFSIVRGLSFEAYDRSGQFRAILGGGRYDNLASLMSGESVPAVGFGMGDAVISLLLKRENVQIPREKKSVYICRVGKINSSIMNEYSRKLRERGMNVTVE--MERGLSAQLKYASAIGADFAVIFGERDLERGVVTIRNMYTGSQENVGLDSVVEHLISQATLE................................................................................................................... 428
37 -22.5004g84_A mol:protein length:464 Histidine--tRNA ligase, cytoplasmic  ali model follow..  12  8......................LRRQFVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGEDS---KLIYDLKDQGGEL----LSLRY-----LTVPFARYLAMNKLTNIKRYHIAKVYRRD-NPAMTRGRYREFYQCDFDIAGNFDPMIPD--AECLKIMCEILSSLQIGDFLVKVNDRRILDGMFAICGVSDSKFRTICSSVDKLDKV-LDYYTGVIYEAVLLQTPAQAGEEPLGVGSVGRYDGLVGMFDPKGRKVPCVGLSIGVERIFSIVEQRLEALEEKIRTTKKLLEERLKLVSELWDAGIKAELLYKKNPKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRSVTSREEVDVRREDLVEEIKRRTGQPL.................................................................................................................. 464
38 -22.5003w3s_A mol:protein length:527 Type-2 serine--tRNA ligase  ali model follow..  17  180TVVDESGPRRIRFRGDVTEEARRRGWVKEFPGRGQWIYTPPMAALFEVLRDFLLERVRKLGFEPALFPKLIPLETMFR-MRYLHGLPDGMYYVCPPKRDPEDPGYVLAPAQCEPFYELLRDEVVDPERLPIKLYDCGWTYRWEGGAAKGLERVNEFQRIE--VWIAEPEEAYRIRRELLEATKRVAEELELDPFYLEGRLLEDRDIELPDVPSYEFEVSSEEAWISVGSFNVHGEHFVDGFNV----KEKSGRTLFTGCAGLGV-TRWVVGLLAQHGFYPY-EWPEPILER............................................................................................................................................................................................................................. 508
39 -22.5001ser_A mol:protein length:421 PROTEIN (SERYL-TRNA SYNTHETASE (E.C.6.1.1.11))  ali model follow..  14  135................DHVALMEKNGWWEPSGSRSYALKGDLALYELALLRFAMDFMARRGFLPMTLPSYAREKAF-LGTGHFPAYRDQVWAIA-------ETDLYLTGTAEVVLNALHSGEILPYEALPLRYAGYAPAFRSEAKDVRGLMRVHQFHKVEQYVLTEASEASDRAFQELLENAEEILRLLELPYRLVEVATG-DMGPGKWRQVDIEVYLPSEGRYRETHSCSALLDWQARRANLRYRDPEGRVRYAYTLNNTALATPRILAMLLENHQLQDGVRVPQALIPY............................................................................................................................................................................................................................. 411
40 -22.5003hrk_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  12  16.....................MQKNMVETEPVQGCRDFPPEAMRCRRHLFDVFHATAKTFGFEEYDAPVLESEELYIRKAG--EEITEQMFNFITKGGHR----VALRPEMTPSLARLLLGKGRSLL-LPAKWYSIPQCWRYE-AITRG--RRREHYQWNMDIVGVKSVSAEVELVCAAWAMRSLVDAITTTLSLKSIDEIAQRVGEEHEAVKELRQFFEQVEAYGYGDWVLFDASVVRGLAYNLLTTYGSPTPIPCAGFGFGD-CVIVELL------QEKRLLPDIPHVVDDVVIPFD----------ESMRPHALAVLRRLRDAGRSADII--DKKKVVQAFNYADRVGAVRAVLVAPEEWERGEVQVKMLREGTGKEEGGAERGFAVPLDRL..................................................................................................................... 449
41 -22.3003hri_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  13  16.....................MQMNMVETEPVQGCRDFPPETMRLRKYLFDVFHSTARKFGFEEYDSPVLESEELYIRKAG--EEITEQMFNFITKGGHR----VALRPEMTPSLARQLLAKGRSLL-LPAKWYSIPQCWRYE-AITRG--RRREHYQWNMDIIGVKSVSSEVELVCAAGLESNVVDAITSTLSLKTIDEIAQRIGEEHEAVRELRDFITQIEAYGFGDWVIFDASVVRGLAYNLLTTYGSPTAVPCVGFGFGD-CVIVELL------NEKKLLPELHHVVDDLVIPFD----------ETMRPHALSILRRLRDAGRSADIV--DKKKVVQAFNYADRIGALRAVLVAPDEWARGEVRVKMLREGAGREEGANERGIVLPVDKI..................................................................................................................... 449
