current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 5xip_A mol:protein length:498 Prolyl-tRNA synthetase, putative, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .
# Score Template Links and tools%idFirst GAMGVTAKKSTNFADWYTQVIVRGELVEYYDISGCYIIRPWAYRIWEAVQKFFDDGIKRLGVENCYFPMFVSQAKLEKEKDHVEGFKPEVAWVTHYGDSELPEKVAIRPTSETIMYPAYAKWIRSHRDLPLKLNQWNNVVRWEFKQPTPFLRTREFLWQEGHTAHATEEEAYTLVLEILELYRQWYEDYLAVPVIKGEKSENEKFAGGKKTTTIEGIIPDTGRGIQAATSHLLGQNFSRMFSIEFEDEKGAKQLVHQTSWGCTTRSLGVMIMTHGDDKGLVLPPRVVAVQAVIIPIIFKETGGMEIVAKCRELERLLNAAGVRVKVDDRTNYTPGWKFNDWELKGVPLRLEIGPRDVESCQTRVVRRDTSEARNVPWAEAASTIPAMLETMQKDLFNKAKAKFEASIEQITTFDEVMPALNRRHVVLAPWCEDPETETQIKRETQRLSEIQARENADGMTGAMKPLCIPFDQPPMPEGTRCFFTGRPAKRWCLFGRSYLast
1 -170.0005xip_A mol:protein length:498 Prolyl-tRNA synthetase, putative  ali model  100  1GAMGVTAKKSTNFADWYTQVIVRGELVEYYDISGCYIIRPWAYRIWEAVQKFFDDGIKRLGVENCYFPMFVSQAKLEKEKDHVEGFKPEVAWVTHYGDSELPEKVAIRPTSETIMYPAYAKWIRSHRDLPLKLNQWNNVVRWEFKQPTPFLRTREFLWQEGHTAHATEEEAYTLVLEILELYRQWYEDYLAVPVIKGEKSENEKFAGGKKTTTIEGIIPDTGRGIQAATSHLLGQNFSRMFSIEFEDEKGAKQLVHQTSWGCTTRSLGVMIMTHGDDKGLVLPPRVVAVQAVIIPIIFKETGGMEIVAKCRELERLLNAAGVRVKVDDRTNYTPGWKFNDWELKGVPLRLEIGPRDVESCQTRVVRRDTSEARNVPWAEAASTIPAMLETMQKDLFNKAKAKFEASIEQITTFDEVMPALNRRHVVLAPWCEDPETETQIKRETQRLSEIQARENADGMTGAMKPLCIPFDQPPMPEGTRCFFTGRPAKRWCLFGRSY 498
2 -161.0005xif_A mol:protein length:500 Prolyl-tRNA synthetase (ProRS)  ali model follow..  75  2..AMVTAKKDENFSEWYTQAIVRSEMIEYYDISGCYIMRPWAFHIWEKVQRFFDDEIKKMGVENSYFPMFVSRHKLEKEKDHVEGFSPEVAWVTHYGDSPLPEKIAIRPTSETIMYPAYAKWIRSHRDLPLKLNQWCSVVRWEFKQPTPFLRTREFLWQEGHTAHATEEEAWELVLDILELYRRWYEECLAVPVIKGEKSEGEKFAGGKKTTTVEAFIPENGRGIQAATSHLLGTNFAKMFEIEFEDEEGHKRLVHQTSWGCTTRSLGVMIMTHGDDKGLVIPPRVASVQVVIIPILFKDENTGEILGKCRELKTMLEKADIRVRIDDRSNYTPGWKYNHWEVKGVPLRLELGPKDLAKGTARVVRRDTGEAYQISWADLAPKLLELMEGIQRSLFEKAKARLHEGIEKISTFDEVMPALNRKHLVLAPWCEDPESEEQIKKETQKLSEIQAIESEQVMTGAMKTLCIPFDQPPMPEGTKCFYTGKPAKRWTLWGRSY 500
3 -159.0004ncx_A mol:protein length:506 Proline--tRNA ligase  ali model follow..  63  4NILGITSKKIENFSDWYTQVIVKSELIEYYDISGCYILRPAAYYIWECVQAFFNKEIKKLNVENSYFPLFVTKNKLEKEKNHIEGFSPEVAWVTKYGDSNLPEEIAIRPTSETIMYSVFPKWIRSYRDLPLKLNQWNTVVRWEFKQPTPFIRTREFLWQEGHTAHKNEEEAVKLVFDILDLYRRWYEEYLAVPIIKGIKSEGEKFGGANFTSTAEAFISENGRAIQAATSHYLGTNFAKMFKIEFEDENEVKQYVHQTSWGCTTRSIGIMIMTHGDDKGLVLPPNVSKYKVVIVPIFYKTTDENAIHSYCKDIEKILKNAQINCVYDDRASYSPGYKFNHWELRGIPIRIEVGPKDLQNNSCVIVRRDNNEKCNVKKESVLLETQQMLVDIHKNLFLKAKKKLDDSIVQVTSFSEVMNALNKKKMVLAPWCEDIATEEEIKKETQRLSLNQT-NSETTLSGAMKPLCIPLDQPPMPPNMKCFWSGKPAKRWCLFGRSY 500
4 -152.0005f9y_A mol:protein length:511 Aminoacyl-tRNA synthetase  ali model follow..  62  8SLLGITADKITSFADWYSQVIVKSEMIEYYDISGCYILRPWSYFIWETIQSVFDQKIKQHDVQNAYFPIFVTQKKLETEKDHVEGFSPEVAWVTKSGKSDLAEPIAIRPTSETIMYPYFAKWIRSHRDLPLKINQWTSIVRWEFKHPTPFIRTREFLWQEGHTAHSTRKEALEMVDIILNEYASIYEDLLATPVVKGTKSENEKFPGGDITKSIEGFIPEIGRAVQAATSHLLGQNFSKMFGVEFEDEKGNKEYAHQTSWGLTTRAIGVMIMTHGDNKGLVLPPKVAPVQVIIIPIIFKTVITEEQKKICNEVECILKKAGVRVKIDDRSNYTPGWKYNHWEVKGVCLRFEVGPRDIEKRSVRVVVRDNMEKMDIPISELESKIPKLLEEFQNRLLFKAKQRQNESIIRVDTFDKVMDTLNQKKMVIAPWCEDVSCEEEIKKETARLSLDN--EDNQSMTGAMKSLCIPNDQIFEEGKTKCFFCDKLAKKFTLFGRSY 505
5 -149.0004k86_A mol:protein length:535 Proline--tRNA ligase  ali model follow..  52  29TRLGLEAKKEENLADWYSQVITKSEMIEYHDISGCYILRPWAYAIWEAIKDFFDAEIKKLGVENCYFPMFVSQS-ALEKEKTHVADFAPEVAWVTRSGKTLAEPIAIRPTSETVMYPAYAKWVQSHRDLPIKLNQWCNVVRWEFKHPQPFLRTREFLWQEGHSAFATMEEAAEEVLQILDLYAQVYEELLAIPVVKGRKTEKEKFAGGDYTTTIEAFISASGRAIQGGTSHHLGQNFSKMFEIVFEDPKIPGEFAYQNSWGLTTRTIGVMTMVHGDNMGLVLPPRVACVQVVIIPCGITNALKEALIAKCNDYRRRLLSVNIRVRADLRDNYSPGWKFNHWELKGVPIRLEVGPRDMKSCQFVAVRRDTGEKLTVAENEAETKLQAILEDIQVTLFTRASEDLKTHMVVANTMEDFQKILDSGKIVQIPFCGEIDCEDWIKKTTARDQ----DLEPGAPSMGAKSLCIPFKPLELQPGAKCVCGKNPAKYYTLFGRSY 529
6 -146.0004hvc_A mol:protein length:519 Bifunctional glutamate/proline--tRNA ligase  ali model follow..  56  13TRLGLEAKKEENLADWYSQVITKSEMIEYHDISGCYILRPWAYAIWEAIKDFFDAEIKKLGVENCYFPMFVSQSALEKEKTHVADFAPEVAWVTRSGKTELAEPIAIRPTSETVMYPAYAKWVQSHRDLPIKLNQWCNVVRWEFKHPQPFLRTREFLWQEGHSAFATMEEAAEEVLQILDLYAQVYEELLAIPVVKGRKTEKEKFAGGDYTTTIEAFISASGRAIQGGTSHHLGQNFSKMFEIVFEDPKIPGEFAYQNSWGLTTRTIGVMTMVHGDNMGLVLPPRVACVQVVIIPCGITNEDKEALIAKCNDYRRRLLSVNIRVRADLRDNYSPGWKFNHWELKGVPIRLEVGPRDMKSCQFVAVRRDTGEKLTVAENEAETKLQAILEDIQVTLFTRASEDLKTHMVVANTMEDFQKILDSGKIVQIPFCGEIDCEDWIKKTTARDQ----DLEPGAPSMGAKSLCIPFKPLELQPGAKCVCGKNPAKYYTLFGRSY 513
7 -139.0003ial_A mol:protein length:518 Prolyl-tRNA synthetase  ali model follow..  29  13.......KTRDTFADWFDAIMDAAELVDRYPVKGCVVFRPYGFFMENAIMRLCEEEYAKVGISQILFPTVIPESFLKKESDHIKGFEAECFWVEKGGLQPLEERLALRPTSETAIYSMFSKWVRSYKDLPLKIHQTCTIFRHETKNTKPLIRVREIHWNEAHCCHATAEDAVSQLSDYWKVIDTIFSDELCFKGQKLRRVCWDRFPGADYSEVSDVVMPC-GRVLQTAGIHNLGQRFSSTFDILYANKANESVHPYLTCAGISTRVLACALSIHGDSGGLVLPPLIAPIHVVIIPIGCGKKNDQQVLGKVNEIADTLSKLGLRVSIDDDFSKSMGDKLYYYELKGVPLRIEVGQRDLANGQCIVVPRDVGKDQVIPITEVMKVSSDELDAYKARLKEKAFAFHNSMVTNCKSFDEIVACIENKGLARFPFYTTEADGEVWDKKLKDAC-------------SAEIRGHNPDENV-LPGEVCALSGKPAVCYMYCAKSY 512
8 -136.0005xil_A mol:protein length:512 Putative prolyl-tRNA synthetase  ali model follow..  53  1GAMGIAAKREENFSAWYIDVITKAEMIEYYDVSGCYIIRPWAYYVWKCVQRFLGGKIEKLGVEDCYFPMFVSRSCLEREKDHIEGFAPEVAWVTRAGDTELEQPVAVRPTSETVMYPYYAKWIRSHRDLPVRLNMWNNVIRWEFSHPTPFIRTREFLWQEGHCAWAKAEECAKEVLEILECYASVYEQLLAVPVVRGRKTEKEKFAGGDYTTTVETFIEAVGRGCQGATSHNLGQNFGKMFDIRFQDPENNEQTLWQNSWGLSTRVIGVMIMVHGDNRGMVMPPRVASTQVIIIPVGITKDTRQELLASCWRLESELCEGGVRARCDLRDNYSPGWRFNHWEVKGVPLRVELGPRELAERSLAVAVRHSGARHSVAWDAQTPAAAALLEDVHAQMYARAKETMETHRVRVTEWTEFVPTLNRKCLILAPWCGAMECENQVKKDSAEESKVAQAQDARAPSMGAKTLCIPFEQPEEPHECICKGCTKPATTWVLFGRSY 512
