current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 5xix_A mol:protein length:472 Asparagine--tRNA ligase, cytoplasmic, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .
# Score Template Links and tools%idFirst MGSSSSGLVPRGSHMAKKITIKNDPSLPEPKCVKIGALEGYRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVLADELCQCYNGVLLSTESSVAVYGMLNLTPKGKQAPGGHELSCDFWELIGLAPAGGADNLINEESDVDVQLNNRHMMIRGENMSKILKARSMVTRCFRDHFFDRGYYEVTPPTLVQTQVEGGATLFKLDYFGEEAFLTQSSQLYLETCLPALGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFLTFDDLLNRLEDLVCDVVDRILKSPAGSIVHELNPNFQPPKRPFKRMNYSDAIVWLKEHDVKKEDGTFYEFGEDIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDSRLTESVDVLMPNVGEIVGGSMRIFDSEEILAGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRDVCLYPRFVQRCTPLast
1 -142.0005xix_A mol:protein length:472 Asparagine--tRNA ligase, cytoplasmic  ali model  100  1MGSSSSGLVPRGSHMAKKITIKNDPSLPEPKCVKIGALEGYRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVLADELCQCYNGVLLSTESSVAVYGMLNLTPKGKQAPGGHELSCDFWELIGLAPAGGADNLINEESDVDVQLNNRHMMIRGENMSKILKARSMVTRCFRDHFFDRGYYEVTPPTLVQTQVEGGATLFKLDYFGEEAFLTQSSQLYLETCLPALGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFLTFDDLLNRLEDLVCDVVDRILKSPAGSIVHELNPNFQPPKRPFKRMNYSDAIVWLKEHDVKKEDGTFYEFGEDIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDSRLTESVDVLMPNVGEIVGGSMRIFDSEEILAGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRDVCLYPRFVQRCTP 466
2 -132.0002xti_A mol:protein length:437 ASPARAGINYL-TRNA SYNTHETASE, CYTOPLASMIC, PUTATIVE  ali model follow..  64  1..............................TGVKIRDLVKHRNERVCIKGWIHRMRRQGKSLMFFILRDGTGFLQVLLMDKLCQTYDALTVNTECTVEIYGAIKEVPEGKEAPNGHELIADFWKIIGNAPPGGIDNVLNEEASVDKMLDNRHLVIRGENAAALLRLRAAATRAMREHFYNAGYVEVAPPTLVQTQVEGGSTLFNLDYFGEQSFLTQSSQLYLETCIPTLGDVFCIAQSYRAEKSRTRRHLAEYAHVEAECPFITLDDLMEKIEELVCDTVDRLLADEEAKKLLEINPKFQPPERPFLRMEYKDAIKWLQEHNVENEFGNTFTYGEDIAEAAERFMTDTINKPILLNRFPSEIKAFYMQRDAKDNTLTESVDLLMPGVGEIVGGSMRIWKFDELSKAFKNVEIDPKPYYWYLDQRLYGTCPHGGYGLGLERFICWLTNTNHIRDVCLYPRFVGRCVP 437
3 -127.0003m4p_A mol:protein length:456 Asparaginyl-tRNA synthetase, putative  ali model follow..  47  2..............PGSMMTEATTTPVETPIVCNIRDAAGLEGKLVTFKGWAYHIRKARKTLIFVELRDGSGYCQCVIFGKELEPEKVKLLTRECSLEITGRLNAYAGKNHDILNLEMQVTEWKVIGESPIDLE-NIINKDSSIPQKMQNRHIVIRSEHTQQVLQLRSEIQWYFRKYYHDNHFTEIQPPTIVKTQCEGGSTLFKLQYFNEPAYLTQSSQLYLESVIASLGKSFCMLSSYRAEQSRTVRHLAEYLHLEAELPFISFEDLLNHLEDLVCTVIDNVMAVHGDKIRKM-NPHLKLPTRPFKRMTYADAIKYCNDHGILNK-DKPFEYGEDISEKPERQMTDEIGCPIFMIHFPSKMKAFYMSKVPGHPDLTESVDLLMPGVGEIVGGSMRIWNYDELMGAYKANGLNPDPYYWYTQQRKYGSCPHGGYGLGVERLVMWLLGEDHIRKVCLYPRYLERCEP 456
4 -120.0004j15_A mol:protein length:521 Aspartate--tRNA ligase, cytoplasmic  ali model follow..  24  28PREIMDAAEDYAKERYGISSMIQSQEKPDRVLVRVRDLIQKADEVVWVRARVHTSRAKGK-QCFLVLRQQQFNVQALVAVGDHASKQAANINKESIVDVEGVVRKVNQKSCTQQDVELHVQKIYVISLAEPRLPLQLDDATVNQDTRLDNRVIDLRTSTSQAVFRLQSGICHLFRETLINKGFVEIQTPKIISAASEGGANVFTVSYFKNNAYLAQSPQLYKQCICADFEKVFSIGPVFRAEDSNTHRHLTEFVGLDIEMAFNYYHEVMEEIADTMVQIFKGLQERFQTEIQTVFPCEPFKFLEPTLRLEYCEALAMLREAGVEMGDEDDLSTPNE-KLLGHLVKEKYDTDFYILDKYPLAVRPFYTMPDPRNPKQSNSYDMFM-RGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLERVTMLFLGLHNVRQTSMFPRDPKRLTP 515
5 -118.0001x54_A mol:protein length:434 Asparaginyl-tRNA synthetase  ali model follow..  36  3..............................EKVYCQEVPELDGKKVRLAGWVYTNMRVGK-KIFLWIRDSTGIVQAVVAKNVVGEETAKKLGRESSVIVEGIVKADER---APGGAEVHVEKLEVIQAVSEFPI-PENPEQASPELLLDYRHLHIRTPKASAIMKVKETLIMAAREWLLKDGWHEVFPPILVTGAVEGGATLFKLKYFDKYAYLSQSAQLYLEAAIFGLEKVWSLTPSFRAEKSRTRRHLTEFWHLELEAAWMDLWDIMKVEEELVSYMVQRTLELRKKEIEMFRDTTLKNTEPPFPRISYDEAIDILQSKG------VNVEWGDDLGADEERVLTEEFDRPFFVYGYPKHIKAFYMKEDPNDPRKVLASDMLAPGYGEIIGGSQREDDYDKLLNRILEEGMDPKDYEWYLDLRRYGSVPHSGFGLGVERLVAWVLKLDHIRWAALFPRTPARLYP 434
6 -118.0001wyd_A mol:protein length:429 hypothetical aspartyl-tRNA synthetase  ali model follow..  28  2............................YRSHFIADVTPEYDGKEVIWAGWVHLLRDLGG-KKFIILRDKTGLGQVVVDKNSSAFGISQELTQESVIQVRGIVKADKRAP---RGIELHAEEITLLSKAKAPLPLDVSKVKADIDTRLRERVLDLRRQEMQAVIKIQSLALKAFRETLYKEGFIEIFTPKIIASATEGGAQLFPVIYFGKEAFLAQSPQLYKELMAGVVERVFEVAPAWRAEESDTPFHLAEFISMDVEMAFADYNDVMQLLEKILHNIVKTIKEEGKEELKIL-NYEPPEVKIPIKRLKYTEAIEILRSKGYNIKFGDDIG-----TPELRILNEELKEDLYFIVDWPSDARPFYTKSKSENPELSESFDLIY-KFLEIVSGSTRNHKREVLEEALKKKGLKPESFEFFLKWFDYGMPPHAGFGMGLARLMVMLTGIQSVKEIVPFPRDKKRLTP 429
7 -117.0001asy_A mol:protein length:490 ASPARTYL-tRNA SYNTHETASE  ali model follow..  25  16.....................SRDSDRTGQKRVKFVDLDKDSDKEVLFRARVHNTRQQGATLAFLTLRQQASLIQGLVKANKEGTKWAGSLNLESIVLVRGIVKKVDEPIKTVQNLEIHITKIYTISETPEALPILLEDPVVNLDTRLDYRVIDLRTVTNQAIFRIQAGVCELFREYLATKKFTEVHTPKLLGAPSEGGSSVFEVTYFKGKAYLAQSPQFNKQQLIADFERVYEIGPVFRAENSNTHRHMTEFTGLDMEMAFEEYHEVLDTLSELFVFIFSELPKRFAHEIELVREEFKLPKDGKMVRLTYKEGIEMLRAAGKEIGDFEDLSTENE-KFLGKLVRDKYDTDFYILDKFPLEIRPFYTMPDPANPKYSNSYDFFM-RGEEILSGAQRIHDHALLQERMKAHGLSPEDLKDYCDGFSYGCPPHAGGGIGLERVVMFYLDLKNIRRASLFPRDPKRLRP 490
8 -116.0001b8a_A mol:protein length:438 PROTEIN (ASPARTYL-TRNA SYNTHETASE)  ali model follow..  29  2............................YRTHYSSEITEELNGQKVKVAGWVWEVKDLGG-IKFLWIRDRDGIVQITAPKKKVDPELIPKLRSEDVVAVEGVVNFTPKAKLG---FEILPEKIVVLNRAETPLPLDPTKVKAELDTRLNNRFMDLRRPEVMAIFKIRSSVFKAVRDFFHENGFIEIHTPKIIATATEGGTELFPMKYFEEDAFLAESPQLYKEMMASGLDRVYEIAPIFRAEEHNTTRHLNEAWSIDSEMAFIDEEEVMSFLERLVAHAINYVREHNAKELDIL-NFELEEPKLPFPRVSYDKALEILGDLGKEIPWGEDID-TEGERLLGKYMMENENAPLYFLYQYPSEAKPFYIMKYDNKPEICRAFDLEYR-GVEISSGGQREHRHDILVEQIKEKGLNPESFEFYLKAFRYGMPPHGGFGLGAERLIKQMLDLPNIREVILFPRDRRRLTP 438