42 -22.3005c53_B mol:protein length:903 Pol gamma B  ali model follow..  57....PEAPGSGEGSEALLEICQRRHFLSSLLSGCHPGFGPLGVELRKNLAAWWTSVVVFREQVFPVDALHHKPGPLLPGDSAFRKLREN--------------------LLHGALEHYVNCLDLVNKRLPYGLAQIGVCFHPVFDTKQIVKSIGEKTEASLVWF-TPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNKLYYNF--KELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQLTENLKLHPCLAPIKVALDVG-------RGPTLELRQVCQGLFNELLENGISVWPGETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSA--KNVMRSRVAVRACHKVCRCLLSGFGGRVDAGQPELL--ERSSPKGGHVKSHAELEGNGEHPEAPGSGEGSEAL........................................ 521
43 -21.9003err_A mol:protein length:536 fusion protein of microtubule binding domain from mouse cytoplasmic dynein and seryl-tRNA synthetase from Thermus thermophilus  ali model follow..  15  245................HVALMEKNGWWEPRISQRSYALKGDLALYELALLRFAMDFMARRGFLPMTLPSYAREKAF-LGTGHFPAYRDQVWAIA-------ETDLYLTGTAEVVLNALHSGEILPYEALPLRYAGYAPAFRSEAKDVRGLMRVHQFHKVEQYVLTEASLESDRAFQELLENAEEILRLLELPYRLVEVATG-DMGPGKWRQVDIEVYLPSEGRYRETHSCSALLDWQARRANLRYRDPEGRVRYAYTLNNTALATPRILAMLLENHQLQDGVRVPQALIPY............................................................................................................................................................................................................................. 520
44 -21.8001qe0_A mol:protein length:420 Histidine--tRNA ligase  ali model follow..  14  3.............................KIPRGTQDILPEDSKKWRYIENQLDELMTFYNYKEIRTPIFESTDLFARGVGD-DVVQKEMYTFKDKGDRS----ITLRPGTAAVVRSYIEHKMQGNPNQPIKLYYNGPMFRYE-RKQKG--RYRQFNQFGVEAIGAENPSVDAE---VLAMVMHIYQSFGLKHLKLVINSVGDMASRKEYNEALVKHFEPVIHEFCSDCQSRLHTDPMRILDFELMMDNPNYDGAITTLCGGGRYNGLLELLDGPSETGIGFALLDIEENLDLFIVTMG----------DQADRYAVKLLNHLRHNGIKADKD--LQRKIKGQMKQADRLGAKFTIVIGDQELENNKIDVKNMTTGESETIELDALVEYFKK........................................................................................................................ 420
45 -21.4003net_A mol:protein length:465 Histidyl-tRNA synthetase  ali model follow..  14  1.................SNAMAKNDKINFSTPSGFPEFLPSEKRLELYLLDTIRRVYESYGFTPIETPAVERLEVLQAKGNQGDNIQAEKDKSGDTGSEA----RALKFDQTVPLAAYIARHLNDLT-FPFARYQMDVVFRGE-RAKDG--RFRQFRQCDIDVVGREKLSLLYDA-QMPAIITEIFEAVNIGDFVIRINNRKSVDDVLDKLKHLSQTLPESEQFNLGVSELELNYYTGTVYETTLIGHEALGSICSGGRYGVGISTRLISRL-----LKAGILNTLPPTPAQVVVVNMQ----------DELMPTYLKVSQQLRQAGLNVITN--EKRQLGKQFQAADKQGIRFCVIIGADEAAAQKSSLKDLQSGEQVEVALADLAEEIKRRL...................................................................................................................... 464
46 -21.4001wle_A mol:protein length:501 Seryl-tRNA synthetase  ali model follow..  15  182................HLEIAEKLDIIRQKSGHRSYYLRGAGALLQHGLVNFTLNKLIHRGFTPMTVPDLLRGVVF-EGCGMTPNAKPSQIYNIDPSRFE---DLNLAGTAEVGLAGYFMDHSVAFRDLPIRMVCSSTCYRAETKEPWGLYRVHHFTKVEMFGVTGPGEQSSELLEEFLSLQMEILTELGLHFRVLDMPTQ-ELGLPAYRKFDIEAWMPGRGRFGEVTSASNCTDFQSRRLHIMFQTEAGELQFAHTVNATGCAVPRLLIALLESYQQKDGVLVPPALQPY............................................................................................................................................................................................................................. 461
47 -21.4005e3i_A mol:protein length:438 Histidine--tRNA ligase  ali model follow..  13  2........................AMSSIVAIKGFNDVLPTQTAAWRRLEQHLASLMDAYGYQQIRLPIVEQTGLFKRAIGD-DIVEKEMYTFFDKGNPP--ESLTLRPEGTAGCVRALVEH-NLLRGATPRVWYMGPMFRYE-KPQKG--RYRQFHQFGVETFGVATPDIDAE---LIMLTARLWKRMGVDHMVTDERTEYRNALVAFLNEHKDALDEDSQRRLTTNPLRILDSKIETAAGIKFVINQKLVRGLDYYNKTVGSQGTVCA-LVGQLKGKADQSVP-FAMGMERLLLLLEQVEQAEIVRDPAYQSKALVLAEQLRDQLEAANSNIRSQGSMKSQMKKADQAGAVYAIILGEREWEAQQLAVKELATAEQSQVALAELVPFLIEKFTK.................................................................................................................... 432
