current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 6FTT Entity 1(prereleased), from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .
# Score Template Links and tools%idFirst GMLPDGVADVLFEDAHKQEVLRHQLTQQLITHGYQLVSPPMIEFTESLLSGASEDLKRQTFKIIDQLTGRLMGIRADITPQILRIDAHHGGDGIARYCYAGDVIHTLPSGLFGSRTPLQLGAEIFGCESIAADIELIDVLFSMINSLDMSAVLHVDLGHVTIFKRLAELAALSASDTEQLMQLYANKNLPELKQVCQVLPMGSDFYTLARFGHDIANLLGRLSENAQQDTKIVTAIDELQRLKAHLQVQWQCAVSIDVTELSGYHYHTGIVFNGYINSETQPLVRGGRFDGMKSNQLATNQPRQATGFSMDVSRLLAHTQLDAPFIVLIDYDAFNNLDSAQRQLLLQQVASLRQQGYRVTMPLTAEDMPVGLTHRLSLADNQWRLHAVLast
1 -109.0006FTT Entity 1(prereleased)  ali  100  1GMLPDGVADVLFEDAHKQEVLRHQLTQQLITHGYQLVSPPMIEFTESLLSGASEDLKRQTFKIIDQLTGRLMGIRADITPQILRIDAHHGGDGIARYCYAGDVIHTLPSGLFGSRTPLQLGAEIFGCESIAADIELIDVLFSMINSLDMSAVLHVDLGHVTIFKRLAELAALSASDTEQLMQLYANKNLPELKQVCQVLPMGSDFYTLARFGHDIANLLGRLSENAQQDTKIVTAIDELQRLKAHLQVQWQCAVSIDVTELSGYHYHTGIVFNGYINSETQPLVRGGRFDGMKSNQLATNQPRQATGFSMDVSRLLAHTQLDAPFIVLIDYDAFNNLDSAQRQLLLQQVASLRQQGYRVTMPLTAEDMPVGLTHRLSLADNQWRLHAV 388
2 -109.0005m8h_A mol:protein length:388 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  100  1GMLPDGVADVLFEDAHKQEVLRHQLTQQLITHGYQLVSPPMIEFTESLLSGASEDLKRQTFKIIDQLTGRLMGIRADITPQILRIDAHHGGDGIARYCYAGDVIHTLPSGLFGSRTPLQLGAEIFGCESIAADIELIDVLFSMINSLDMSAVLHVDLGHVTIFKRLAELAALSASDTEQLMQLYANKNLPELKQVCQVLPMGSDFYTLARFGHDIANLLGRLSENAQQDTKIVTAIDELQRLKAHLQVQWQCAVSIDVTELSGYHYHTGIVFNGYINSETQPLVRGGRFDGMKSNQLATNQPRQATGFSMDVSRLLAHTQLDAPFIVLIDYDAFNNLDSAQRQLLLQQVASLRQQGYRVTMPLTAEDMPVGLTHRLSLADNQWRLHAV 388
3 -86.5003od1_A mol:protein length:400 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  24  12..KPFGMRDTLPEWYKTKKNICDQMTEEINLWGYDMIETPTLEYYETV-GVVSAILDQQLFKLLDQ-QGNTLVLRPDMTAPIARLVASSLKDYPLRLAYQSNVYRAQQNEGGKPAEFEQLGVELIGDGTASADGEVIALMIAALKRAGLSE-FKVAIGHVGYVNALLMDVVGNEQRADRLRRFLYEKNYVGYREHVKSLNLSSRLMNLLSLRGGRAAIEEARG--LIQTEKGKTALAEMTKLYEVLESYGSEYVKFDLTLVLHMSYYTGVVFEGYGNRLGVPLCSGGRYDELLSKF---HRPAQATGFGVRIDLLVEALNGEIISNG--HEQTCILFSNERRFEAIELARKKRANGEAVVLQDLAGVTDVDAMS----SNYQDVIYCI 390
4 -84.7001z7m_A mol:protein length:344 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  21  17.LLPEESAEMTLNQVKSLRQIEGRLRKLFSLKNYQEVMPPSFEYTQLYTALESNGNQEKMFQFIKH-EGQSITLRYDFTLPLVRLYSQIKDSTSARYSYFGKIFRKEKRHKGRSTENYQIGIELFGESADKSELEILSLALQVIEQLGLNK-TVFEIGSAKFFQRLCQ---LADGSTELLTELLLKKDLSGLNAFIEKNNFSKELRGLLKEIFITNELSRLEN--LVTNTKDDVLISSFDQLKEFSEKLSIKPIIIDLGMVPKMDYYTDLMFKAYSSAANQPILSGGRYDQLLSNF---QEEAFAIGFCCHMDTILKALERQELEEDN............................................................ 337