9 -114.0001n9w_A mol:protein length:422 aspartyl-tRNA synthetase 2  ali model follow..  29  2...............................RVLVRDLKAHVGQEVELLGFLHWRRDLGR-IQFLLLRDRSGVVQVVTGGL-------KLPLPESALRVRGLVVENAK---APGGLEVQAKEVEVLSPALEPTPVEIEEWRANPDTLLEYRYVTLRGEKARAPLKVQAALVRGFRRYLDRQDFTEIFTPKVVRAGAEGGSGLFGVDYFEKRAYLAQSPQLYKQIMVGVFERVYEVAPVWRMEEHHTSRHLNEYLSLDVEMGFIDEEDLMRLEEALLAEMLEEALNTAGDEIRLL-GATWPSFPQDIPRLTHAEAKRILKEELGYPVGQD----EEAERLLGEYAKERWGSDWLFVTRYPRSVRPFYTY--PEEDGTTRSFDLLFRGL-EITSGGQRIHRYEELLESLKAKGMDPEAFHGYLEVFKYGMPPHGGFAIGAERLTQKLLGLPNVRYARAFPRDRHRLTP 422
10 -114.0003i7f_A mol:protein length:548 Aspartyl-tRNA synthetase  ali model follow..  24  16..PPVVLLKTPELVSGENFKVMPMHQSQPCYKTGLKYTPAMAEKTVTIRARVQAVRGKGN-MVFLFLRKGIYTCQALVMKSETISKECQKISAESICDITGIVKAVEKEKATQQDVEIHVTSIAVVSLAEYPLPMQIEDLTVSQDTRLDNRMLDLRTVTNIAIFRIQSACCGLFREFLTSQKFVEIHTPKLIGCSSEGGSNIFEVKYFDRKAYLAQSPQLYKQMAIGDFRKVFEVGPVFRAENSNTRRHLTEFEGLDIEMEIVNYHECIDVMEKLFTFIFDEIPKRFPDELKVIRKPFEDLIYRPFLRLTYKEAIEMLRASGETIGDYDDFT-TPQEVKLGELIKAKYNTDFYILDKFPAAIRPFYTMPDIDDPNYSNSYDVFVR-GQEITSGAQRIHDPEFLMKRCIEKGVDPATLKDYIESFRFGSWPHAGCGIGLERITMLYLGIPNIRKVTLFPRDPIRLNP 548
11 -90.2001nnh_A mol:protein length:294 asparaginyl-tRNA synthetase-related peptide  ali model follow..  20  2......................................................................................................................................................NAVEIISREISPTLDIQTKILEYMTDFFVKEGFKWLLPVIISPIPAGEGMEPAEVEIYGVKMRLTHSMILHKQLAIMGLKKIFVLSPNIRLEQKDDGRHAYEFTQLDFEVERAKMEDIMRLIERLVYGLFRKAEEWTGREFPKT---------KRFEVFEYSEVLEEFGS---------------------DEKASQEMEEPFWIINIPREFYDREVDGFWRNYDL-----ILPYGYGEVASGGEREWEYEKIVAKIRKAGLNEDSFRPYLEIAKAGLKPSAGAGIGVERLVRFIVGAKHIAEVQPFPRIPGIPA. 292
12 -89.8003p8t_A mol:protein length:294 AsnS-like asparaginyl-tRNA synthetase related protein  ali model follow..  20  2......................................................................................................................................................NAVEIISRDIYKAIDIQTKILDYMTKFFTDRGFKWLLPIMLSPIPAGEGIRPAEVDVYGVRMRLTHSMILHKQLAIMGLEKIFVLSPNIRLERKDDGRHSYEFTQLDFEIEGAKMKDVMRLIEELIYGLFRKAEEWTGREFPRA---------RHFKVYDYKDILEEFGS---------------------DEKASMEMEEPFWIVNIPREFYDREENGVWKNYDL-----ILPYGYGEVSSGGEREWEYEKIVAKIRAAGLKEDSFRPYLEIARAGLKPSAGAGIGVERLVRFIVGAKHIAEVQPFPRVPGIPAV 293
13 -86.2005eln_A mol:protein length:535 Lysine--tRNA ligase  ali model follow..  16  15..SHYTDNRYKMMECIKDAGRPFYPHKFKISMSNVENGYIDKDTTLSLSGRVTSIRSSSSKLIFYDIFCEEQKVQIIANIMEHDSVSHSEIRRGDVVGFTGFPGKSKRGELS-----LFSKSVVLLSPCYHMLPTAIS-GLKDQEVRYRQRYLDLLNEESRKVFKLRSRAIKYIRNYFDRLGFLEVETPMLNMIYGGAAARPFITYHLETQLYMRIAPELYKQLIVGGLDKVYEIGKNFRNEGIDL-THNPEFTAMEFYMAYADYYDLMDLTEELISGLVLEIHGSLKIPYHPEGKCIEIDFTTPWKRFSFVEEIESGLGEKLKRELPHPRTAAKLLDKLAGHFVETKCTNPSFIIDHPQTMSP-LAKWHREKPEMTERFELFV-LGKELCNAYTELNEPLQQRKFFEQQADAKASDETFCLALEHGLPPTGGWGLGIDRLIMFLADKNNIKEVILFPAMRNV... 516
14 -85.8005hgq_A mol:protein length:524 Lysine--tRNA ligase  ali model follow..  15  8..QEYFKLRTALINERRSKGINPYPHKFHVSISSLEKDVILNDIVQSVAGRVFSKRESGGKLIFYDLHGEGTRLQVLANARFHSGDEHDRIKRGDIIGVNGYPARSKSGELS-----IIPYEIIQLTPCLHMLPHTHF-GLKNQETRYRMRYLDLMNPDVKNRFVTRSRMISFLRRYLDNLGFLEVETPMMNLIAGGATAKPFITHHLDMDLYLRVAPELYKMLVVGGIDRVYEIGRVFRNEGIDQ-THNPEFTSCEFYMAYADYEDLMKITEDMLARMVYYMHGTYKIQYHVENPVYEVDFTPPFRKVNIYDGLQEKLGIQFPPECPAPRTTARLLDKLIGEFLEPTFISPTFLTGHPQIMSP-LAKWHRSIPGLTERFELFV-VTKEIVNAYTELNDPLTQRLRFDEQAKQKQADENYCTALEYGLPPTAGWGMGIDRLAMILTDSNNIKEVLFFPAMRPD... 511
15 -85.4003bju_A mol:protein length:521 Lysyl-tRNA synthetase  ali model follow..  16  6..NQYYKIRSQAIHQLKVNGEDPYPHKFHVDISHLQPGDHLTDITLKVAGRIHAKRASGGKLIFYDLRGEGVKLQVMANSRNYKSEENNKLRRGDIIGVQGNPGKTKKGELS-----IIPYEITLLSPCLHMLPHLHF-GLKDKETRYRQRYLDLLNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHLDMNLYMRIAPELYKMLVVGGIDRVYEIGRQFRNEGIDL-THNPEFTTCEFYMAYADYHDLMEITEKMVSGMVKHITGSYKVTYHPEGQAYDVDFTPPFRRINMVEELEKALGMKLPEECPPPRTTARLLDKLVGEFLEVTCINPTFICDHPQIMSP-LAKWHRSKEGLTERFELFV-MKKEICNAYTELNDPMRQRQLFEEQAKAKAADENFCTALEYGLPPTAGWGMGIDRVAMFLTDSNNIKEVLLFPAMKPE... 508
16 -85.2001efw_A mol:protein length:580 ASPARTYL-TRNA SYNTHETASE  ali model follow..  22  12......................................ETHVGEEVVLEGWVNRRRDLGG-LIFLDLRDREGLVQLVAHPASPAYATAERVRPEWVVRAKGLVRLRPEPRLATGRVEVELSALEVLAEAKTPPFPGEEEKEASEELRLKYRYLDLRRRRMQENLRLRHRVIKAIWDFLDREGFVQVETPFLTKSTPEGARDFLVPYRHEPGLFLPQSPQLFKQLMVAGLDRYFQIARCFRDEDLRADRQ-PDFTQLDLEMSFVEVEDVLELNERLMAHVFREALGGGFSGGVAKFLEPVREALLQATEARPGDTLLFVAGPRKREGFRFLWVVDFPLLEWDEEEEAWTYMHHPFTSPHPEDLPLL---EKDPGRVRALAYDLVL-NGVEVGGGSIRIHDPRLQARVFRLLGIGEEEFGFFLEALEYGAPPHGGIAWGLDRLLALMTGSPSIREVIAFPKNKEGKDP 557
17 -84.5004wj3_M mol:protein length:599 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  23  14......................................ESLDGQEVTLCGWVHRRRDHGG-VIFLDVRDREGLAQVVFDPDRAETAKADRVRSEFVVKITGKVRLRPEGNMASGSIEVLGYELEVLNQAETPPFPLDEYSDVGEETRLRYRFIDLRRPEMAAKLKLRARITSSIRRYLDDNGFLDVETPILGRPTPEGARDYLVPSRTYPGHFLPQSPQLFKQLMVAGFDRYYQIAKCFRDEDLRADRQ-PEFTQIDIETSFLDESDIIGITEKMVRQLFKEVLDV---------------EFDEFPHMPFEEAMRRYGSDKPDLRIPLELVDVADQLKEVEEENDDGSLSALHHPFTSPKCTP-AELEANPGAALSRAYDMVL-NGTELGGGSIRIHDKSMQQAVFRVLGIDEAEFGFLLDALKYGAPPHGGLAFGLDRLVMLMTGASSIREVIAFPKTQSAGDV 566
18 -84.0004ycv_A mol:protein length:516 Lysine--tRNA ligase  ali model follow..  16  6..RLYFENRSKFIQDQKDKGINPYPHKFERTISDLGNGEHLEDTILNITGRIMRVSASGQKLRFFDLVGDGEKIQVLANYSFHNHEKYDKIRRGDIVGIVGFPGKSKKGELS-----IFPKETILLSACLHMLPMKY--GLKDTEIRYRQRYLDLINESSRHTFVTRTKIINFLRNFLNERGFFEVETPMMNLIAGGANARPFITHHLDLDLYLRIATELPKMLIVGGIDKVYEIGKVFRNEGIDN-THNPEFTSCEFYWAYADYNDLIKWSEDFFSQLVYHLFGTYKISYGPENQPIEIDFTPPYPKVSIVEEIEKVTNTILEQELPNPPTAAKLLDQLASHFIENKNDKPFFIVEHPQIMSP-LAKYHRTKPGLTERLEMFI-CGKEVLNAYTELNDPFKQKECFKLQQKDREKDSAFCTSLEYGLPPTGGLGLGIDRITMFLTNKNSIKDVILFPTMRPA... 507