48 -21.3002dq3_A mol:protein length:425 Seryl-tRNA synthetase  ali model follow..  15  141................HWEIGERLGILDFKSGSRFTVIAGWGARLERALINFMLDLHTKKGYKEICPPHLVKPEIL-IGTGQLPKFEEDLYKCE-------RDNLYLIPTAEVPLTNLYREEILKEENLPIYLTAYTPCYRREAKDIRGIIRQHQFDKVELVKI-VHPDTSYDELEKLVKDAEEVLQLLGLPYRVVELCTG-DLGFSAAKTYDIEVWFPSQNKYREISSCSNCEDFQARRMNTRFKDSKTGKNRFVHTLNGSGLAGRTLAAILENYQQEDGVVVPEVLRDY............................................................................................................................................................................................................................. 416
49 -21.1001v95_A mol:protein length:130 Nuclear receptor coactivator 5  ali model follow..  7................................................................................................................................................................................................................................................................................................GPVDCSVIVVN----------KQTKDYAESVGRKVRDLGMVVDLI-NTEVSLSQALEDVSRGGSPFAIVITQQHQIHRSCTVNIMFGTEHRNMPQADAMVLVARNYERYKNECREKEREE........................................................................................................ 119
50 -21.0004rdx_A mol:protein length:423 Histidine--tRNA ligase  ali model follow..  14  3..........................MTARAVRGTKDLFGKELRMHQRIVATARKVLEAAGALELVTPIFEETQVFEKGVGA-DIVRKEMFTFQDRGGRS----LTLRPEGTAAMVRAYLEHGMKVWPQPVRLWMAGPMFRAE-RPQKG--RYRQFHQVNYEALGSENPILDAE---AVVLLYECLKELGLRRLKVKLSSVGDPEDRARYNAYLREVLSPHREALSEDSKERLELNPMRILDLDFLGEEARAKEVERHLERLSVLDYYVRTAFEVHHEEIGAFGLPEEKGPDLYLIPLT----------EEAVAEAFYLAEALRP-RLRAEYA--APRKPAKGLEEALKRGAAFAGFLGEDELRAGEVTLKRLATGEQVRLSREEVPGYLLQAL...................................................................................................................... 422
51 -20.8003lsq_A mol:protein length:484 Seryl-tRNA synthetase  ali model follow..  13  177................VSIMERLGMMDTSKAGGRSYVLKGGLVQLQVALVSYSLDFLVKRGYTPFYPPFFLNRDVM-GEVAQLSQFDEELYQVSGD-----GDKKYLIATSEMPIAAYHRGRWFTELKEPLKYAGMSTCFRKEARDTLGIFRVHQFDKIEQFVVCSPREESWRHLEDMITTSEEFNKSLGLPYRVVNICSG-ALNNAAAKKYDLEAWFPASGAFRELVSCSNCTDYQSQSVNCRYGPNLRVKEYCHMLNGTLCAITRTMCCICENYQTEEGVVIPDVLRPY............................................................................................................................................................................................................................. 460
52 -20.5002dq0_A mol:protein length:455 Seryl-tRNA synthetase  ali model follow..  16  162................HVDLLEILGGADFASGSRFYYLLNEIVILDLALIRFALDRLIEKGFTPVIPPYMVRRFVE-EGSTSFEDFEDVIYKVE-------DEDLYLIPTAEHPLAGMHANEILDGKDLPLLYVGVSPCFRKEAKDTKGIFRVHQFHKVEQFVY-SRPEESWEWHEKIIRNAEELFQELEIPYRVVNICTG-DLGYVAAKKYDIEAWMPGQGKFREVVSASNCTDWQARRLNIRFRDRTDEKPRYVHTLNSTAIASRAIVAILENHQEEDGVRIPKVLWKY............................................................................................................................................................................................................................. 437
53 -20.1006blj_A mol:protein length:485 Serine-tRNA ligase  ali model follow..  12  185................HIDIMRKLGGLATEGGGRGYFLLGDLVRMNLALQNYAIDFLAKKGYMPIYTPFFMTKEQM-KKVAQLSQFDEELYTVTGE-----GEDKYLIATSEQPIAAFHLEKRFDESELPIKYCGMSTCFRKEVKDTLGIFRVHQFEKIEQFVVTSPKDNSWEMFDEMIGNSEAFYQSLGIPYRVVNIVSG-ALNNAAAKKFDLEAWFPGADEG-ELVSCSNCTDYQTRRLEVKYKKQGSEVEFCHMLNSTLTATSRTLCCIVENYQTPEGVNVPEVLQPY............................................................................................................................................................................................................................. 468