5 -84.0003rac_A mol:protein length:373 Histidine-tRNA ligase  ali model follow..  19  25..RPPGMQDGYPDFAKRRRAVETRLLSFVEDAGYEPVTSGLFEYVDTLLRARSPESSRDWIRLFDG-GGDAVALRPEMTPSIARMAAPRVAATPIRWCYCERVYRRTSWASGKAAESTQVGIERIGEEAVDVDMDVLRLLHEASAAAGVRH-HRIVVSHARLVPRLLDALGISASLSRAFLACLTSGNYVQFRELWQLHAAKDAAKRSREASDRELEALLRDAVDPRAAADVRDAWRYLCRLAEALHDSGSDVVTFDLALHRELDYYTGLVFEMFAPGVGAPIAQGGRYDELLAQF---GAGAPAVGFAFEVERVMAVLEAQEEGEGEC........................................................... 373
6 -82.4001wu7_A mol:protein length:434 Histidyl-tRNA synthetase  ali model follow..  18  9...IRGFRDFYPEDMDVEKFIFKTAEEAAEAFGFRRIDFPSLEYLDLYRIKSGEELLQQTYSFVDK-GGREVTLIPEATPSTVRMVTSRKDQRPLRWYSFPKVWRYEEPQAGRYREHYQFNADIFGSDSPEADAEVIALASSILDRLGLQDIYEIRINSRKIMEEIIG--GMTSSDPFSVFSIIDRYHKISREEFVDQLRSAGIGEDGVSMIADLCSGTRGIDEMARITGKSSEEIARMAAVEDLLASYGVKNVRYDFSIVRGLSYYTGIVFEAYDRGQFRAILGGGRYDNLASLMS--GESVPAVGFGMGDAVISLLLKRENVQPREKKSVYICRVGKINSSIMNEYSRKLRERGMNVTVEIMERGLSAQLKY----ASAIGADFAV 387
7 -81.2003hrk_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  19  26...VQGCRDFPPEAMRCRRHLFDVFHATAKTFGFEEYDAPVLESEELYIRKAGEEITEQMFNFITK-GGHRVALRPEMTPSLARLLLGKGRSLPAKWYSIPQCWRYEAITRGRRREHYQWNMDIVGVKSVSAEVELVCAACWAMRSLGLSKDVGIKVNSRKVLQTVVEQAGVTSDKFAPVCVIVDKMEKIPREEVEAQL-AVLGLEPTVVDAITTTLSLKSIDEIAQRVGEEHEAVKELRQFFEQVEAYGGDWVLFDASVVRGLAYYTGIVFEGFDRGKFRALCGGGRYDNLLTTYGS-PTPIPCAGFGFGDCVIVELLQEKRLLPPHVVDDVVIPFDESMRPHALAVLRRLRDAGRSADIILDKKKVVQAFNY----ADRVGAVRAV 410
8 -80.5003hri_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  19  26...VQGCRDFPPETMRLRKYLFDVFHSTARKFGFEEYDSPVLESEELYIRKAGEEITEQMFNFITK-GGHRVALRPEMTPSLARQLLAKGRSLPAKWYSIPQCWRYEAITRGRRREHYQWNMDIIGVKSVSSEVELVCAACTAMQSLGLSSDVGVKINSRKILQTVVEQAGVSADKFAPVCVIVDKMEKLPREEVVAQLAAIGLESNVVDAITSTLSL-KTIDEIAQRIGEEHEAVRELRDFITQIEAYGGDWVIFDASVVRGLAYYTGIVFEGFDRGNFRALCGGGRYDNLLTTYGS-PTAVPCVGFGFGDCVIVELLNEKKLLPHHVVDDLVIPFDETMRPHALSILRRLRDAGRSADIVFDKKKVVQAFNY----ADRIGALRAV 410
9 -78.0004g85_A mol:protein length:517 Histidine-tRNA ligase, cytoplasmic  ali model follow..  15  69..TPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGED-SKLIYDLKDQ-GGELLSLRYDLTVPFARYLAMNKL-TNIKRYHIAKVYRRDNPARGRYREFYQCDFDIAGNFDPMPDAECLKIMCEILSSLQIGD-FLVKVNDRRILDGMFAICGVSDSKFRTICSSVDKLDKVSWEEVKNEMVGEKRIGDYVQQHGGVSLVEQLLQDPLSQNKQALEGLGDLKLLFEYLTLFGDDKISFDLSLARGLDYYTGVIYEAVLLQTPGSVAAGGRYDGLVGMFDPKGRKVPCVGLSIGVERIFSIVEQRLEALTTETQVLVASAQKKLLEERLKLVSELWDAGIKAELLYKKNP---KLLNQLQYCEEAGIPLVA 475