9 -130.0001h4q_A mol:protein length:477 PROLYL-TRNA SYNTHETASE  ali model follow..  44  2AKEKGLTPQSQDFSEWYLEVIQKAELADYGPVRGTIVVRPYGYAIWENIQQVLDRMFKETGHQNAYFPLFIPMSFLRKEAEHVEGFSPELAVVTHAGGEELEEPLAVRPTSETVIGYMWSKWIRSWRDLPQLLNQWGNVVRWEMRTR-PFLRTSEFLWQEGHTAHATREEAEEEVRRMLSIYARLAREYAAIPVIEGLKTEKEKFAGAVYTTTIEALMKD-GKALQAGTSHYLGENFARAFDIKFQDRDLQVKYVHTTSWGLSWRFIGAIIMTHGDDRGLVLPPRLAPIQVVIVPIY-KDESRERVLEAAQGLRQALLAQGLRVHLDDRDQHTPGYKFHEWELKGVPFRVELGPKDLEGGQAVLASRLGGKE-TLPLAALPEALPGKLDAFHEELYRRALAFREDHTRKVDTYEAFKEAVQEG-FALAFHCGDKACERLIQEET-----------------TATTRCVPFEAEP--EEGFCVRCGRPSAKRVVFAKAY 477
10 -127.0001nj1_A mol:protein length:501 Proline-tRNA Synthetase  ali model follow..  34  25...RYHGEKMTEFSEWFHNILEEAEIIDQYPVKGMHVWMPHGFMIRKNTLKILRRILDR-DHEEVLFPLLVPEDELAKEAIHVKGFEDEVYWVTHGGLSKLQRKLALRPTSETVMYPMFALWVRSHTDLPMRFYQVVNTFRYETKHTRPLIVREITTFKEAHTIHATASEAEEQVERAVEIYKEFFNSLGI-PYLITRRPPWDKFPGSEYTVAFDTLMPD-GKTLQIGTVHNLGQTFARTFEIKFETPEGDHEYVHQTCYGLSDRVIASVIAIHGDESGLCLPPDVAAHQVVIVPII-FKKAAEEVMEACRELRSRLEAAGFRVHLDDR-DIRAGRKYYEWEMRGVPLRVEIGPRDLEKGAAVISRRDTGEKVTADLQGIEETLRELMKDILENLRTRAWERMESEIREAETLEEASRIVDEKRIISFMWCGEEECGMDVEEKV-----------------RVDILGIQEEGS-----GTCINCGREAPYRAYLARTY 495
11 -120.0001nj8_A mol:protein length:459 Proline-tRNA Synthetase  ali model follow..  33  1......GSHMLEFSEWYSDILEKAEIYDRYPIKGCGVYLPYGFKIRRYTFEIIRNLLDESGHDEALFPMLIPEDLLAKEAEHIKGFEDEVYWVTHGGKTQLDVKLALRPTSETPIYYMMKLWVKVHTDLPIKIYQIVNTFRYETKHTRPLIRLREIMFKEAHTAHSTKEEAENQVKEAISIYKKFFDTLGIPYLISKRPEWDKFPGAEYTMAFDTIF--PDGRTMQIATVHNLGQNFSKTFEIIFETPTGDKDYAYQTCYGISDRVIASIIAIHGDEKGLILPPIVAPIQVVIVPLIFKGKED--IVMEKAKEIYEKLKGKFRVHIDDR-DIRPGRKFNDWEIKGVPLRIEVGPKDIENKKITLFRRDTMEKFQVDETQLMEVVEKTLNNIMENIKNRAWEKFENFITILEDIDEIKNILEKRGVILVPFKEEIYNEELEEKV------------------EATILGETEYK-----GNKYIAIA----------KTY 459
12 -98.0002j3l_A mol:protein length:572 PROLYL-TRNA SYNTHETASE  ali model follow..  22  5KMLIPTLREVPNDAEVSHQILLRAGYIRQV-AAGIYSYLPLANRVLEKLKTIMREEFEKIDAVEMLMPALLPAE-LWKESGRYETYGPNLYRLKDRNDRD----YILGPTHEETFTELIRDEINSYKRLPLNLYQIQTKYRDEKRSRSGLLRGREFIMKDGYSFHADEASLDQSYRDYEKAYSRIFERCGLEFRAIIGDGGAMGGKDSKEFMAISEIGEDTTKGIEIGHIFKLGTRYSDAMGATVLDENGREKSVIMGCYGIGVRLLSAIVEQNADERGINWPTGIAPFDLHVVQMNVKDEY---QTKLSQEVEAMMTEAGYEVLVDDR-NERAGVKFADADLIGCPIRITVGKKAVD-GVVEVKIKRTGEMLEVRKEELESTLSILMNTTSEV........................................................................................................ 571
13 -87.1005ucm_A mol:protein length:579 Proline--tRNA ligase  ali model follow..  21  7QYLLSTLKETPADAV-SHQLLLRAGMIRRL-ASGLYTWLPMGLRVLRKVETIVREEMNAAGALEVLMPAVQPAE-LWQESGRWEQYGPELLRLKDRHERE----FCVGPTHEEVITDLARNELNSYKQLPINFYQIQTKFRDEIRPRFGLMRGREFIMKDAYSFHLSQDSLQQTYDGMYQAYSKIFSRLGLDFRPVQADNGSIGGSGSHEFHVLANSGEDDKRGIEVGHIFQLGTKYSEAMKLSVLSEQGKPVNLIMGCYGIGVRVVAAAIEQNHDERGILWPSALAPFQIALVPLKYETES---VKQATDKLYAELTAAGFEVLLDDRDKKSPGVKFADMELIGIPHRIVISDRGLSEGVLEYKGRRDSESQNLPIGELMSFITEKLSR............................................................................................................ 573
14 -85.2002i4l_A mol:protein length:458 Proline-tRNA ligase  ali model follow..  19  27.......ENPKEAEIVSHRLMLRAGMLRQE-AAGIYAWLPLGHRVLKKIEQIVREEQNRAGAIELLMPTLQLAD-LWRESGRYDAYGPEMLRIADRHKRE----LLYGPTNEEMITEIFRAYIKSYKSLPLNLYHIQWKFRDEQRPRFGVMRGREFLMKDAYSFDVDEAGARKSYNKMFVAYLRTFARMGLKAIPMRAETGPIGGDLSHEFIVLAETGESG-RGIEVGQIFYFGTKYSDSMKANVTGPDGTDAPIHGGSYGVGVRLLGAIIEACHDDNGIIWPEAVAPFRVTILNLKQGDAA---TDAACDQLYRELSAKGVDVLYDDT-DQRAGAKFATADLIGIPWQIHVGPRGLAEGKVELKRRSDGARENLALADVVARLT................................................................................................................. 452
15 -58.4004p3n_A mol:protein length:415 Threonine--tRNA ligase, cytoplasmic  ali model follow..  16  2.........GSSSSGDHRKIGRDQELYFFHESPGSCFFLPKGAYIYNALIEFIRSEYRKRGFQEVVTPNIFNSR-LWMTSGHWQHYSENMFSFEVE-----KELFALKPMNCPGHCLMFDHRPRSWRELPLRLADFGVLHRNELSGATGLTRVRRFQQDDAHIFCAMEQEIKGCLDFLRTVYSVFGFSFKLNLSTRPEKFLGDGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIR-FNLTYVSHDGDDKIVHRAILGSVERMIAILTENYGGK----WPFWLSPRQVMVVPVGPTCDE------YAQKVRQQFHDAKFMADIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKISGTVNIRTRDNKVHGERTISETIERLQQLKEFRSKQAEEE.................................................................................................... 408
16 -57.2004hwt_A mol:protein length:413 Threonine--tRNA ligase, cytoplasmic  ali model follow..  17  1............MARDHRKIGRDQELYFFHELPGSCFFLPKGAYIYNALIEFIRSEYRKRGFQEVVTPNIFNSR-LWMTSGHWQHYSENMFSFEVE-----KELFALKPMNCPGHCLMFDHRPRSWRELPLRLADFGVLHRNELSGATGLTRVRRFQQDDAHIFCAMEQEIKGCLDFLRTVYSVFGFSFKLNLSTRPEKFLGDGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIR-FNLTYVSHDGDDKIVHRAILGSVERMIAILTENYGGK----WPFWLSPRQVMVVPVGPTCDE------YAQKVRQQFHDAKFMADIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKISGTVNIRTRDNKVHGERTISETIERLQQLKEFRSKQAEEE.................................................................................................... 404
17 -55.9003a31_A mol:protein length:471 Probable threonyl-tRNA synthetase 1  ali model follow..  15  17.........DITVKPDSRVPVFNREFATFT-GAGVPLFSLGGGPIRYALAEVLAKFHARRGYYVVETPIIASTE-LFKVSGHIEFYRNNMYLFDIE-----GHEFAVKPMNCPYHILLFLNEVASKLPLPFKVFEFGRVHRYEPSGSYGLLRVRGFTQDDAHIIVPGGRVVYDVFEEMKLVLERLSETFKVRLSMSDKSLIGKEFMGSKEEFIMMVEESGVSKEWQMGTIFNLPRRFRLYDVVREEFGIEEVYIIHRALLGSIERFLGVYLEHRRGR----MPFTLAPIQFAVIAVKTGGEVDREIEDLASSIAKGLLDKGFRVAVKGSSKTGLSSDVRHIESTAKPAVVFIGAKEVREKVLDVRVFDLESMKRRRLAIAYGDAADAVENLAAVAEELESPVRSLSGQAPRIPADFSFML.............................................................................. 471