54 -20.0004e51_A mol:protein length:467 Histidine--tRNA ligase  ali model follow..  12  20......................KRKLEKLTGVKGMNDILPQDAGLWEFFEATVKSLLRAYGYQNIRTPIVEHTPLFTRGIGE-DIVEKEMYSFVDALN---GENLTLRPENTAAVVRAAIEH-NMLYDGPKRLWYIGPMFRHE-RPQRG--RYRQFHQVGVEALGFAGPDADAE---IVMMCQRLWEDLGLTGIKLEINSLGLAEERAAHRVELIKYLEQHADKLDDDAQRRLYTNPLRVLDTKVTDKLGAQGTVAAGGRYDPLIEQLGGKPTAACGWAMGIERILELLKEEHLVPEQEGVDVYVVHQGDAAREQAFIVAERLRDTGLDVILADGAGASFKSQMKRADASGAAFAVIFGEDEVTNGTASVKPGEKSVQQSVPVESLTEFLINAMVATAEDG............................................................................................................... 459
55 -19.5002el9_A mol:protein length:431 Histidyl-tRNA synthetase  ali model follow..  13  13.............................QAIRGMNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGE-DVVEKEMYTFEDRNGDS----LTLRPEGTAGCVRAGIEH-GLLYNQEQRLWYIGPMFRHE-RPQKG--RYRQFHQLGCEVFGLQGPDIDAE---LIMLTARWWRALGISEHVLEARANYRDALVAFLEQHKEKLDEDCKRRMYTNPLRVLDSKLLESAGIAYTVNQRLVRGLDYYNRTVGRYDGLVEQLGGRATPAVGFAMFKADPVVDIYLVASG----------ADTQSAAMALAERLRDPGVKLMTN--GGGNFKKQFARADKWGARVAVVLGESEVANGTAVVKDLRSGEQTAVAQDSVAAHLRTLL...................................................................................................................... 430
56 -17.9002lw7_A mol:protein length:170 Histidine--tRNA ligase, cytoplasmic  ali model follow..  17  42...................................................................................................................................................................................................................................................................AQLGPDQKFVLKT------PKALEEKIRTTETQVLVASAQ----------KKLLEERLKLVSELQDAGIKAELLYKKNPKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRSVTSREEVDVRREDLVEEIKRRTGQPLSIS............................................................................................................... 170
57 -16.9004cs2_A mol:protein length:274 PYRROLYSINE--TRNA LIGASE  ali model follow..  10  14...VLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEEREYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGI-------DNDTELSKQIFRVDKNFCLRPMLAPNLANYLRKLDRALPD-PIKIFEIGPCYRKESDGKE---HLEEFTMLNFCQM-----GSGCTRENLESIITDFLNHLGI................................................................................................................................................................................................................................................................................................................................. 186
58 -16.3005k1p_A mol:protein length:274 Pyrrolysine--tRNA ligase  ali model follow..  11  14...VLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEEREYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGI-------DNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPD-PIKIFEIGPCYRKESDGKE---HLEEFTMLAFAQM-----GSGCTRENLESIITDFLNHLGIDFKIV............................................................................................................................................................................................................................................................................................................................ 191
59 -16.0004bw9_A mol:protein length:291 PYRROLYSINE--TRNA LIGASE  ali model follow..  10  27DRLEVLLNPKDEISLNSGKPFRLESELLSRRKKDLQQIYAEEREYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGI-------DNDTELSKQIFRVDKNFCLRPMLAPNLGNYLRKLDRALPD-PIKIFEIGPCYRKESDGKE---HLEEFTMLNFCQM-----GSGCTRENLESIITDFLNHLGI................................................................................................................................................................................................................................................................................................................................. 203