19 -83.5003a74_A mol:protein length:493 Lysyl-tRNA synthetase  ali model follow..  19  6..NDQLRVRREKLKKIEELGVDPFGKRFERTHKAEELFELYQQIEVAVAGRIMTKRGMGK-AGFAHIQDVTGQIQIYVRQDDVGEQQFKISDLGDIVGVRGTMFKTKVGELS-----IKVSSYEFLTKALRPLPEKYH-GLKDIEQRYRQRYLDLMNPESKKTFITRSLIIQSMRRYLDSHGYLEVETPMMHAVAGGAAARPFITHHLDMTLYMRIAIELHKRLIVGGLEKVYEIGRVFRNEGIST-RHNPEFTMLELYEAYADFRDIMKLTENLIAHIATEVLGT----TKIQYGEHLVDLTPEWRRLHMVDAIKEYVGVDFWREVAPHMTFGHIVNEFFEQKVEDKLIQPTFIYGHPVEISP-LAKKNPDDPRFTDRFELFI-VGREHANAFTELNDPIDQRQRFEEQLKEREQDEDFLEALEYGMPPTGGLGIGVDRLVMLLTNSPSIRDVLLFPQMRHK... 493
20 -83.3004up7_A mol:protein length:777 LYSINE--TRNA LIGASE  ali model follow..  15  5..KQLFLNRCKDVEEYQKAGHNPWPHKFNVSITVPEEKSQVSDDIVSVAGRVLSKRSSSSALMFIDLHDSQTKLQIMLNKSAYENKETKMIYRGDICGFTGHPTRTKTGE-----LSLIPISGMILSPCLHMLPSM-HYGLGDQETRFRKRYLDLINPESVKNFVLRTKVVKAVRKYLDDKGFLEVETPILNTIPGGATARPFITHHLDIQMYMRIAPELYLKLVVGGINRVYEIGRLFRNEGIDQT-HNPEFTTCEFYMAYADYNDIMKMTEELLGNMVKDITGG---STKLEIKDRLMDINNEEDIKMLEKFFKEPIPRPFNSAPFKRISYVHALEEKFGEKIPRPLDGPEALTFQPQLMSP-LAKYHRSEPELTERFELFI-LKREIANAYTELNNPIVQRSNFEQQAKDKAADEVFLDAIEHAFPPTGGWGLGIDRLAMLLADVDNIKEVILFPTMRPE... 564
21 -83.0001e1o_A mol:protein length:504 LYSYL-TRNA SYNTHETASE, HEAT INDUCIBLE  ali model follow..  19  57...................................NQELESLNIEVSVAGRMMTRRIMGK-ASFVTLQDVGGRIQLYVARDSLPEGVYKKWDLGDIIGARGTLFKTQTGELS-----IHCTELRLLTKALRPLPDKFH-GLQDQEVRYRQRYLDLANDKSRQTFVVRSKILAAIRQFMVARGFMEVETPMMQVIPGGASARPFITHHLDLDMYLRIAPELYKRLVVGGFERVFEINRNFRNEGISV-RHNPEFTMMELYMAYADYHDLIELTESLFRTLAQEVLGT----TKVTYGEHVFDFGKPFEKLTMREAIKKYRPESIGITVEKSWGLGRIVTEIFDEVAEAHLIQPTFITEYPAEVSP-LARRNDVNPEITDRFEFFI-GGREIGNGFSELNDAEDQAERFQEQVNAKAADEDYVTALEYGLPPTAGLGIGIDRMIMLFTNSHTIRDVILFPAMRPQ... 503
22 -82.2001bbu_A mol:protein length:504 PROTEIN (LYSYL-TRNA SYNTHETASE)  ali model follow..  18  15..NNELKTRREKLANLREQGIHTSDQLHAEFDGKENEELEALNIEVAVAGRMMTRRIMGK-ASFVTLQDVGGRIQLYVARDDLPEGVYKKWDLGDILGAKGKLFKTKTGELS-----IHCTELRLLTKALRPLPDKFH-GLQDQEARYRQRYLDLSNDESRNTFKVRSQILSGIRQFMVNRGFMEVETPMMQVIPGGAAARPFITHHLDLDMYLRIAPELYKRLVVGGFERVFEINRNFRNEGISV-RHNPEFTMMELYMAYADYKDLIELTESLFRTLAQDILGK----TEVTYGDVTLDFGKPFEKLTMREAIKKYRPESIGIHVEKSWGLGRIVTEIFEEVAEAHLIQPTFITEYPAEVSP-LARRNDVNPEITDRFEFFI-GGREIGNGFSELNDAEDQAQRFLDQVAAKDADEDYVTALEHGLPPTAGLGIGIDRMVMLFTNSHTIRDVILFPAMRPV... 503
23 -82.0006aqh_A mol:protein length:508 Lysine--tRNA ligase  ali model follow..  17  14..PEQFRIRQAKRADLLAQGRQPYPVDVPRTHTLLEPVDARTGEIVGVTGRVVFARNSGK-LCFATLQEGDGQLQAMISLAEVGQEALTYVDIGDIVFVHGEVITSKRGELS-----VLADSWQMAAKALRPLPVAHKE--MSEESRVRQRYVDLVRDQARKVARQRIAVMRAIRSALERRGFLEVETPMLQTLAGGAAARPFVTHSLDTELYLRIAPELFKRCLVGGFERVFELNRVFRNEGADS-THSPEFVMLETYQAYGTYDDSAVVTRELIQEVADEAIGTRQVP---LPDGTVYDLDGEWESIQMYPSLSIADRLGLDIPRDRGYGHGKLVEELWEHTVGAKLWAPTFVKDFPVETTP-LTRSHRSIPGVTEKWDLYV-RRIELATGYSELTDPIIQRERFEAQARAAAADEDFLAALEYGMPPSTGTGMGIDRLMMTLTG-LSIRETVLFPIVKPR... 502
24 -82.0006chd_A mol:protein length:597 Lysine--tRNA ligase  ali model follow..  16  74..NQYYKIRSQAIHQLKVNGEDPYPHKFHVDISHLQPGDHLTDITLKVAGRIHAKRASGGKLIFYDLRGEGVKLQVMANSRNYKSEENNKLRRGDIIGVQGNPGKTKKGELS-----IIPYEITLLSPCLHMLPHLHF-GLKDKETRYRQRYLDLLNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHLDMNLYMRIAPELYKMLVVGGIDRVYEIGRQFRNEGIDL-THNPEFTTCEFYMAYADYHDLMEITEKMVSGMVKHITGSYKVTYHPEGQAYDVDFTPPFRRINMVEELEKALGMKLPEECPPPRTTARLLDKLVGEFLEVTCINPTFICDHPQIMSP-LAKWHRSKEGLTERFELFV-MKKEICNAYTELNDPMRQRQLFEEQAKAKAADENFCTALEYGLPPTAGWGMGIDRVAMFLTDSNNIKEVLLFPAMKPE... 576
25 -81.9004ex5_A mol:protein length:529 Lysine--tRNA ligase  ali model follow..  19  31..NQIVAERRDKLRALRDQGIHHAADLQTAYADADKEALEAKSLEVAIAGRMMLKRVMGK-ASFATVQDGSGQIQFFVTPADVGAETFKKWDLGDIVAARGVLFRTNKGELS-----VKCTQLRLLAKALRPLPDKFH-GLADQETRYRQRYVDLVTPETRTTFRARTKAIASIRKFMGDADFMEVETPMLHPIPGGAAAKPFVTHHLDMEMFLRIAPELYKRLIVGGFERVFEINRNFRNEGVSP-RHNPEFTMMEFYAAYTDYRWLMDFTERLIRQAAVDALGT----ATIQYQGRELDLAQPFHRLTITQAIQKYAPSYTTQPAFLNAGIGALQLALFEETAEAQLWEPTFIIDYPIEVSP-LARESDTVAGITERFELFI-TGREIANGFSELNDPEDQAARFKKQVEQKDADADYIRALEYGMPPTGGCGIGIDRLVMLLTDSPTIRDVLLFPHLRRE... 522
26 -81.2005vl1_A mol:protein length:506 Lysine--tRNA ligase  ali model follow..  17  11..PEQFRIRRDKRARLLAEGYDPYPVAIERTHTLAEPTDSATEDIVGVAGRVVFARNTGK-LCFATLQDGDGQLQAMISLDEVGRESLADVDIGDVVYVHGTVISSRRGELS-----VLADSWRMAAKALRPLPVAHKE--MSEESRVRQRYVDLVRPQAREVARQRIAVIRAVRNALERRGFLEVETPMLQTLAGGAAARPFVTHSLDIDLYLRIAPELFKRCIVGGFDRVFELNRVFRNEGSDS-THSPEFSMLETYQTYGTYDDSALITRELIQEVADEAIGTRQLSMP---DGSVYDIDGEWATMEMYSSLSEALGEQITPETTVAFGHGKLVEELWEHAVGNKLTAPTFVKDFPVETTP-LTRQHRSIPGVTEKWDLYV-RGVELATGYSELNDPVVQRDRFADQARAAAADEDFLTALEYGMPPCTGTGMGIDRLLMCLTG-LSIRETVLFPIVRPH... 498
27 -80.7004rmf_A mol:protein length:609 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  23  12......................................PADAGQTVTLAGWVARRRDHGG-VIFIDLRDASGVSQVVFREGDVL-AAAHRLRAEFCVAVTGVVEVRPEGEIPTGQIEVNATELTVLGES-APLPFQLD-EQAGEEARLKYRYLDLRREGPGNALRLRSKVNAAARSVLAEHDFVEIETPTLTRSTPEGARDFLVPARLQPGSFLPQSPQLFKQLMVAGMERYYQIARCYRDEDFRADRQ-PEFTQLDMEMSFVEADDVIAISEQVLKAVWATIGYD---------------LPLPLPRISYEEAMRRFGSDKPDLRFGIELDEATAAGDVAVGSGAWTAMHHAFTAPKPDSVDTF---DSDPGNALSDAYDIVC-NGNEIGGGSIRIHRRDIQERVFAMMGIDHDEFGFLLDAFSYGAPPHGGIAFGWDRITALLAGVDSIREVIAFPKSGG.... 559