10 -77.1003net_A mol:protein length:465 Histidyl-tRNA synthetase  ali model follow..  14  14..TPSGFPEFLPSEKRLELYLLDTIRRVYESYGFTPIETPAVERLEVLQAKGNQGRQAEKDKSGDT-GSEARALKFDQTVPLAAYIARHLNDFPFARYQMDVVFRGERAKDGRFRQFRQCDIDVVGRESLLYDAQMPAIITEIFEAVNIGD-FVIRINNRKVLTGFFQSLNISETQIKSCISIIDNLEKIGEAKVKLELEKEGKIIDFVKIDGSVDDVLDKLKHLLPESEQFNLGVSELETVITGVRNLGDKRFCIDLAIARGLNYYTGTVYETTLIGHEGSICSGGRYEELVGTFI--GEKMPGVGISIGLTRLISRLLKAGILNPTPAQVVVVNMQDELMPTYLKVSQQLRQAGLNVITNFEKRQLGKQ----FQAADKQGIRFCV 426
11 -76.8005e3i_A mol:protein length:438 Histidine--tRNA ligase  ali model follow..  17  8..AIKGFNDVLPTQTAAWRRLEQHLASLMDAYGYQQIRLPIVEQTGLFKRAIGDAVEKEMYTFFDKGNPESLTLRPEGTAGCVRALVEHNRGATPRVWYMGPMFRYEKPQKGRYRQFHQFGVETFGVATPDIDAELIMLTARLWKRMGVDHMVQLELNTLGETDERTEYRNALVAFLNEHKDALDEDSQRRLT--------TNPLRILDSKIESTQKILENAPKLH--DFLKEDSLSHFQQLQDYLTAAG-IKFVINQKLVRGLDYYNKTVFEWTTTGSQGTVCAGGRYDGLVGQLKGKAQSVPAVGFAMGMERLLLLLEQVEQAEIVRDCEAFLVAEPAYQSKALVLAEQLRDQLEAANSNIRIKTGQGSMKSQMKKADQAGAVYAI 392
12 -76.8004g84_A mol:protein length:464 Histidine--tRNA ligase, cytoplasmic  ali model follow..  15  16..TPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGED-SKLIYDLKDQ-GGELLSLRYDLTVPFARYLAMNKL-TNIKRYHIAKVYRRDNPTRGRYREFYQCDFDIAGNFDPMPDAECLKIMCEILSSLQIGD-FLVKVNDRRILDGMFAICGVSDSKFRTICSSVDKLDKVSWEEVKNEMVGEKRIGDYVQQHGGVSLVEQLLQDPLSQNKQALEGLGDLKLLFEYLTLFGDDKISFDLSLARGLDYYTGVIYEAVLLQTPGSVAAGGRYDGLVGMFDPKGRKVPCVGLSIGVERIFSIVEQRLEALTTETQVLVASAQKKLLEERLKLVSELWDAGIKAELLYKKNP---KLLNQLQYCEEAGIPLVA 422
13 -75.3004e51_A mol:protein length:467 Histidine--tRNA ligase  ali model follow..  18  28..GVKGMNDILPQDAGLWEFFEATVKSLLRAYGYQNIRTPIVEHTPLFTRGIGEVVEKEMYSFVDALNGENLTLRPENTAAVVRAAIEHNYDGPKRLWYIGPMFRHERPQRGRYRQFHQVGVEALGFAGPDADAEIVMMCQRLWEDLGLTG-IKLEINSLGLAEERAAHRVELIKYLEQHADKLDDDAQRRLYT--------NPLRVLDTKNPALQEIVRNAPKLI--DFLGDVSRAHFEGLQRLLKANN-VPFTINPRLVRGLDYYNLTVFEWVTDGAQGTVAAGGRYDPLIEQLG--GKPTAACGWAMGIERILELLKEEHLVPEQEVDVYVVHQGDAAREQAFIVAERLRDTGLDVILHCSADGAGASFKSQMKRADASGAAFAV 407
14 -75.2001usy_A mol:protein length:275 ATP PHOSPHORIBOSYLTRANSFERASE REGULATORY SUBUNIT  ali model follow..  18  2........DFLDFE------KVFSFYSKATKKGFSPFFVPALEKAEEP----------AGNFFLDR-KGNLFSIREDFTKTVLNHRKRYSPDSQIKVWYADFVYRYSG---SDLVAEYQLGLEKVPRNSLDDSLEVLEIIVESASEFFEGP-VIVEIGHTGVYEDLLK--EIPKDLHEKVLNLIDTKNLAEIEFLSHMKKIDLSRVEKIIEDSI----YRRSPEHLKTMDLPLSVREDLLSASSFLQEKFTVSVEIDLTLARTIEEYCGLIFTIYDTSSSRLVAAGGEYTVNGE---------KGVGGSIFLEGK......................................................................... 273