18 -52.1004hwo_A mol:protein length:411 Threonine--tRNA ligase  ali model follow..  18  1............MARDHRKIGKQLDLYHMQEEPGMVFWHNDGWTIFRELEVFVRSKLKEYQYQEVKGPFMMDRV-LWEKTGHWDNYKDAMFTTSSE-----NREYCIKPMNCPGHVQIFNQGLKSYRDLPLRMAEFGSCHRNEPSGSHGLMRVRGFTQDDAHIFCTEEQEVNGCIRLVYDMYSTFFEKIVVKLSTRPEKRIGSGEGAFYGPKIEFTLYDCLDRAWQCGTVQ-LDFSLPSRLSASYVGEDNERKMIHRAILGSMERFIGILTEEFAGF----FPTWLAPVQVVIMNITDSQSE------YVNELTQKLSNAGIRVKADLR-NEKIGFKIREHTLRRVPYMLVCGDKEVESGKVAVRTRRGKDLGSMDVNEVIEKLQQEIRSRSLKQLEE.................................................................................................... 403
19 -49.9001nyq_A mol:protein length:645 threonyl-tRNA synthetase 1  ali model follow..  16  236.........EERKERDHRKIGKELELFTNSQGAGLPLWLPNGATIRREIERYIVDKEVSMGYDHVYTPVLANVD-LYKTSGHWDHYQEDMFPPMQLDETE---SMVLRPMNCPHHMMIYANKPHSYRELPIRIAELGTMHRYEASGASGLQRVRGMTLNDSHIF-VRPDQIKEEFKRVVNMIIDVYKDFGFEDYSFRLSYRAIGEAAFYGPKLDVQVKTAMGKEETLSTAQLDFLLPER-FDLTYIGQDGEHHVIHRGVVSTMERFVAFLTEETKGA----FPTWLAPKQVQIIPVNVDLH-----YDYARQLQDELKSQGVRVSIDDR-NEKMGYKIREAQMQKIPYQIVVGDKEVENNQVNVRQYGSQDQETVEKDEFIWNLVDEIRLKKHR........................................................................................................ 645
20 -48.4003ugq_A mol:protein length:460 Threonyl-tRNA synthetase, mitochondrial  ali model follow..  16  13..SHMASATKNASSA-TSMVSQRQDLFMTDPSPGSMFFLPNGAKIFNKLIEFMKLQQKKFGFNEVVTPLIYKKT-LWEKSGHWENYADDMFKVETTDEEK--EEYGLKPMNCPGHCLIFGKKDRSYNELPLRFSDFSPLHRNEASGASGLTRLRKFHQDDGHIFCTPSQEIFNSLKLIDIVYNKIFSNYFINFSTRPDHFIGDGDGAFYGPKLDIMVTDHLRKTHQVATIQ-LDFQLPERFDLKFKDQDNSYKMIHRATFGSIERFMALLIDSNEGR----WPFWLNPYQAVIIPVNTKNVQLRNELEADDMEPVPLNDWHFNVDLDIR-NEPVGYRIKSAILKNYSYLIIVGDEEVQLQKYNIRERDNRKSEKLTMSQIWEKFIELEKNYK.......................................................................................................... 454
21 -47.6001b76_A mol:protein length:442 Glycine--tRNA ligase  ali model follow..  14  1.....AASSLDELVALCKRRGFIFQSSEIYGLQGVYDYGPLGVELKNNLKQAWWRRNERDDMEGLDASVLTHRL-VLHYSGHEATFADPMVDNAKARYGGRGLLAYLRPETAQGIFVNFKNVLDATSKLGFGIAQIGKAFRNEITPRNFIFRVREFEQMEIEYF-VRPGEDEYWHRYWVEERLKWWQEMGLSRENLPPESSAHYAKATVDILYRFPHGSLELEGIAQRTDFDLGSHTKDQEALGITARVLRNEYVIEPSAGVDRGVLALLAEAFTREE-LKLKPQLAPIKVAVIPLVKNRPE---ITEYAKRLKARLLALGLGRVLYEDTG-NIGKAYRRHDEVGTPFAVTVDYDTIGQSTVTVRDRDTMEQIRLHVDELEGFLRERLR............................................................................................................. 441
22 -46.3001qf6_A mol:protein length:642 THREONYL-TRNA SYNTHETASE  ali model follow..  18  237.........EEAAKRDHRKIGKQLDLYHMQEAPGMVFWHNDGWTIFRELEVFVRSKLKEYQYQEVKGPFMMDRV-LWEKTGHWDNYKDAMFTTSSE-----NREYCIKPMNCPGHVQIFNQGLKSYRDLPLRMAEFGSCHRNEPSGSHGLMRVRGFTQDDAHIF-CTEEQIRDEVNGCIRLVYDMYSTFGFEKIVVKLSTRPEKRIGSYGPKIEFTLYDCLDRAWQCGTVQ-LDFSLPSRLSASYVGEDNERKMIHRAILGSMERFIGILTEEFAGF----FPTWLAPVQVVIMNITDSQSE------YVNELTQKLSNAGIRVKADLR-NEKIGFKIREHTLRRVPYMLVCGDKEVESGKVAVRTRRGKDLGSMDVNEVIEKLQQEIRSRSLKQLEE.................................................................................................... 642
23 -42.6002cim_A mol:protein length:522 SERYL-TRNA SYNTHETASE  ali model follow..  15  183NLLWQREPMEHPFKEDPTQAMMKEGWLKRGSSRGQWIHGPQSARIFRTFEKIVLEELEPLGYREMIFPKLVTWEVW-MKSGHAKGVYPEIYYVCPPQTRDPDYIGGMCYAQCPPFWMYVAGETLPNEEIPVKVFDRGTSHRYESGGIHGIERVDEFHRIEIVWI-GTKEEVLKCAEELHDRYMHIFNDILDIEWRKARVTPEENTVGTTDYEACLPYRGPDGEWLEFQNVSINGDKYPKGFNVKLQSGD----ELWSGCSGVGLRWAAVFLAQKGLDPA-NWP---EEFRNRVGEM.......................................................................................................................................................................................................... 509
24 -39.4002pme_A mol:protein length:693 Glycyl-tRNA synthetase  ali model follow..  14  54KELALQPKDDIVDRAKMEDTLKRRFFY-YGGVSGLYDFGPVGCALKNNIIQTWRQHFQEEQILEIDCTMLTPEP-VLKTSGHVDKFADFMVKDVKNGEGGNMPGYLRPETAQGIFLNFKRLLEFNQGKLPFAAAQIGNSFRNEISPRSGLIRVREFTMAEIEHFVDPSEKDHPKFQNVADLHLYLYSAKAYKKDAKLVMEYLAICDECYITEMEMLLNEKGEFTIETEGKTFQLTKDMINVKRFQKTLYVEE-NVIEPSFGLG-RIMYTVFEHTFHVREFSFPAVVAPFKCSVLPLSQNQE----FMPFVKELSEALTRHGVSHKVDDSSG-SIGRRYARTDEIGVAFGVTIDFDTVNKTTATLRDRDSMRQIRAEISELPSIVQDLANG--ADVEARYPLFEGQETGKKETIEELE................................................................................. 687
25 -37.6001ati_A mol:protein length:505 GLYCYL-TRNA SYNTHETASE  ali model follow..  14  1.........AASSLDELVALCKRRGFI-YGGLQGVYDYGPLGVELKNNLKQAWWRRNERDDMEGLDASVLTHRL-VLHYSGHEATFADPMVDNRITKKGGRGLLAYLRPETAQGIFVNFKNVLDATSKLGFGIAQIGKAFRNEITPRNFIFRVREFEQMEIEYFVRPGEDEYWHVEERLKWWQEMGENLVPYQQPPESSAHYAKATVDILYRFPHGSLELEGIAQRTDFDLGSHTKDQEALGITARVLRNEHSYVIEPSAGVDRGVLALLAEAFTREE-LKLKPQLAPIKVAVIPLVKNRPE---ITEYAKRLKARLLALGLGRVLYEDTG-NIGKAYRRHDEVGTPFAVTVDYDTIGQSTVTVRDRDTMEQIRLHVDELEGFLRERLR............................................................................................................. 504
26 -31.9005c51_B mol:protein length:485 DNA polymerase subunit gamma-2, mitochondrial  ali model follow..  10  57....PEAPGSGEGSEALLEICQRRHFLSGSKSGCHPGFGPLGVELRKNLAAEWWTSVVVFREQVFPVDLHHKPGPLLPGDSAFRLVSAETLQLVAFLENVLKTSGKLRENLLHGALEHYVNCLDLVNRLPYGLAQIGVCFHPVFDTKQIVKSIGEKTEASLVWF-TPPRTSNQWLDFWLRHRLQWWRKFAMSPSFSSSDCQDEEGRKGNKLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVCVLSVNGDLDRGMLAYLYDSFQLTENLKLHPCLAPIKVALDVGRGPTLE---LRQVCQGLFNELLENGISVWYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKN......................................................................................................... 484