28 -80.1004o2d_A mol:protein length:620 Aspartate--tRNA ligase  ali model follow..  23  28......................................PADAGQTVTLAGWVARRRDHGG-VIFIDLRDASGVSQVVFREGDVL-AAAHRLRAEFCVAVTGVVEVRPEGEIPTGQIEVNATELTVLGES-APLPFQLD-EQAGEEARLKYRYLDLRREGPGNALRLRSKVNAAARSVLAEHDFVEIETPTLTRSTPEGARDFLVPARLQPGSFLPQSPQLFKQLMVAGMERYYQIARCYRDEDFRADRQ-PEFTQLDMEMSFVEADDVIAISEQVLKAVWATIGYD---------------LPLPLPRISYEEAMRRFGSDKPDLRFGIELDEATAAGDVAVGSGAWTAMHHAFTAPKPDSVDTF---DSDPGNALSDAYDIVC-NGNEIGGGSIRIHRRDIQERVFAMMGIDHDEFGFLLDAFSYGAPPHGGIAFGWDRITALLAGVDSIREVIAFPKSGG.... 575
29 -79.4005w25_A mol:protein length:616 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  22  2..............GSSSSGLVPRGSHVFVLRSHALLREGDAGQQVTLAGWVARRRDHGG-VIFIDLRDASGIAQVVFRDPQDTEAQAHRLRAEFCVSVAGVVEIRPEGEIATGEIEVNATSLTVLGEC-APLPFQLD-EPAGEELRLKYRYLDLRRDDPAAAIRLRSRVNAAARAVLARHDFVEIETPTITRSTPEGARDFLVPARLHPGSFLPQSPQLFKQLMVAGMERYYQIARCYRDEDFRADRQ-PEFTQLDMEMSFVDAEDIIAISEEVLTELWALIGYR---------------IPTPIPRIGYAEAMRRFGTDKPDLRFGLELVECTDFFSDTTGLIDPDAWAFVWVVDPPAVHHAF-RIESDTGSVLADAYDIVC-NGHEIGGGSVRIHRRDIQERVFAVMGLDKAEFGFLLEAFMFGAPPHGGIAFGWDRTTALLAGMDSIREVIAFPKTGG.... 578
30 -79.1001eqr_A mol:protein length:590 ASPARTYL-TRNA SYNTHETASE  ali model follow..  21  11......................................LSHVGQQVTLCGWVNRRRDLGS-LIFIDMRDREGIVQVFFDPDRADAKLASELRNEFCIQVTGTVRARDEKDMATGEIEVLASSLTIINRA-DVLPLDSN-HVNTEEARLKYRYLDLRRPEMAQRLKTRAKITSLVRRFMDDHGFLDIETPMLTKATPEGARDYLVPSRVHKGKFLPQSPQLFKQLMMSGFDRYYQIVKCFRDEDLRADRQ-PEFTQIDVETSFMTAPQVREVMEALVRHLWLEVKGV---------------DLGDFPVMTFAEAERRYGSDKPDLRNPMELTDVADL-PMFEDDGEGGLTAMHHPFTSPKDMTA-AELKAAPENAVANAYDMVI-NGYEVGGGSVRIHNGDMQQTVFGILGINEEEFGFLLDALKYGTPPHAGLAFGLDRLTMLLTGTDNIRDVIAFPKTTAAACL 563
31 -79.0004ah6_A mol:protein length:617 ASPARTATE--TRNA LIGASE, MITOCHONDRIAL  ali model follow..  22  2....................IPEFSSFVVRTNTCGELRSSHLGQEVTLCGWIQYRRQNT----FLVLRDFDGLVQVIIPQDESAASILCEAPVESVVQVSGTVISRPAGKMPTGEIEIKVKTAELLNACKKLPFEIKNFVKKTEALRLQYRYLDLRSFQMQYNLRLRSQMVMKMREYLCNLGFVDIETPTLFKRTPGG-AKEFLVPSREPGKFLPQSPQQFKQLMVGGLDRYFQVARCYRDEGSRPDRQ-PEFTQIDIEMSFVDQTGIQSLIEGLLQYSWPNDKDP---------------VVVPFPTMTFAEVLATYGTDKPDTRFGMKIECADLLETRGVVLRDPTLFSFLWVVDFPSAHHPFHLLYTEPKKARSQHYDLVL-NGNEIGGGSIRIHNAELQRYILATLLKEDVKLSHLLQALDYGAPPHGGIALGLDRLICLVTGSPSIRDVIAFPKSFR.... 570
32 -64.7004lns_A mol:protein length:351 Asparagine synthetase a  ali model follow..  12  3....................................................................................................................................................DDGYSSYV-LLQEQILTVKRSFSEALEKEL---NLVEVRAPILFRVGDEKAVQVPVKAIPNASFEVVHSLAKWKRRTLAPGHGLYTHMTALRVDDVLDNIHSVVVDQWDWEMVMKDDQRNLAFLKEVVCKVYAAIRKTELAVCEKYKQKPILHLLLAYPNLTAKEREREIAREYGAVGIGAVLSSGDRHDARAPDYDDWTSPVEASQVVFPRTSKPIPTMN-SLSSLKGLNGDILLDDSLEVSSMGIRVNAEALRHQISLTGDDSLLKSEWHQQLLNGEFPQTVGGGIGQSRMVMFMLRKKHIGEVQVWPEEIRKKHN 349
33 -62.4003a5y_A mol:protein length:345 Putative lysyl-tRNA synthetase  ali model follow..  19  2...........................................................................................................................................GSSSSGLVPRGSHMSEQPSASIPNLLKRAAIMAEIRRFFADRGVLEVETPCMSQAVTDIHLVPFETRFQGMNLWLMTSPEYHKRLLVAGCGPVFQLCRSFRNEEMGR-YHNPEFTMLEWYRPHYDMYRLMNEVDDLLQQVLDCPAAESLSYQQAFLRYLEIDPLS----ADKTQLREVAAKLDLSNVADTEEDRDTLLQLLFTFGVEPNIGKPTFVYHFPASQAS-LAQISTEDHRVAERFEVYYKGI-ELANGFHELTDAREQQQRFEQDNRKRAADQNLIEALKVGMPDCSGVALGVDRLVMLALGAETLAEVIAFS........ 335
34 -62.2003g1z_A mol:protein length:326 Putative lysyl-tRNA synthetase  ali model follow..  19  9...........................................................................................................................................................QPSASIPNLLKRAAIMAEIRRFFADRGVLEVETPCMSQAVTDIHLFPFETRFQGINLYLMTSPEYHKRLLAAGCGPVFQLCRSFRNEEMGR-HHNPEFTMLEWYRPHYDMYRLMNEVDDLLQQVLDCQ----PAESLSYQQAFQRHLEIDPLSADKTQLREAAAKLDLSNIADTEEDRDTLLQLLFTMGVEPHIGKPTFIYHFPASQAS-LAQISTEDHRVAERFEVYYKGI-ELANGFHELTDAREQQQRFEQDNRKRAADQNLLDALAAGLPDCSGVALGVDRLVMLALGAESLADVIAFT........ 322
35 -60.50011as_A mol:protein length:330 ASPARAGINE SYNTHETASE  ali model follow..  13  5...........................................................................................................................................................YIAKQRQISFVKSHFSRQLEERL---GLIEVQAPILSRVGAEKAVQVKVKALPDAQFEVVHSLAKWKRQTLGQHEGLYTHMKALRDEDRLSPLHSVYVDQWDWERVMGDGERQFSTLKSTVEAIWAGIKATEAAVSEEF--GLAPFLPDQIHFVHSQELLSRYPDLDAKGERAIAKDLGAVFLVGIGGKLSDGHVRAPDYDDWSTPSELGHAGLNGD---ILVWNPVLE-DAFELSSMGIRVDADTLKHQLALTGDEDRLELEWHQALLRGEMPQTIGGGIGQSRLTMLLLQLPHIGQVGVWPAAVRESVP 327
36 -32.5002zni_A mol:protein length:308 Pyrrolysyl-tRNA synthetase  ali model follow..  12  1..................................................................................MGSSSSGLVPRGSHMFLTRRDPPLSSFYQRLKELNASGEQLEMGFSDALSRDRAFQ-GIEHQLMSQGKRHLELRTVKHRPAL---LELEEKLAKALHQQGFVQVVTPTIITKSTIGEDHPLFSQVFDGKKCLRLAPNLYTERLWDKPIRIFEIGTCYRKESQGA-QHLNEFTMLNLTELGTPLEERHQRLEDMARWVLEAAREFELVTESSVVYGDTVDVMKGDLELASGAMGPHFLDEKWEIFDGLGFGLERLLMIREGTQHVQSMARSLSYLDGVR.......................................................................................................... 298
37 -32.2004gn3_B mol:protein length:113 OBody AM1L10  ali model follow..  20  18......................................PNLHGTEVVVAGWVASLGDYGR-VKIVKVSDREGGAAVSVYLEYGKTKVFAELSREDVVVIKGIVEASKAAADMHNGVEIFPSEIWILNKAK................................................................................................................................................................................................................................................................................................................................................ 113