15 -75.0002el9_A mol:protein length:431 Histidyl-tRNA synthetase  ali model follow..  18  14..AIRGMNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVVEKEMYTFEDR-NGDSLTLRPEGTAGCVRAGIEHGYNQEQRLWYIGPMFRHERPQKGRYRQFHQLGCEVFGLQGPDIDAELIMLTARWWRALGISEHVTLELNSIGSLEARANYRDALVAFLEQHKEKLDEDCKRRMY--------TNPLRVLDSKNPEVQALLNDAPALG--DYLDEESREHFAGLCKLLESAG-IAYTVNQRLVRGLDYYNRTVFEWVTNGSQGTVCAGGRYDGLVEQLG--GRATPAVGFAMGLERLVLLVQAVNPEFDPVVDIYLVASGADTQSAAMALAERLRDEGVKLMTNHGGGNFKKQFAR----ADKWGARVAV 392
16 -74.4001qe0_A mol:protein length:420 Histidine--tRNA ligase  ali model follow..  16  5...PRGTQDILPEDSKKWRYIENQLDELMTFYNYKEIRTPIFESTDLFARGVGDSVQKEMYTFKDK-GDRSITLRPEGTAAVVRSYIEHKMNQPIKLYYNGPMFRYERKQKGRYRQFNQFGVEAIGAENPSVDAEVLAMVMHIYQSFGLKH-LKLVINSVGDMASRKEYNEALVKHFEPVIHEFCSDCQSRLH--------TDPMRILDCKVDRDKEAIKTAPRIT--DFLNEESKAYYEQVKAYLDDLG-IPYTEDPNLVRGLDYYTHTAFELMMDNPNTTLCGGGRYNGLLELLD--GPSETGIGFALSIERLLLALEEEGIELEENLDLFIVTMGDQADRYAVKLLNHLRHNGIKADKDYLQRKIKGQMKQ----ADRLGAKFTI 384
17 -73.7004rdx_A mol:protein length:423 Histidine--tRNA ligase  ali model follow..  17  7..AVRGTKDLFGKELRMHQRIVATARKVLEAAGALELVTPIFEETQVFEKGVGAAVRKEMFTFQDR-GGRSLTLRPEGTAAMVRAYLEHVWPQPVRLWMAGPMFRAERPQKGRYRQFHQVNYEALGSENPILDAEAVVLLYECLKELGLRR-LKVKLSSVGDPEDRARYNAYLREVLSPHREALSEDSKERLE--------LNPMRILDSKSERDQALLKELGVRPMLDFLGEEARAHLKEVERHLERLS-VPYELEPALVRGLDYYVRTAFEVHHEGAQSALGGGGRYDGLSELLG--GPRVPGVGFAFGVERVALALEAEGFGLEKGPDLYLIPLTEEAVAEAFYLAEALR-PRLRAEYALAPRKPAKGLEE----ALKRGAAFAG 384
18 -39.7004cs2_A mol:protein length:274 PYRROLYSINE--TRNA LIGASE  ali model follow..  42...KKDLQQIYAEERENLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDN-DTELSKQIFR-VDKNFCLRPMLAPNLANYLRKLDRPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTRENLESI--ITDFLNHLGID--FKIVGDSCMVFGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFG-------------LERLLKVKHDFKNIKRAARSESYYNGISTNL.............................................................................................................................................. 268
19 -36.6003qtc_A mol:protein length:290 Pyrrolysyl-tRNA synthetase  ali model follow..  10  56...KKDLQQIYAEERENLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDN-DTELSKQIFRVD-KNFCLRPMLTPNLYNYLRKLDRPDPIKIFEIGPCYRKESDGKEHLEEFTMLVFWQMGSGCTRENLESI--ITDFLNHLGID--FKIVGDSCMVFGDTLDVMHGDLELSSALVGPIPLDREWGIDKPWIGAGFG-----------------------LERLLKVKHDFKNIKRAARSESYYNGISTNL.................................................................................................................................... 282