27 -31.5002g4c_A mol:protein length:474 DNA polymerase gamma subunit 2  ali model follow..  10  41.....EAPGSGEGSEALLEICQRRHFLSGSKSGCHPGFGPLGVELRKNLAAEWWTSVVVFREQVFPV-LHHKPGPLLPGDSAFRLVSAETLQLVTFLENVLKTSGKLRENLLHGALEHYVNCLDLVNRLPYGLAQIGVCFHPVFDTKQGVKSIGEKTEASLVWF-TPPRTSNQWLDFWLRHRLQWWRKFAMSPSFSSSDCQDEEGRKGNKLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVCVLSVNGDLDRGMLAYLYDSFQLTENLKLHPCLAPIKVALDVGRGPTLE---LRQVCQGLFNELLENGISVWPGETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKN......................................................................................................... 467
28 -30.8004ztu_B mol:protein length:472 DNA polymerase subunit gamma-2, mitochondrial  ali model follow..  10  34.....EAPGSGEGSEALLEICQRRHFLSGSKSGCHPGFGPLGVELRKNLAAEWWTSVVVFREQVFPV-LHHKPGPLLPGDSAFRLVSAETLQLVAFLENVLKTSGKLRENLLHGALEHYVNCLDVNKRLPYGLAQIGVCFHPVFDTKNGVKSIGEKTEASLVWF-TPPRTSNQWLDFWLRHRLQWWRKFAMSPSFSSSDCQDEEGRKGNKLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVCVLSVNGDLDRGMLAYLYDSFQLTENLKLHPCLAPIKVALDVGRGPTLE---LRQVCQGLFNELLENGISVWYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKN......................................................................................................... 460
29 -30.8003qne_A mol:protein length:485 Seryl-tRNA synthetase, cytoplasmic  ali model follow..  14  145.......ATGAPAKLSHHEVLLRLDGYDRIVGHRGYFLRNYGVFLNQALINYGLSFLSSKGYVPLQAPVMM-NKEVMAKTAQLSQFDEELYKVIDG-----EDEKYLIATSEQPISAYHAGEWSPAEQLPVRYAGYSSCFRREAKDAWGIFRVHAFEKIEQFVL-TEPEKSWEEFDRMIGCSEEFYQSLGLPYRVVGIVSGELNNA-AAKKYDLEAWFPFQQEYKELVSCSNCTDYQSRNLEIRCGIKQQNQQHCLNSTLSATERTICCILENYQKEDGLVIPEVLRKY-----------PGEPEFIPYIKELPKNTTSVKKAKGKNPK-NTTSVKKAKGKNGS.......................................................................................................................................................... 478
30 -29.9001g5h_A mol:protein length:454 MITOCHONDRIAL DNA POLYMERASE ACCESSORY SUBUNIT  ali model follow..  11  16.....DAPEHAVAREALVDLCRRRHFLSGTPLSGCHAFGPLGVELRKNLASQWWSSMVVFREQVFAVDLHQEPGSSQPRDSAFRLVSPESEQLVAFLENLLKTSGKLRATLLHGALEHYVNCLDLVNKLPFGLAQIGVCFHNSNQTPSSVTRVGEKTEASLVWF-TPTRTSSQWLDFWLRHRLLWWRKFAMSPSSADCQDELGRKGSKLYYSFPWGKEPIETLWNLGDQELLHTYPGNVSTIQGRDGRKNVVPCVLSVSGDVDLGTLAYLYDSFQLAENLKLHPCLAPIKVALDVGKGPTVE---LRQVCQGLLNELLENGISVWYSETVHSSLEQLHSKYDEMSVLFSVLVTETTLENGLIQLRSRDTTMKEMMHISKLRDFLVKYLASASN......................................................................................................... 442
31 -29.4004h2w_A mol:protein length:346 Amino acid--[acyl-carrier-protein] ligase 1  ali model follow..  13  17IAVLPNSPDTAPQIADPLDHLADKLFHSMG-SDGVYARTALYESIVERLAALITS-HREAGTEALRFPPVMSRAQL-EKSGYLKSFPNLLGCVCGLHGTEREADLVLSPAACYPVYPIAASRGPL-PKGGLRFDVAADCFRRE--PSKHLDRLQSFRMRE-YVCIGTPDDVSDFRERWMVRAQAIARDLGLTFRVDYAKMLANNQRDQQLKFELLIPLRSEEQPTACMSFNYHREHFGTTWGIQDANGE----PAHTGCVAFGMRLAVAMFHTHGTDLS-AWPAKVRDI................................................................................................................................................................................................................. 323
32 -28.8003mey_A mol:protein length:346 Bll0957 protein  ali model follow..  13  23.....SPDTAPQIADPLDHLADKLFH--SMGSDGVYARTALYESIVERLAALITS-HREAGTEALRFPPVMSRAQL-EKSGYLKSFPNLLGCVCGLHGTEREADLVLSPAACYPVYPIAASRGPL-PKGGLRFDVAADCFRRE--PSKHLDRLQSFRMRE-YVCIGTPDDVSDFRERWMVRAQAIARDLGLTFRVDYAQMKAVSQKQQQLKFELLIPLRSEEQPTACMSFNYHREHFGTTWGIQDANGE----PAHTGCVAFGMRLAVAMFHTHGTDLS-AWPAKVRDI................................................................................................................................................................................................................. 323
33 -26.7003ikl_A mol:protein length:459 DNA polymerase subunit gamma-2, mitochondrial  ali model follow..  58.....EAPGSGEGSEALLEICQRRHFLSGSKSGCHPGFGPLGVELRKNLAAEWWTSVVVFREQVFPVDALHHKP-------------------GPLLPGDSAFRGGLRENLLHGALEHYVNCLDLVNRLPYGLAQIGVCFHPVFDTKQIVKSIGEKTEASLVWF-TPPRTSNQWLDFWLRHRLQWWRKFAMSPSFSSSDCQDEEGRKGNKLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVCVLSVNGDLDRGMLAYLYDSFQLTENLKLHPCLAPIKVALDVGRGPTLE---LRQVCQGLFNELLENGISVWPGETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKN......................................................................................................... 452
34 -24.4003w3s_A mol:protein length:527 Type-2 serine--tRNA ligase  ali model follow..  17  185.....SGPRRIRFRGDVTEEARRRGWVKEFPGRGQWIYTPPMAALFEVLRDFLLERVRKLGFEPALFPKLIPLETM-FRMRYLHGLPDGMYYVCPPKRDP-DPGYVLAPAQCEPFYELLRDEVVDPERLPIKLYDCGWTYRWEGGAAKGLERVNEFQRIE-HVWIAEPEEAYRIRRELLEATKRVAEELELEWKVVVSDDPFYLEGRLLEDRDIELPDVSEEAWISVGSFNVHGEHFVDGFNV----KEKSGRTLFTGCAGLGVRWVVGLLAQHGFYPY-EWPEPI.................................................................................................................................................................................................................... 505
35 -24.0001wu7_A mol:protein length:434 Histidyl-tRNA synthetase  ali model follow..  12  4..........................LQIEKIRGFRDFYPEDMDVEKFIFKTAEEAAEAFGFRRIDFPSLEYLDLYRIKSG--EELLQQTYSFVDKGGREV----TLIPEATPSTVRMVTS--RKDLQRPLRWYSFPKVWRYE-EPQAG--RYREHYQFNADIFGSDSPEADAE---VIALASSILDRLGLQGIDEMARITGKSSEEIARMAAVEDLLASYGKNVRYDFSIVRGLSYYTGIVFEAYDRSGQFRAILGG-FGMGDAVISLLLKREN------VQIPREKKSVYICRVG------KINSSIMNEYSRKLRERGMNVTVE--MERGLSAQLKYASAIGADFAVIFGERDLERGVVTIRNMYTGSQENVGLDSVVEHLISQATL............................................................................................................ 427