38 -30.3005gro_A mol:protein length:115 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  25  16......................................EKDVGKIVKVAGWCNTYRDHGG-VVFIDLRDKSGLVQLVCDPSSKAYEKALEVRSEFVLVAKGKVRLRGAGKLKTGKIEIVLEELIIENKS................................................................................................................................................................................................................................................................................................................................................. 109
39 -30.2004gn4_B mol:protein length:108 OBody AM2EP06  ali model follow..  20  15......................................PNLHGSEVVVAGWVAHLGDYGR-VKIVKVSDREGGAAVPVYLERGKTKVFAELSREDVVVIKGIVEASEQYG-SATGVEIFPSEIWILNKA................................................................................................................................................................................................................................................................................................................................................. 108
40 -29.7004glv_B mol:protein length:107 OBody AM3L09  ali model follow..  21  14......................................PNLHGSEVVVAGWVAHLGDYGR-VKIVKVSDREGGAAVPVYLERGKTKVFAELSREDVVVIKGIVEATTVTRWD-TGVEIFPSEIWILNKA................................................................................................................................................................................................................................................................................................................................................. 107
41 -29.5004gla_C mol:protein length:109 OBody NL8  ali model follow..  20  5...........................PKKTHWTAEITPNLHGTEVVVAGWVASLGDYGR-VKIVKVSDREGGAAVPVYLEAGKTKVFAELSREDVVVIKGIVEASK---GVGRGVEIFPSEIWILNKAKA............................................................................................................................................................................................................................................................................................................................................... 109
42 -29.2004gn5_A mol:protein length:113 OBody AM3L15  ali model follow..  20  14......................................PNLHGSEVVVAGWVAHLGDYGR-VKIVKVSDREGGAAVPVYLERGKTKVFAELSREDVVVIKGIVEAGWPVALD-TGVEIFPSEIWILNKAKP............................................................................................................................................................................................................................................................................................................................................... 109
43 -23.1004tqd_A mol:protein length:291 Pyrrolysine--tRNA ligase  ali model follow..  18  1..................................................................................MGSSSSGLVPRGSHMASAPALTKSQTDR-----LEVLLNPKDEISLNSGKPFRELE------SELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEGIDNDTELSKQIFRVDKNFCLRPMLKLDRALPDPIKIFEIGPCYRKESDGKE-HLEEFTMLSFIQMGSGRENLESIITDFLNHLGIDFKIVGDS------------------CMVYGDTLDVMHG--------------------------------------------------------------------ELSSAVVGPIPLD------REWGIDKPWI---------------GAGFGLERLLKVKHDFKNIKRA............ 271
44 -22.7002e3c_A mol:protein length:291 Pyrrolysyl-tRNA synthetase  ali model follow..  19  1..................................................................................MGSSSSGLVPRGSHMASAPALTKSQTDR-----LEVLLNPKDEISLNSGKPFRELE------SELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEGIDNDTELSKQIFDKNFCLRPMLAPNLYNYLRKLDKIFEIGPCYRKESDGK-EHLEEFTMLNFCQMGSGRENLESIITDFLNHL----------------------------------GIDFKIVGDSCMVYGDTL---------------------------------------------------------DVMHGDLELSSAVVGPIPLDREGIDK---------------PWIGAGFGLERLLKVKHDFKNIKRA............ 271
45 -22.0004bw9_A mol:protein length:291 PYRROLYSINE--TRNA LIGASE  ali model follow..  14  4.....................................................................................SSSGLVPRGSHMASAPALTKSQTDRLE-----VLLNPKDEISLNSGKPFRELESELLSRRKK------DLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEGIDNDTELSKQIFDKNFCLRPMLAPNLGNYLRKLDKIFEIGPCYRKESDG-KEHLEEFTMLNFCQ--MGSGCTRENLESIITDFLNHL----------------------IDFKIVGDSCMVFGDTLDVMHGDLELSSAVVGPRPLDREWG--IDKPWIGAGFGLERLL-KVKHDFKNIKRAARSESYYNG................................................................................ 280
46 -21.7005k1p_A mol:protein length:274 Pyrrolysine--tRNA ligase  ali model follow..  17  6....................................................................................................................KSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEGIDNDTELSKQIFRVDKNFCLRPMLAPNLYLPDPIKIFEIGPCYRKESDGKE-HLEEFTMLAFAQMGSGRENLESIITDFLNHL--------------------------------------------------------------------------------------------DFKIVGDSCMVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWI---------------GAGFGLERLLKVKHDFKNIKRA............ 254
47 -21.7004q6g_A mol:protein length:267 Pyrrolysine--tRNA ligase  ali model follow..  16  1................................................................................................................PALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGI-QIFRVDKNFCLRVAPNIFNYARKLDRAKIFEIGPCYRKESDGKE-HLEEFTMLNFFQ--MGSGCTRENLESIITDFLNHLGIDFKIVGD--------------SCSVYGDTLDVMHG--------------------------------------------------------------------ELSSAVVGPIPLD------REWGIDKPWI---------------GAGFGLERLLKVKHDFKNIKRA............ 253