20 -36.0004bw9_A mol:protein length:291 PYRROLYSINE--TRNA LIGASE  ali model follow..  59...KKDLQQIYAEERENLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDN-DTELSKQIFRVD-KNFCLRPMLAPNLGNYLRKLDRPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTRENLESI--ITDFLNHLGID--FKIVGDSCMVFGDTLDVMHGDLELSSAGPRPLDREWGIDKPWIGAGFGLE.......................................................................................................................................................................................... 256
21 -32.7005k1p_A mol:protein length:274 Pyrrolysine--tRNA ligase  ali model follow..  12  42...KKDLQQIYAEERENLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDN-DTELSKQIFRVD-KNFCLRPMLAPNLYNYLRKLDRPDPIKIFEIGPCYRKESDGKEHLEEFTMLAFAQMGSGCTRENLESI--ITDFLNHLGIDFKIVGD........................................................................................................................................................................................................................................ 193
22 -31.9004q6g_A mol:protein length:267 Pyrrolysine--tRNA ligase  ali model follow..  42....KDLQQIYAEERENLGKLEREITRFFVDRGFLEIKSPILIPLEYI-ERMGIDNDTELSKQIFRVD-KNFCLRPMVAPNIFNYARKLDRPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFFQMGSGCTRENLE--SIITDFLNHLGID--FKIVGDSCSVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFG-----------------------LERLLKVKHDFKNIKRAARSESYYNGISTNL.................................................................................................................................... 267
23 -30.5002e3c_A mol:protein length:291 Pyrrolysyl-tRNA synthetase  ali model follow..  12  59...KKDLQQIYAEERENLGKLEREITRFFVDRGFLEIKSPILIPLEYI-ERMGIDNDTELSKQIFRVD-KNFCLRPMLAPNLYNYLRKLDRPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTRENLE--SIITDFLNHLGIDFKI........................................................................................................................................................................................................................................... 207
24 -27.7004tqd_A mol:protein length:291 Pyrrolysine--tRNA ligase  ali model follow..  10  60....KDLQQIYAEERENLGKLEREITRFFVDRGFLEIKSPILIPLEYI-ERMGIDNDTELSKQIFRVD-KNFCLRPMLAPNLYNYLRKLDRPDPIKIFEIGPCYRKESDGKEHLEEFTMLSFIQMGSGCTRENLE--SIITDFLNHLGIDFKIVLELSSAVVGPPLDREWGIDKPWIG-----------FGLERLLKVKHDFKNIKRA.................................................................................................................................................................................... 271