36 -23.7001qe0_A mol:protein length:420 Histidine--tRNA ligase  ali model follow..  12  5...............................PRGTQDILPEDSKKWRYIENQLDELMTFYNYKEIRTPIFESTDLFARGVGD-DVVQKEMYTFKDKGDRSI----TLRPEGTAAVVRSYEHKMQGNPNQPIKLYYNGPMFRYE-RKQKG--RYRQFNQFGVEAIGAENPSVDAE---VLAMVMHIYQSFGLKHLKLVINSVGDNEESKAYYEQVKAYLDDLGIPYTEDPNLVRGLDYHTAFELMMDNPNYDGAITTLCGGGRYNGLLELLDGPSETGIGFALLDIEENLDLFIVTMG------DQADRYAVKLLNHLRHNGIKADKD--LQRKIKGQMKQADRLGAKFTIVIGDQELENNKIDVKNMTTGESETIELDALVEYFKK................................................................................................................ 420
37 -23.4003hrk_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  15  1......MAMGTLEAQTQGPGSMQKNMVETEPVQGCRDFPPEAMRCRRHLFDVFHATAKTFGFEEYDAPVLESEELYIRKAG--EEITEQMFNFITKGGHRV----ALRPEMTPSLARLLLGKGRSLL-LPAKWYSIPQCWRYE-AITRG--RRREHYQWNMDIVGVKSVSAEELVCAACWAMRSL-AQLAVLGLEPTVVDAITTTLSLKSIDEIAQRVGEEHEAVK-GLAYYTGIVFEGFDR-NLLTTYGSPTPIPCAGFGFGDCVIVELLQEKR-----LLPDIPHVVDDVVIPFD------ESMRPHALAVLRRLRDAGRSADII--DKKKVVQAFNYADRVGAVRAVLVAPEEWERGEVQVKMLREGTGKEEGGAERGFAVPL................................................................................................................ 446
38 -23.4005c53_B mol:protein length:903 Pol gamma B  ali model follow..  11  390SSLEQLYSKYDEMSILFTVLVTETTL-----ENGLIHLRSRDTTMISKLKDFLIKYISRSRVAVRACHKVCR-CLLSGFGGRVDAGQPELLTERSSPKGGHDSAFRLRENLLHGALEHYVNCLDLVNRLPYGLAQIGVCFHPVFDTKQGVKSIGEKTEASLVWF-TPPRTSNQWLDFWLRHRLQWWRKFAMSPSFSSSDCQDEEGRKGNKLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVVLSVNGDLDRGMLAYLYDSFQLTENLKLHPCLAPIKVALDVGRGPTLE---LRQVCQGLFNELLENGISVWPGETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKN......................................................................................................... 902
39 -23.4005e3i_A mol:protein length:438 Histidine--tRNA ligase  ali model follow..  11  1.......................MAMSSIVAIKGFNDVLPTQTAAWRRLEQHLASLMDAYGYQQIRLPIVEQTGLFKRAIGDATDIEKEMYTFFDKGNPP--ESLTLRPEGTAGCVRALVEH-NLLRGATPRVWYMGPMFRYE-KPQKG--RYRQFHQFGVETFGVATPDIDAE---LIMLTARLWKRMGVDHMVAPKLHDFLKEDSLSHFQQLQDYLTAAGIKFVINQKLVRGLDYKTVFEWTTTALGSQGTVCAGGRYDGLVGQLKGKADQSVPAVGFAMGME-VRDCEAFLVAE------PAYQSKALVLAEQLRDQLEAANSNIRSQGSMKSQMKKADQAGAVYAIILGEREWEAQQLAVKELATAEQSQVALAELVPFLIEKFTK............................................................................................................ 432
40 -23.2003hri_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  14  1......MAMGTLEAQTQGPGSMQMNMVETEPVQGCRDFPPETMRLRKYLFDVFHSTARKFGFEEYDSPVLESEELYIRKAG--EEITEQMFNFITKGGHRV----ALRPEMTPSLARQLLAKGRSLL-LPAKWYSIPQCWRYE-AITRG--RRREHYQWNMDIIGVKSVSSEVELVCAANVVDAITSTLSLKTIDEIAQRIGEEHEAVRELRDFITQIEAYG-SVVRGLAYYTGIVFEGFDR-NLLTTYGSPTAVPCVGFGFGDCVIVELLNEKK-----LLPELHHVVDDLVIPFD------ETMRPHALSILRRLRDAGRSADIV--DKKKVVQAFNYADRIGALRAVLVAPDEWARGEVRVKMLREGAGREEGANERGIVLPV................................................................................................................ 446
41 -22.8004g85_A mol:protein length:517 Histidine-tRNA ligase, cytoplasmic  ali model follow..  11  65..........................FVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGE----SKLIYDLKDQGGELL----SLRYD----LTVPFARYLAMNKLTNIKRYHIAKVYRRD-NPAMTRGRYREFYQCDFDIAGNFDPMIPDA--ECLKIMCEILSSLQIGDFLVKVNDRRILDGMFAICGVSDSKFRTICSSVD-GLDYYTGVIYEAVLLQTPAQAGEEPLGVGSVAAGIGVERIFSIVE----QRLEALEEKIRTTETQVLVASAQKK----LLEERLKLVSELWDAGIKAELLYKKNPKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRSVTSREEVDVRREDLVEEIKRRTGQ............................................................................................................ 515
42 -22.5004g84_A mol:protein length:464 Histidine--tRNA ligase, cytoplasmic  ali model follow..  12  12..........................FVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGE----SKLIYDLKDQGGELL----SLRYD----LTVPFARYLAMNKLTNIKRYHIAKVYRRD-NPAMTRGRYREFYQCDFDIAGNFDPMIPDA--ECLKIMCEILSSLQIGDFLVKVNDRRILDGMFAICGVSDSKFRTICSSVD-GLDYYTGVIYEAVLLQTPAQAGEEPLGVGSVAAGIGVERIFSIVEQRLEALE---KIRTTETQVLVASAQ------KKLLEERLKLVSELWDAGIKAELLYKKNPKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRSVTSREEVDVRREDLVEEIKRRTGQ............................................................................................................ 462
43 -22.2004rdx_A mol:protein length:423 Histidine--tRNA ligase  ali model follow..  12  1........................GPMTARAVRGTKDLFGKELRMHQRIVATARKVLEAAGALELVTPIFEETQVFEKGVGA-DIVRKEMFTFQDRGGRSL----TLRPEGTAAMVRAYLEHGMKVWPQPVRLWMAGPMFRAE-RPQKG--RYRQFHQVNYEALGSENPILDAE---AVVLLYECLKELGLRRLKVKLSSVGDGEEARAHLKEVERHLERLSVPYELEPALVRGLDYRTAFEVHHEEIGAQSALGGGGRYAFGVERVALALEAEG-----FGLPEEKGPDLYLIPLT------EEAVAEAFYLAEALRP-RLRAEYA--APRKPAKGLEEALKRGAAFAGFLGEDELRAGEVTLKRLATGEQVRLSREEVPGYLLQALG............................................................................................................. 423
44 -21.8003vbb_A mol:protein length:522 Seryl-tRNA synthetase, cytoplasmic  ali model follow..  16  161.......DCTVRKKYSHVDLVVMVDGFEGAVVAGGYFLKGVLVFLEQALIQYALRTLGSRGYIPIYTPFFMRKEVM-QEVAQLSQFDEELYKVIGKGSEK-YDEKYLIATSEQPIAALHRDEWLRPEDLPIKYAGLSTCFRQEVRDTRGIFRVHQFEKIEQFVYSSPHNKSWEMFEEMITTAEEFYQSLGIPYHIVNIVSGSLNHAASKKLDL-EAWFPGSGAFRELVSCSNCTDYQARRLRIRYGQTKKMMDHMLNATMCATTRTICAILENYQTEKGITVPEKLKEFLQELIP-KQHEGSKKKAAARDVTLENRLQNMEVTDALE........................................................................................................................................................................... 516