48 -20.3003qtc_A mol:protein length:290 Pyrrolysyl-tRNA synthetase  ali model follow..  17  3...................................................................................................GGLVPRGSHGASAPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEGIDNDTELSKQIFRVDKNFCLRPMLTPNLYNYLRKKIFEIGPCYRKESDG-KEHLEEFTMLVFWQMGSGRENLESIITDFLNHL........................................................................................................................................................................................... 198
49 -17.0004cs2_A mol:protein length:274 PYRROLYSINE--TRNA LIGASE  ali model follow..  16  6....................................................................................................................KSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEGIDNDTELSKQIFRVDKNFCLRPMLAPNLANYLRKKIFEIGPCYRKESDG-KEHLEEFTMLNFCQ--MGSGCTRENLESIITDFLNHL....................................................................................................................................................................................... 184
50 -14.1002rhq_A mol:protein length:294 Phenylalanyl-tRNA synthetase alpha chain  ali model follow..  13  3...........................................................................................................................SSSSGLVPRGSHMGTELMEKLNQQLAEETIDVTLPSRQGSKHPLTRTVEEIEDLFLGLGYEIVDGYEVEQDKSHPARDMQDSFYITDEILMRTHTSPVQARTMEKRNKIICPGKVYRRDSDDAT-HSHQFTQIEGLVV-IKMSDLKGTLELVAKKLFGADREIRLRPSYF-----------PFTEPSVEVDVSCFKCKGKGCNVCKHTGW-------------------------------------------------------EILGAGM------VHPNVLEMAGFDSNEYSGF------------AFGMGPDRIAMLKYGIEDIRYF............ 269
51 -13.0004gnx_B mol:protein length:136 Putative uncharacterized protein  ali model follow..  16  2........KKAGNNTLRPVTIRQILNAEQPHPDAEFILDGAELGQLTFVAVVRNISRNATNVAY-SVEDGTGQIEVRLDSSSDDSSKASEIRNNVYVRVLGTLKSFQNRR------SISSGHMRPVIDYNE............................................................................................................................................................................................................................................................................................................................................... 119
52 -12.8001b70_A mol:protein length:350 PHENYLALANYL-TRNA SYNTHETASE  ali model follow..  11  2..................................................................LEEALAAIQNARDLEELKALKARYLGKKGLLTQEMKGLSALPLEERRKRGQELNAIKAALEAALEAREKALEEAALKEALERERVDVSLPGASLFS-LHPITLMERELVEIFRALGYQAVEGPEVESEPARDMWDTFWLTGEGFRLEGPLGEEVEGRLLLRTHTRIVVPGRVFRFEQTDAT-HEAVFHQLEGLVV-IAMAHLKGAIYELAQAL--------------------------------------------------------------------------FGPDSKVRFQPVYF------PFVEPGAQFAVGKWLELGGAGM--------PKVFQAVDAYRERLGLPPAYRGVTG----AFGLGVERLAMLRYGIPDIRYF............ 335
53 -12.4004p71_C mol:protein length:338 Phenylalanine--tRNA ligase alpha subunit  ali model follow..  12  8..................................................................VSQALEAVRHTEDVNALEQIRVHYLGKKGELTQVMKTLGDLPAEERPKVGALINVAKEKVQDVLNARKTELEGAALAARLAAERIDVTLPGRGQLS-LHPVTRTLERIEQCFSRIGYEVAEGPEVEDDGHHPARAMHDTFYFNANMLLRTHTSPVQVRTMESQQRIVCPGRVYRCDSDLT--HSPMFHQVEGLLV-VSFADLKGTIEEFLRAFFEKQLEVRFRPSFF-----------PFTEPSAEVDIQCVICSGNGCRVCKQTGW-------------------------------------------------------EVMGCGM------VHPNVLRMSNIDPEKFQGF------------AFGMGAERLAMLRYGVNDLRLF............ 326
54 -12.3001nnx_A mol:protein length:109 Protein ygiW  ali model follow..  11  21...........................PNGSVTTVESAKSLDDTWVTLRGNIVERISDDL----YVFKDASGTINVDIDHKRWNG---VTVTPKDTVEIQGEV------DKDWNSVEIDVKQIRKVNP.................................................................................................................................................................................................................................................................................................................................................. 109
55 -12.2004g85_A mol:protein length:517 Histidine-tRNA ligase, cytoplasmic  ali model follow..  12  7.................................................................................ELRRQMAERAALEELVKLQGERVRGLKQQKASA--ELIEEEVAKLLKLKAQLGPDESKQKFVLKTPKGTRDY------SPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKEGEDSKLIYDLKDQGGEL-LSLRYDLTVPFARYLAMKRYHIAKVYRRDNPAMTRRYREFYQCDFDIPMIPDAECLKIMCEILSSLICGVSDSKFRTICSSVDKLDKVSWEEVKNLAPEVADRIGDYVQQHGGVSLVEQLLQDPKLSQNKQALEGLGDLKLLFEYLTLFG--IDDKISFDLSLARGLDYYTGVIYEVAAGG----RYDGLVGMFDPKGRK---------------VPCVGLSIGVERIFSIV..................... 404
56 -11.9003pco_A mol:protein length:327 Phenylalanyl-tRNA synthetase, alpha subunit  ali model follow..  12  8..................................................................VASAKAAISQASDVAALDNVRVEYLGKKGHLTLQMTTLRELPPEERPAAGAVINEAKEQVQQALNARKAELESAALNARLAAETIDVSLPGRRIEN-LHPVTRTIDRIESFFGELGFTVATGPEIEDDGHHPARADHDTFWFDTTRLLRTSGVQIRTMKAQQPPIRIIAPGRVYRNDYDQT-HTPMFHQMEGLIV-ISFTNLKGTLHDFLRNFFEEDLQ----------------------------------------------------------------------IRFRPSYFPF------TEPSAEVDVMGKNGKWLEVLGCGM---------NVLRNVGIDPEVYSGF------------AFGMGMERLTMLRYGVTDLRSF............ 315