25 -25.5002zni_A mol:protein length:308 Pyrrolysyl-tRNA synthetase  ali model follow..  12  81...........VKHRPALLELEEKLAKALHQQGFVQVVTPTIITKSALAKMTIGE-DHPLFSQVFWLD-GKKCLRPMLAPNLYTLWRERLWDKPIRIFEIGTCYRKESQGAQHLNEFTMLNLTELGTPLEERHQRLEDMARWVLEAAGIRE-FELVTESSVVYGDTVDVMK......................................................................................................................................................................................................................... 239
26 -21.5002lw7_A mol:protein length:170 Histidine--tRNA ligase, cytoplasmic  ali model follow..  11  6.....................................................................................................................................................................................................................................................................................LEELVKLQGERVRGLKQQKASAELIEAQLGPDESKQKFVLKTPKALEEKTTETQVLVASAQKKLLEERLKLVSELQDAGIKAELLYKKNP---KLLNQLQYCEEAGIPLVA 125
27 -15.8002i4l_A mol:protein length:458 Proline-tRNA ligase  ali model follow..  12  49..EAAGIYAWLPLGHRVLKKIEQIVREEQNRAGAIELLMPTLQLADLWESGRYDAYGPEMLRIADR-HKRELLYGPEMITEIFRAYIKSYKSLPLNLYHIQWKFRDEQRPRFRGREFLMKDAYSFDVDEAGAR-KMFVAYLRTFARMGLK-AIPMRAETGPIGGDLSHEFIVLAETGES--GVYIDRDVLNLPVPDENVDYDGDLTPIIKQWTSVYAATEDVHEPARYESEVPEANRLNTRGIEV-----------------------GQIFYF-----------GTKYSDSMKATGPDGTDAPIH-YGVGVSRLLGAIIEACVAPFRVTILNLKQGDAATDAACDQLYRELSAKGVDVLYD----DTDQRAGAKFATADLIGIPWQI 417
28 -15.1003ial_A mol:protein length:518 Prolyl-tRNA synthetase  ali model follow..  39....KGCVVFRPYGFFMENAIMRLCEEEYAKVGISQILFPTVIPESFLKKESDKGFEAECFWVEKGGLEERLALRPTAIYSMFSKWVRSYKDLPLKIHQTCTIFRHETKNT-RVREIHWNEAHCCHATAEDAVSQLSDYWMPCGRVLQTAGIHNLGQRFSSTFDILYANKANESVHPYLTCAGISTR----LACALSIHGDSGGLVLPPLIAPIHVVIIPIGCGKKNNQESDQQVLGKVNEIADTLKSKLGLRVSIDDDFSKSMGD----LYYYELKGVPLRIEVGQRDLANGQCIVVPRDVGKDQKRVIPITEVMKVSSHTTENHELVVKNVIKDELDAYKARLKEKAFAFHNSMVTNCKSFDEIVACIENKGGLARF......... 456
29 -13.6002j3l_A mol:protein length:572 PROLYL-TRNA SYNTHETASE  ali model follow..  11  35..VAAGIYSYLPLANRVLEKLKTIMREEFEKIDAVEMLMPALLPAELWKES--ETYGPNLYRLKDR-NDRDYILGPETFTELIRDEINSYKRLPLNLYQIQTKYRDERSRSGRGREFIMKDGYSFHADEASLDQDYEKAYSRIFERCGLE-AIIGDGGAMG--DTICYSTESDYAANLEMATSLYTPKKSHETQLDLEKIATPEVGTIAEVANKLKNFLGADFLDEATEEDARRVLGAGFGSIGPVNVSEDVKIYADLAVQDLANAIVGANEDGYH-EIGHIFKLGTRYSDAMGALDENGREKSVMGYGIGVSRLLSAIVEQGIAPFDLHVVQMNVKDEYQTKLSQEVEAMMTEAGYEVLVD----DRNERAGVKFADADLIGCPIRI 528