45 -21.7003net_A mol:protein length:465 Histidyl-tRNA synthetase  ali model follow..  13  1.................SNAMAKNDKINFSTPSGFPEFLPSEKRLELYLLDTIRRVYESYGFTPIETPAVERLEVLQAKGNQGDNIQAEKDKSGDTGSEAR----ALKFDQTVPLAAYIARHLNDLT-FPFARYQMDVVFRGE-RAKDG--RFRQFRQCDIDVVGREKLSLLYDAQ-MPAIITEIFEAVNIGDFVIRINNRKVLTGFFQSLNISETQIKSCISIID-GLNYYTGTVYETTYEELVGTFIGEKMPGVGISIGL-TRLISRL-----LKAGILNTLPPTPAQVVVVNMQ------DELMPTYLKVSQQLRQAGLNVITN--EKRQLGKQFQAADKQGIRFCVIIGADEAAAQKSSLKDLQSGEQVEVALADLAEEIKRRLT............................................................................................................. 465
46 -21.4001ser_A mol:protein length:421 PROTEIN (SERYL-TRNA SYNTHETASE (E.C.6.1.1.11))  ali model follow..  15  126.......PPEFSFPPLDHVALMEKNGWWESQVSGSYALKGDLALYELALLRFAMDFMARRGFLPMTLPSYAREKAF-LGTGHFPAYRDQVWAIA-------ETDLYLTGTAEVVLNALHSGEILPYEALPLRYAGYAPAFRSEAKDVRGLMRVHQFHKVEQYVLTESLEASDRAFQELLENAEEILRLLELPYRLVEVATGDMGPG-KWRQVDIEVYLPSEGRYRETHSCSALLDWQARRANLRYRDPEGRVRYAYTNTALATPRILAMLLENHQLQDGVRVPQALIPY................................................................................................................................................................................................................. 411
47 -21.1002dq3_A mol:protein length:425 Seryl-tRNA synthetase  ali model follow..  16  130.....EPRKFDFEPKPHWEIGERLGILDFKRGSRFTVIAGWGARLERALINFMLDLHTKKGYKEICPPHLVKPEIL-IGTGQLPKFEEDLYKCE-------RDNLYLIPTAEVPLTNLYREEILKEENLPIYLTAYTPCYRREAKDIRGIIRQHQFDKVELVKI-VHPDTSYDELEKLVKDAEEVLQLLGLPYRVVELCTGDLGFS-AAKTYDIEVWFPSQNKYREISSCSNCEDFQARRMNTRFKDSKTGKNRFVHTLNGSGLRTLAAILENYQQEDGVVVPEVLRDY................................................................................................................................................................................................................. 416
48 -20.9003err_A mol:protein length:536 fusion protein of microtubule binding domain from mouse cytoplasmic dynein and seryl-tRNA synthetase from Thermus thermophilus  ali model follow..  15  245................HVALMEKNGWWEPSQVSGSYALKGDLALYELALLRFAMDFMARRGFLPMTLPSYAREKAF-LGTGHFPAYRDQVWAIA-------ETDLYLTGTAEVVLNALHSGEILPYEALPLRYAGYAPAFRSEAKDVRGLMRVHQFHKVEQYVLTEASLESDRAFQELLENAEEILRLLELPYRLVEVATGDMGPG-KWRQVDIEVYLPSEGRYRETHSCSALLDWQARRANLRYRDPEGRVRYAYTNTALATPRILAMLLENHQLQDGVRVPQALIPY................................................................................................................................................................................................................. 520
49 -20.5002el9_A mol:protein length:431 Histidyl-tRNA synthetase  ali model follow..  10  15...............................IRGMNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGE-DVVEKEMYTFEDRNGDSL----TLRPEGTAGCVRAGIEH-GLLYNQEQRLWYIGPMFRHE-RPQKG--RYRQFHQLGCEVFGLQGPDIDAE---LIMLTARWWRALGISLNDAPALGDYLDEESREHFAGLCKLLESAGIAYTVNQRLVRGLDYRTVFEWVTNSLGSQGTVCAGGRYAMGLERLVLLVQAVN-----PEFKADPVVDIYLVASG------ADTQSAAMALAERLRDELPGVKLMNHGGGNFKKQFARADKWGARVAVVLGESEVANGTAVVKDLRSGEQTAVAQDSVAAHLRTLLG............................................................................................................. 431
50 -20.4002dq0_A mol:protein length:455 Seryl-tRNA synthetase  ali model follow..  16  151.....EYEILEWKPKLHVDLLEILGGADFAKVSGFYYLLNEIVILDLALIRFALDRLIEKGFTPVIPPYMVRRFVE-EGSTSFEDFEDVIYKVE-------DEDLYLIPTAEHPLAGMHANEILDGKDLPLLYVGVSPCFRKEAKDTKGIFRVHQFHKVEQFVY-SRPEESWEWHEKIIRNAEELFQELEIPYRVVNICTGDLGYV-AAKKYDIEAWMPGQGKFREVVSASNCTDWQARRLNIRFRDRTDEKPRYVHTLNSTAIRAIVAILENHQEEDGVRIPKVLWKY................................................................................................................................................................................................................. 437
51 -20.3001wle_A mol:protein length:501 Seryl-tRNA synthetase  ali model follow..  16  173.......PAFSFQPRGHLEIAEKLDIIRQSHVSGSYYLRGAGALLQHGLVNFTLNKLIHRGFTPMTVPDLLRGVVF-EGCGMTPNAKPSQIYNIDPSRFE---DLNLAGTAEVGLAGYFMDHSVAFRDLPIRMVCSSTCYRAETKEPWGLYRVHHFTKVEMFGVTGPGEQSSELLEEFLSLQMEILTELGLHFRVLDMPTQELGLP-AYRKFDIEAWMPGRGRFGEVTSASNCTDFQSRRLHIMFQTEAGELQFAHTATGCAVPRLLIALLESYQQKDGVLVPPALQPY................................................................................................................................................................................................................. 461
52 -20.1003lsq_A mol:protein length:484 Seryl-tRNA synthetase  ali model follow..  14  166.....GNTTKRAKLNHVSIMERLGMMDTSTSMAGSYVLKGGLVQLQVALVSYSLDFLVKRGYTPFYPPFFLNRDVM-GEVAQLSQFDEELYQVSGD-----GDKKYLIATSEMPIAAYHRGRWFTELKEPLKYAGMSTCFRKEARDTLGIFRVHQFDKIEQFVVCSPREESWRHLEDMITTSEEFNKSLGLPYRVVNICSGALNNAAAKKY--LEAWFPASGAFRELVSCSNCTDYQSQSVNCRYGPNLRGTAHMLNGTLCAITRTMCCICENYQTEEGVVIPDVLRPY................................................................................................................................................................................................................. 460
53 -19.8006blj_A mol:protein length:485 Serine-tRNA ligase  ali model follow..  14  176.......PETGYKCLKHIDIMRKLGGLATTQVGGGYFLLGDLVRMNLALQNYAIDFLAKKGYMPIYTPFFMTKEQM-KKVAQLSQFDEELYTVTGE-----GEDKYLIATSEQPIAAFHLEKRFDESELPIKYCGMSTCFRKEVKDTLGIFRVHQFEKIEQFVVTSPKDNSWEMFDEMIGNSEAFYQSLGIPYRVVNIVSGALNNAAAKKFDLEAPGADEGNEYRELVSCSNCTDYQTRRLEVKYKKQGSEVEFCHMSTLTATSRTLCCIVENYQTPEGVNVPEVLQPY................................................................................................................................................................................................................. 468