57 -11.7002el9_A mol:protein length:431 Histidyl-tRNA synthetase  ali model follow..  14  26...................................................................................................................................................................TAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTDVVEKEMYLTLRPEGTAGCVRAGIERLWYIGPMFRHERPQKGRY-RQFHQLGCEVFGLQ--ELIMLTARWWRAL--GISEHVTLELNSIGSLEARANYRDALVAFLEQHKEKLDEDCKRRMYTNPL---RVLDSKNPEVQALLNDAPALGDYLDEESREHFAGLCK-NQRLVRGLDYYNRTVFEWVTNSLGSQGT-----------CAGGRYDGLVEQLGGRATPAVGFAMGLERLVLLV..................... 323
58 -11.6001wu7_A mol:protein length:434 Histidyl-tRNA synthetase  ali model follow..  10  20...................................................................................................................................................................MDVEKFIFKTAEEAAEAFGFRRIDFPSLEYLDLELLQQTYSFVDKGGRE-VTLIPEATPSTVRMVTSRWYSFPKVWRYEEPQAGRY-REHYQFNADIFGSD--EVIALASSILDRL-RKIMEEIIGGMTSSDPFSVFSIIDRYHKISREEFVDQLRSAGIGEDGVSMIADLCSGTRGIDEMARITGKSSEEIARMAA-LASYGVKNVRYDFSIVRGLSYYTGIVFEILGGGR---------------------YDNLASLMSGESVPAVGFGMGDAVISLLL..................... 321
59 -11.6004g84_A mol:protein length:464 Histidine--tRNA ligase, cytoplasmic  ali model follow..  12  4...........................................................................................................................................SEFELRRQFVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKEGEDSKLIYDLKDQGGEL-LSLRYDLTVPFARYLAMKRYHIAKVYRRDNPAMTRRYREFYQCDFDIPMIPDAECLKIMCEILSSLICGVSDSKFRTICSSVDKLDKVSWEEVKNLAPEVADRIGDYVQQHGGVSLVEQLLQDPKLSQNKQALEGLGDLKLLFEYLTLFG--IDDKISFDLSLARGLDYYTGVIYEVAAGG----RYDGLVGMFDPKGRK---------------VPCVGLSIGVERIFSIV..................... 351
60 -11.5005e3i_A mol:protein length:438 Histidine--tRNA ligase  ali model follow..  13  20...................................................................................................................................................................TAAWRRLEQHLASLMDAYGYQQIRLPIVEQTGLFKRAIGDATDIVEKEMYLTLRPEGTAGCVRALVERVWYMGPMFRYEKPQKGRY-RQFHQFGVETFGVA--ELIMLTARLWKRM--GVDHMVQLELNTLGETDERTEYRNALVAFLNEHKDALDEDSQRRLTTNPL---RILDSKIESTQKILENAPKLHDFLKEDSLSHFQQLQD-NQKLVRGLDYYNKTVFEVCAGG----RYDGLVGQLKGKADQS--------------VPAVGFAMGMERLLLLL..................... 322
61 -11.4004rdx_A mol:protein length:423 Histidine--tRNA ligase  ali model follow..  14  2..................................................................................................................................................PMTARAVRGTKDLFGKELRMHQRIVATARKVLEAAGALELVTPIFEETQVFEKGVGAATDIVRKEMFLTLRPEGTAAMVRAYLERLWMAGPMFRAERPQKGRY-RQFHQVNYEALGSE--EAVVLLYECLKEL----LRRLKVKLSSVGDPEDRARYNAYLREVLSPHREALSEDSKERLELNPMR---DSKSERDQALLKELGVRPMLDFLGEEARAHLKEVER-EPALVRGLDYYVRTAFELGGGGR---------------------YDGLSELLGGPRVPGVGFAFGVERVALAL..................... 318
62 -11.3004e51_A mol:protein length:467 Histidine--tRNA ligase  ali model follow..  12  40...................................................................................................................................................................AGLWEFFEATVKSLLRAYGYQNIRTPIVEHTPLFTRGIGEVTDIVEKEMYLTLRPENTAAVVRAAIERLWYIGPMFRHERPQRGRY-RQFHQVGVEALGFA--EIVMMCQRLWEDL----LTGIKLEINSLGLAEERAAHRVELIKYLEQHADKLDDDAQRRLYTNPLRVLDTKNPALQEIVRNA---PKLIDFLGDVSRAHFEGLQR-NPRLVRGLDYYNLTVFEVAAGGR---------------------YDPLIEQLGGKPTAACGWAMGIERILELLKEEHLVPE............. 345
63 -11.2003net_A mol:protein length:465 Histidyl-tRNA synthetase  ali model follow..  10  1..........................................................................................................................................SNAMAKNDKINFSTPSGFPEFLPSEKRLELYLLDTIRRVYESYGFTPIETPVLQAKGNQGDNIIYGLEPILPPN-RALKFDQTVPLAAYIARARYQMDVVFRGERAKDGRF-RQFRQCDIDVSLLYDAQMPAIITEIFEAV--VIRINNRKVLTGFFQSLNISETQIKSCISIIDNLEKIGEAKVKLELEKEGINPEQTQKIID-----------------------FVKIDGSVDDVLDKLKHLSQTLPESEQFNLGVSELETVITGVRNLGVPDKRFNYYTGTVRYEKMPGVGISIGLTRLISRLLKAGILNTL............ 367
64 -11.1001qe0_A mol:protein length:420 Histidine--tRNA ligase  ali model follow..  12  16...................................................................................................................................................................SKKWRYIENQLDELMTFYNYKEIRTPIFESTDLFARGVGDSTDVVQKEMYITLRPEGTAAVVRSYIEKLYYNGPMFRYERKQKGRY-RQFNQFGVEAIGAE--EVLAMVMHIYQSF----LKHLKLVINSVGDMASRKEYNEALVKHFEPVIHEFCSDCQSRLHTDPM---RILDCKVDRDKEAIKTAPRITDFLNEESKAYYEQVKA-DPNLVRGLDYYTHTAFELMMDNPNYDGAITTLCG--------GRYNGLLELLDGPSETGIGFALSIERLLLAL..................... 317
65 -10.9003kf6_A mol:protein length:159 Protein stn1  ali model follow..  15  48...........................................RWIQIVGYIAAIDIYEGKHVL-TVDDCSGMVLRVVQDDFSMSKRAISMSPGNVVCVFGKINSFRSEV------ELIAQSFEELRDPNDEW............................................................................................................................................................................................................................................................................................................................................. 133
66 -10.7006FTT Entity 1(prereleased)  ali follow..  15...................................................................................................................................................................AHKQEVLRHQLTQQLITHGYQLVSPPMISGASEDLKRQTFKIIDQLTGRLMGIRADITPQILRIDAHRYCYAGDVIHTLPSGLFGS-RTPLQLGAEISIAADIELIDVLFSMINSLFKRLAELAALSASDTEQLMQLYANKNLPELKGHDIANLLGRLSENAQQDTKIVTAIDELQRLKAHLQVQWQCAVSIDVTELSGYHYHT------------FNGYINSETQPLVRGGR---FDGMKSNQLATNQPR---------------QATGFSMDVSRLLAHT..................... 319