60 -15.6003qtc_A mol:protein length:290 Pyrrolysyl-tRNA synthetase  ali model follow..  11  24DRLEVLLNPKDEISLNSGKPFREESELLSRRKKDLQQIYAEEREYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGI-------DNDTELSKQIFRVDKNFCLRPMLTPNLYNYLRKLDRALPD-PIKIFEIGPCYRKESDGKE---HLEEFTMLVFWQM-----GSGCTRENLESIITDFLNHLGI................................................................................................................................................................................................................................................................................................................................. 200
61 -15.4004q6g_A mol:protein length:267 Pyrrolysine--tRNA ligase  ali model follow..  10  13...VLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEEREYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQI-------FRVDKNFCLRPMVAPNIFNYARKLDRALPD-PIKIFEIGPCYRKESDGKE---HLEEFTMLNFFQM-----GSGCTRENLESIITDFLNHLGIDFKIV............................................................................................................................................................................................................................................................................................................................ 190
62 -15.4003od1_A mol:protein length:400 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  4......................MSKPFMFEKPFGMRDTLPEWYKTKKNICDQMTEEINLWGYDMIETPTLEYYETVGVVSAILD---QQLFKLLDQQGNT----LVLRPDMTAPIARLVASSLKD-RAYPLRLAYQSNVYRAQQNEG----KPAEFEQLGVELIGDGTASADGEVIALMQRADRLRRFLYEKNYVGYREHVKSLNLSTIDKSRLMNLLRGGRAAIEEARGLIQTEKGKTALAYEVLESYGASEYVKFDLTLVLHMSYYTGVVFEGYGNRLGVPLQATGFGVRIDLLVEALNGEIISNGHEQTCFEAIELARKKRANGEAVVLQDLAG-VTDVDAMSSNYQDVIYCIGTAGRGGEDA.................................................................................................................................................. 400
63 -15.4002zni_A mol:protein length:308 Pyrrolysyl-tRNA synthetase  ali model follow..  12  58RAFQGIEHQLMSQGKRHLEQLRTVKHRP----------------ALLELEEKLAKALHQQGFVQVVTPTIITKSALAKMTI-------GEDHPLFSQVFWLDGKKCLRPMLAPNLYTLWRELERLW-DKPIRIFEIGTCYRKESQGAQ---HLNEFTMLNLTELGTPLEERHQRLE---DMARWVLEAAGIREFELVTESS....................................................................................................................................................................................................................................................................................................................... 228
64 -13.8002e3c_A mol:protein length:291 Pyrrolysyl-tRNA synthetase  ali model follow..  13  65....................................IYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGI-------DNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPD-PIKIFEIGPCYRKESDGKE---HLEEFTMLNFCQM-----GSGCTRENLESIITDFLNHLGIDFKIVGDSC........................................................................................................................................................................................................................................................................................................................ 212
65 -13.2006FTT Entity 1(prereleased)  ali follow..  10  5................................DGVADVLFEDAHKQEVLRHQLTQQLITHGYQLVSPPMIEFTESLLSGAS--EDLKRQTFKIIDQLTGRL---MGIRA---DITPQILRIDAHHGGDGIARYCYAGDVIHTLPSGL----GSRTPLQLGAEIFGCESIAADIE---LIDVLFSMINSLDMSA-------------------VLHVDLGHVTIFKRLAELAALSASDTEQLMQLYANKNLPELKQVCQVLPMGSDFYTLARFGHDIAN----------------LLGRLSENAQQDTKIVTAIDELQRLKAHLQVQWCAVSIDVTEHYHTGIVF-NGYINSETQPLVRGGR---DGMKSNQLATNQPRQATGFSMDVSRLLAHTQLDAPFIVLIDYDAFNNLDSAQRQLLLQQVASLRQQGYRVTMPLTAEDMPVGLTHRLS............................................................ 377