54 -19.8001v95_A mol:protein length:130 Nuclear receptor coactivator 5  ali model follow..  17  8...............................................................................................................................................................................................................................................................................................PVDCSVIVVNKQTKD------YAESVGRKVRDLGMVVDLI-NTEVSLSQALEDVSRGGSPFAIVITQQHQIHRSCTVNIMFGTEHRNMPQADAMVLVARNYERYKNECREKERE................................................................................................. 118
55 -19.7004e51_A mol:protein length:467 Histidine--tRNA ligase  ali model follow..  10  1....MAMGTLEAQTQGPGSMTEKRKLEKLTGVKGMNDILPQDAGLWEFFEATVKSLLRAYGYQNIRTPIVEHTPLFTRGIGE-DIVEKEMYSFVDALN---GENLTLRPENTAAVVRAAIEH-NMLYDGPKRLWYIGPMFRHE-RPQRG--RYRQFHQVGVEALGFAGPDADAE---IVMMCQRLWEDLGLTGIKLEINSLGLGDVSRAHFEGLQRLLKANNVPFTINPRLVRGLDYLTVFEWVTDKLGAQGTVAAGGRYAMGIERILELLKEEH--------PEQEGVDVYVVHQG------DAAREQAFIVAERLRDTGLDVILHCSADASFKSQMKRADASGAAFAVIFGEDEVTNGTASVKPGEKSVQQSVPVESLTEFLINAMVATAED........................................................................................................ 458
56 -18.2002lw7_A mol:protein length:170 Histidine--tRNA ligase, cytoplasmic  ali model follow..  13  46...................................................................................................................................................................................................................................................................PDESKQKFVLKTPKALEE-----KIRTTETQVLVASAQ------KKLLEERLKLVSELQDAGIKAELLYKKNPKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRSVTSREEVDVRREDLVEEIKRRTGQ............................................................................................................ 165
57 -17.3005k1p_A mol:protein length:274 Pyrrolysine--tRNA ligase  ali model follow..  10  15....LLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEEENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGI-------DNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPD-PIKIFEIGPCYRKESDGKE---HLEEFTMLAFAQMGSGCTREN-----LESIITDFLNHLGIDFKIVGDS........................................................................................................................................................................................................................................................................................................... 194
58 -17.1004cs2_A mol:protein length:274 PYRROLYSINE--TRNA LIGASE  ali model follow..  12  22....ISLNSGKPFRELESELLSRR-------KKDLQQIYAEEREYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGI---DNDTELSKQIFRVDKNF----CLRPMLAPNLANYLRKLDRALPD-PIKIFEIGPCYRKESDGKE---HLEEFTMLNFCQMGSGCTREN-----LESIITDFLNHLGIDFKIVGDS........................................................................................................................................................................................................................................................................................................... 194
59 -16.1004bw9_A mol:protein length:291 PYRROLYSINE--TRNA LIGASE  ali model follow..  11  32....LLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEEREYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGI---DNDTELSKQIFRVDKNF----CLRPMLAPNLGNYLRKLDRALPD-PIKIFEIGPCYRKESDGKE---HLEEFTMLNFCQMGSGCTREN-----LESIITDFLNHLGIDFKIVGDS........................................................................................................................................................................................................................................................................................................... 211
60 -15.7004q6g_A mol:protein length:267 Pyrrolysine--tRNA ligase  ali model follow..  14....LLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEEREYLGKLEREITRFFVDRGFLEIKSPIL-------IPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMVAPNIFNYARKLDRALPD-PIKIFEIGPCYRKESDGKE---HLEEFTMLNFFQMGSGCTREN-----LESIITDFLNHLGIDFKIVGDS-----------CSVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDKP------------GAGFGLERLLKVKHDFKN.............................................................................................................................................................................................................................. 249
61 -15.7002zni_A mol:protein length:308 Pyrrolysyl-tRNA synthetase  ali model follow..  10  44EQLEMGFSDALSRDRAFQGIEHQLMSQGKRHLE--QLRTVKHRPALLELEEKLAKALHQQGFVQVVTPTIITKSALAKMTI---GEDHPLFSQVFWLDGKK----CLRPMLAPNLYTLWRELERLWDK-PIRIFEIGTCYRKESQGAQ---HLNEFTMLNLTELGTPLEERHQRLEDMAR.............................................................................................................................................................................................................................................................................................................................. 210