67 -10.7005m8h_A mol:protein length:388 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  15...................................................................................................................................................................AHKQEVLRHQLTQQLITHGYQLVSPPMISGASEDLKRQTFKIIDQLTGRLMGIRADITPQILRIDAHRYCYAGDVIHTLPSGLFGS-RTPLQLGAEISIAADIELIDVLFSMINSLFKRLAELAALSASDTEQLMQLYANKNLPELKGHDIANLLGRLSENAQQDTKIVTAIDELQRLKAHLQVQWQCAVSIDVTELSGYHYHT------------FNGYINSETQPLVRGGR---FDGMKSNQLATNQPR---------------QATGFSMDVSRLLAHT..................... 319
68 -10.7003hrk_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  10  2................................................................................................................................AMGTLEAQTQGPGSMQKNMVETEPVQGCRDFPPEAMRCRRHLFDVFHATAKTFGFEEYDAPVLESEELEITEQMFNFITKGGHR-VALRPEMTPSLARLLLGKWYSIPQCWRYEAITRGRR-REHYQWNMDIVGVK--ELVCAACWAMRSL-RKVLQTVVEQAGVTSDKFAPVCVDKMEKIPREEVEAQLAVLGLEPTVVDAITTTLSLKSI-DEIAQRVGEEHEAVKELRQFFEQVEAYGYGDDASVVRGLAYYTGIVFELCGGG----RYDNLLTTYGSPT----------------PIPCAGFGFGDCVIVELLQEKRLLPDI............ 352
69 -10.6003hri_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  12  37...................................................................................................................................................................MRLRKYLFDVFHSTARKFGFEEYDSPVLESEELEITEQMFNFITKGGHR-VALRPEMTPSLARQLLAKWYSIPQCWRYEAITRGRR-REHYQWNMDIIGVK--ELVCAACTAMQSL-RKILQTVVEQAGVSADKFAPVCVDKMEKLPREEVVAQLAAIGLESNVVDAITSTLSLKTIDEQRIGEEHEAVRELRDFITQIEAYFGDWVIFDASVVRGLAYYTGIVFELCGGG----RYDNLLTTYGSPT----------------AVPCVGFGFGDCVIVELLNEKKLLPEL............ 352
70 -10.4002pi2_A mol:protein length:270 Replication protein A 32 kDa subunit  ali model follow..  12  32.PSQAEKKSRARAQHIVPCTISQLLSATLVDEV---RIGNVEISQVTIVGIIRHAEKAPTNIVY-KIDDMTAAPMDVRVDTDDTSSENTVVPPETYVKVAGHLRSFQNKKSEFTTHILEVINAHMVLSKANSQPSAGRAPISNPGMSEAGNFGGNSFMPANGLTVAQNQVLNLIKACPRPEG--------------------------NFQDLKNQLKHMSVSSIKQAVDFLSNEGHIYSTVDDD------HFKSTDAE............................................................................................................................................................................................................... 270
71 -9.9904joi_A mol:protein length:166 CST complex subunit STN1  ali model follow..  10  37...........................................KQVDVLGTVIGVRERDAFYSY-GVDDSTGVINCICKKLQETIEQKTKIEIGDTIRVRGSIRTYREER------EIHATTYYKVD-----------DPVWNIQIARMLELPTIYRKVYDQPFH............................................................................................................................................................................................................................................................................................................. 165
72 -9.9603l4g_A mol:protein length:508 Phenylalanyl-tRNA synthetase alpha chain  ali model follow..  10  108...........................................................MSNKWIRVDKSAADGPRVFRVVDSMEDEVQRRLQLVRGGQAEKLGEKERSELRKRKLLAEVTLKTYWVSKGSAFSTSISKQETELEMISSGSWRDRPFKPYNFLAHGVLKVRSQFRQIFLEMGFTEMPTDALFQPQQHPARDQHDTFFLRDPAEALQLPMDYVQRVKRTHSKYFSIDRVFRNETLDAT-HLAEFHQIEGVVA-LTLGHLMGVLREFFTKLGIT-------------------------------------------------------------------------LRFKPAYNPYTEPSMEVFSYHQGLKKWV-----EVGNSGV------FRPEMLLPMGLPENVSVI-------------AWGLSLERPTMIKYGINNIREL............ 477
73 -9.9301z7m_A mol:protein length:344 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  11  30...................................................................................................................................................................VKSLRQIEGRLRKLFSLKNYQEVMPPSFEYTQLYTALESNGKTFNQEKMFITLRYDFTLPLVRLYSQRYSYFGKIFRKEKRHKGRS-TENYQIGIELADKSELEILSLALQVIEQLLTELLLKKDLSGLNAFIEKNNFSKELRGLLKEIFITNELSRLENLVTNTKDDVLISSFDQLKEFSEKLSMIKPIIIDLGMVPKMDYYT------------FKAYSSAANQPILSGGRYDQL----------------------LSNFQEEFAIGFCCHMDTILKALERQELEED............. 336
74 -9.8104h2w_A mol:protein length:346 Amino acid--[acyl-carrier-protein] ligase 1  ali model follow..  34...............................................................................................................................................LDHLADKLFHSMGSDGVYARTALYESIVERLAALITSAGTEALRFPPVMSRAQLEKSGYLK-SLSPADLVLSPAACYPVYPIAAS--RFDVAADCFRREPSKHLDRLQSFRMREY-VCIGTPDDVSDFRERWMVRAQA------------------------ARDLGLTFRVDYASD-------------------------------------------PFFGRAGKMLANNQLKFELLIPLRSE--EQPTACMSFNYHREHFGTT----------IQDANGEPAHTGCVAFGMDRLAVAMFHTHGT-DLSAWPAKVRD... 322
75 -9.7703rac_A mol:protein length:373 Histidine-tRNA ligase  ali model follow..  12  37...................................................................................................................................................................AKRRRAVETRLLSFVEDAGYEPVTSGLFEARSPESSRDWIRLFDGGGDA-VALRPEMTPSIARMAAPRWCYCERVYRRTDDPASLKAAESTQVGIER--IGEEASVDVDMDVLRLLHEASAAAGVRHHRIVVSHARLV--------RLLDALGISASLSRAFLACLTSGNYVQFRELWQLHAAKDVDLLANLLTWSPAERDAAKRSREASDRELEALLRDAVDPRAAADVRDAWRYLCRLAEALHDSGLASDELDYYTGLVQFGAGPAVGFAFEVERVMAVLEAQEEGEGEC........... 373

FFAS is supported by the NIH grant R01-GM087218-01
1 2 6 4 6 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Rodrigues AP, Grant BJ, Godzik A, Friedberg I. The 2006 automated function prediction meeting. BMC Bioinformatics. 2007 May 22;8 Suppl 4:S1-4.