66 -13.2005m8h_A mol:protein length:388 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  10  5................................DGVADVLFEDAHKQEVLRHQLTQQLITHGYQLVSPPMIEFTESLLSGAS--EDLKRQTFKIIDQLTGRL---MGIRA---DITPQILRIDAHHGGDGIARYCYAGDVIHTLPSGL----GSRTPLQLGAEIFGCESIAADIE---LIDVLFSMINSLDMSA-------------------VLHVDLGHVTIFKRLAELAALSASDTEQLMQLYANKNLPELKQVCQVLPMGSDFYTLARFGHDIAN----------------LLGRLSENAQQDTKIVTAIDELQRLKAHLQVQWCAVSIDVTEHYHTGIVF-NGYINSETQPLVRGGR---DGMKSNQLATNQPRQATGFSMDVSRLLAHTQLDAPFIVLIDYDAFNNLDSAQRQLLLQQVASLRQQGYRVTMPLTAEDMPVGLTHRLS............................................................ 377
67 -13.1003rac_A mol:protein length:373 Histidine-tRNA ligase  ali model follow..  11  27................................PGMQDGYPDFAKRRRAVETRLLSFVEDAGYEPVTSGLFEYVDTLLRARS--PESSRDWIRLFDGGG----DAVALRPEMTPSIARMAAPRVAA-GRTPIRWCYCERVYRRTDDPAS---KAAESTQVGIERIGEEASVDVD--MDVLRLLHEASAAAGV--------------------RHHRIVVSHARLVPRLLDALGISASLSRAFLACLTSGNYVQFRELWQLHAAKDVDLLANLLTWSPAERDAAKRSREASDRELEALLRDAVDPRAAADVRDAWRYLCRLAEALHDSGLVVTFDLA-DYYTGLVF-EMFAPGVGAPIAQGGR-------ELLAQFGAGAPAVGFAFEVERVMAVLEAQ................................................................................................................... 366
68 -12.8004tqd_A mol:protein length:291 Pyrrolysine--tRNA ligase  ali model follow..  13  65....................................IYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGI-------DNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPD-PIKIFEIGPCYRKESDGKE---HLEEFTMLSFIQM-----GSGCTRENLESIITDFLNHLGIDFKIVGDSC........................................................................................................................................................................................................................................................................................................................ 212
69 -10.5001z7m_A mol:protein length:344 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  11  10......................RMEKINYLLPEESAEMTLNQVKSLRQIEGRLRKLFSLKNYQEVMPPSFEYTQLYTALESNGKTFQEKMFQFIKHEG----QSITLRY---DFTLPLVRLYSQIKDSTSARYSYFGKIFRKEKRHK----RSTENYQIGIELFGESADKSELE---ILSLALQVIEQLG-----------------------LNKTVFEIGSAKFFQRLCQLADGSTELLTELLLKKDLSGLNAFIEKNNFSKELRGLLKEIFITNE-------------------SRLENLVTNTKDDVLISSFDQLKEFSEKLSMIKPIIIDLGMVPKMDYYKAYSSAANQPILSGGR-------QLLSNFQEEAFAIGFCCHMDTILKALERQ................................................................................................................... 331
70 -9.4005x6c_A mol:protein length:553 O-phosphoserine--tRNA(Cys) ligase  ali model follow..  133..............................................GIDIDEEKKERLREVLHLYKKGAIDGDKALNVSNEMGLKVLETAFPEFK--LKPESTTLTLR-SHMTSGWFITLSSLIKKRKLPLKLFSIDRCFRRE--QREDRSHLMSYHSASCVVV-----GEDVSVDDGKVVAEGLLAQFGFTKFKFKPDEKKSKYYTPETQTEVYAYHPKLGEWIEVATFGVYSPIALAKYNIDVP-------------MNLGLGVERLAMIIYGYEDVRAMKVPILDEFYNFANELIDICIANKDKESPCSVEVKREFNFNGERRVIKVEINEPNKKLLGPSVYDGNIYGIP-----PTFEGVKEQYIPILKKAKEEGVSTNIRYIDGIIYKLVAKIEEAL-VSNVDEFKFRVPIVRSLSDINLKIDE................................................................................... 525

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 7 6 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Awobuluyi M, Yang J, Ye Y, Chatterton JE, Godzik A, Lipton SA, Zhang D. Subunit-specific roles of glycine-binding domains in activation of NR1/NR3N-methyl-D-aspartate receptors. Mol Pharmacol. 2007 Jan;71(1):112-22. Epub 2006 Oct 17.