62 -15.6003qtc_A mol:protein length:290 Pyrrolysyl-tRNA synthetase  ali model follow..  10  29....LLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEEREYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGI-------DNDTELSKQIFRVDKNFCLRPMLTPNLYNYLRKLDRALPD-PIKIFEIGPCYRKESDGKE---HLEEFTMLVFWQMGSGCTREN-----LESIITDFLNHLGIDFKIVGDSC.......................................................................................................................................................................................................................................................................................................... 209
63 -15.5002e3c_A mol:protein length:291 Pyrrolysyl-tRNA synthetase  ali model follow..  11  65....................................IYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGI-------DNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPD-PIKIFEIGPCYRKESDGKE---HLEEFTMLNFCQMGSGCTREN-----LESIITDFLNHLGIDFKIVGDSC-----------MVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDKP----------WIGAGFGLERLLKVKHDFKNIKRA.......................................................................................................................................................................................................................... 271
64 -14.6004tqd_A mol:protein length:291 Pyrrolysine--tRNA ligase  ali model follow..  11  65....................................IYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDT---------SKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPD-PIKIFEIGPCYRKESDGKE---HLEEFTMLSFIQMGSGCTREN-----LESIITDFLNHLGIDFKIVGDS-----------CMVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDKP------------GAGFGLERLLKVKHDFKNIKRA.......................................................................................................................................................................................................................... 271
65 -14.4003od1_A mol:protein length:400 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  12  14................................FGMRDTLPEWYKTKKNICDQMTEEINLWGYDMIETPTLEYYETVGVVSAILD---QQLFKLLDQQGNTL----VLRPDMTAPIARLVASSLKD-RAYPLRLAYQSNVYRAQ-QNEGG--KPAEFEQLGVELIGDGTASADGE---VIALMIAALKRAGLSEFKVAIGHVGYVNALLMDVVGNEQRADRLRRFLY-HMSYYTGVVFE-GNRLGVPLCSGGRYDELLSKFHRPAQATGFGVRIDLLVEALNGEIISNGHEQTCILFSNERRFE------AIELARKKRANGEAVVLQDLAG-VTDVDAMSSNYQDVIYCIGTAGRGGEDA.......................................................................................................................................... 400
66 -12.7003rac_A mol:protein length:373 Histidine-tRNA ligase  ali model follow..  11  2NAMNGTRSAWGARAWEAVRGFADR-------PPGMQDGYPDFAKRRRAVETRLLSFVEDAGYEPVTSGLFEYVDTLLRARS--PESSRDWIRLFDGGGDAV----ALRPEMTPSIARMAAPRVAA-GRTPIRWCYCERVYRRTLSWASG--KAAESTQVGIERIGEEASVDVDM--DVLRLLHEASAAAGVRHHRIVVSHARLVPRLLDALGISASLSRAFLACLT-------------------GNYVQFRELWQLHAAKDVDLLANLLTWSPAERDAAKRSREASDRELEALVDPRAAADVRDAWRYLCRLAEALHDSGLVVTFDLA-DYYTGLVF-EMFAPGVGAPIAQGGR-------ELLAQFGAGAPAVGFAFEVERVMAVLEA............................................................................................................ 365
67 -12.1006FTT Entity 1(prereleased)  ali follow..  10  5................................DGVADVLFEDAHKQEVLRHQLTQQLITHGYQLVSPPMIEFTESLLSGAS--EDLKRQTFKIIDQLTGRL---MGIRA---DITPQILRIDAHHGGDGIARYCYAGDVIHTLPSGLF---GSRTPLQLGAEIFGCESIAADIE---LIDVLFSMINSLDMSAVLH----------------------------VDLGHVTIF-KRLAELAALSASDTEQLMQLYANKNLPELKQVCQVLPMGSDFYTLARFGHDIANLLGRLSENAQQDTKIVTAIDELQRLKAHLQVQWCAVSIDVTEHYHTGIVF-NGYINSETQPLVRGGR---DGMKSNQLATNQPRQATGFSMDVSRLLAHTQLDAPFIVLIDYDAFNNDSAQRQLLLQQVASLRQQGYRVTMPLTAEDMPVGLTHRLS..................................................... 377
68 -12.1005m8h_A mol:protein length:388 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  10  5................................DGVADVLFEDAHKQEVLRHQLTQQLITHGYQLVSPPMIEFTESLLSGAS--EDLKRQTFKIIDQLTGRL---MGIRA---DITPQILRIDAHHGGDGIARYCYAGDVIHTLPSGLF---GSRTPLQLGAEIFGCESIAADIE---LIDVLFSMINSLDMSAVLH----------------------------VDLGHVTIF-KRLAELAALSASDTEQLMQLYANKNLPELKQVCQVLPMGSDFYTLARFGHDIANLLGRLSENAQQDTKIVTAIDELQRLKAHLQVQWCAVSIDVTEHYHTGIVF-NGYINSETQPLVRGGR---DGMKSNQLATNQPRQATGFSMDVSRLLAHTQLDAPFIVLIDYDAFNNDSAQRQLLLQQVASLRQQGYRVTMPLTAEDMPVGLTHRLS..................................................... 377
69 -10.8001z7m_A mol:protein length:344 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  11  10......................RMEKINYLLPEESAEMTLNQVKSLRQIEGRLRKLFSLKNYQEVMPPSFEYTQLYTALESNGKTFQEKMFQFIKHEGQSI----TLRY---DFTLPLVRLYSQIKDSTSARYSYFGKIFRKEKRHK----RSTENYQIGIELFGESADKSELE---ILSLALQVIEQLGLNKTV-----------------------------FEIGSA--------KFFQRLCQLADGSTELLTELLLKKDLSGLNAFIEKNNFSKELLLKEIFITNELSRLENLVTNTKDDVLISSFDQLKEFSEKLSMIKPIIIDLGMVPKMDYYKAYSSAANQPILSGGR-------QLLSNFQEEAFAIGFCCHMDTILKALER............................................................................................................ 330
70 -9.0803g1z_A mol:protein length:326 Putative lysyl-tRNA synthetase  ali model follow..  10  17..........................................LLKRAAIMAEIRRFFADRGVLEVETPCMSQATV---TDIHLFPFETRFV----GPGHSQGINLYLMTSPEYHMKRLLAAGCG-------PVFQLCRSFRNE----MGRHHNPEFTMLEWYRPHYDMYRLMNEVDDLLQQVLDCQPAESLSYQQAFQRHLEIDPL-SADKTQLREAAAKLDLSNIADTEEDRDTLLQLLFTMGVEPHIGKEKPTFIYHFPAS---QASLAQISTED-----HRVAERFEVYYKGIELANGFHE--LTDAREQQQRFEQDNRKRAARGLPQQPIDQNLLDALAAGLPVMLALGAESLAD........................................................................................................................................... 317

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 4 5 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Sasin JM, Godzik A, Bujnicki JM. SURF'S UP! - protein classification by surface comparisons. J Biosci. 2007 Jan;32(1):97-100.