30 -13.3005xil_A mol:protein length:512 Putative prolyl-tRNA synthetase  ali model follow..  10  33....SGCYIIRPWAYYVWKCVQRFLGGKIEKLGVEDCYFPMFVSRSCLEREKDEGFAPEVAWVTRAGDTELVAVRPTVMYPYYAKWIRSHRDLPVRLNMWNNVIRWEFSHP-RTREFLWQEGHCAWAKAEECAKEILECYASVYEQLLAVPTVETFIEAVGRGCQGATSHNLGQNFGKMFDIRFQDPENNEQTLIPWQNSWGLSTRVIGVMIMVHGDIIPVGITKDTTEEARQELLASCWRLESELCEGG-VRARCDLRD----NYSPGWRFHWEVKGVPLRVELGPR-ERSLAVAVRHSGARHSVAWDAQTPAAVAALLEDVHAQMYARAKETMETHRVRVTEWTEFVPTLNRKCLILAPWCGAMECENQVKKDSA........... 452
31 -13.1003p8t_A mol:protein length:294 AsnS-like asparaginyl-tRNA synthetase related protein  ali model follow..  10  8.......SRDIYKAIDIQTKILDYMTKFFTDRGFKWLLPIMLSPITDPLWPDPAGEGIRPAEVDVYGVRMRLTHSMILHKQLAIAMGLE------KIFVLSPNIRLESRRKDDGREFTQLDFEIEGAK------DVMRLIEELIY-------------------GLFRKAEEWTGREFPRARHFKVYDYKDILEEFGSDEKASMEMEEPFWIVNIPREFYDREENGVWKNYDLILPYGYGEVSSGGEREWEYEKIVAKIRAAGLKEDS---FRPYLE------------------IARAGKLKPSAGAGIGVERLVRFI..................................................................... 272
32 -12.8001nyq_A mol:protein length:645 threonyl-tRNA synthetase 1  ali model follow..  11  261....AGLPLWLPNGATIRREIERYIVDKEVSMGYDHVYTPVLANVDLYTSGHWDHYQEDMFPPMQLDETESMVLRPMNCPHIYANKPHSYRELPIRIAELGTMHRYEASGA-RVRGMTLNDSHIFVRPDQIKEKRVVNMIIDVYKDFGFEDSFRLSYRDPEDKEKYFDDDDMWNKAENMLKEAADELGLSYEEAIGEAAFYGPKLDVQVKTAMGKEETLSTAQLDFLLP-------ERFDLTYIGQDGEHHRPVVIHRGVVSTMERFVAFLTEET----------KGAFPTWLA---------------------------------PKQVQIIPVNVDLHYDYARQLQDELKSQGVRVSIDDRNEKMGYKIREA............. 592
33 -12.7001nnh_A mol:protein length:294 asparaginyl-tRNA synthetase-related peptide  ali model follow..  10  15..............LDIQTKILEYMTDFFVKEGFKWLLPVIISPITDPLWPDPAGEGMEPAEVEIYGVKMRLTHSMILHKQLAIAMGLK------KIFVLSPNIRLESRQKDDGREFTQLDFEV----ERAKMEDIMRLIERLVYGL---------------FRKAEEWTGREFPKTKRFEVFEYSEVLEEFGSDEKASQEMEEPFWIINIPREFYDREVDGFWRNYDLILPYGYGEEYEKIVAKIRKAGLNE--------DSFRPYLEIA----------------KA----------GKLKPSAGAGIGVERLVRFI..................................................................... 272
34 -12.6004hwt_A mol:protein length:413 Threonine--tRNA ligase, cytoplasmic  ali model follow..  14  20..LSPGSCFFLPKGAYIYNALIEFIRSEYRKRGFQEVVTPNIFNSRLWTSGHWQHYSENMFSF--EVEKELFALKPMNCPGMFDHRPRSWRELPLRLADFGVLHRNELSGA-RVRRFQQDDAHIFCAMEQIEDKGCLDFLRTVYSVFGFSFKLNLSTRP----EKFLGDIEVWDQAEKQLENSLNEFGEK-------ELNSGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLTYVSHDGDDKKRPVIVHRAILGSVERMIAILTENY----------GGKWPFWLS----------------------------------PRQVMVVPVGPTCDEYAQKVRQQFHDAKFMADIDLDPGC---TLNKKIRNAQLAQYNFIL 356
35 -12.4004p3n_A mol:protein length:415 Threonine--tRNA ligase, cytoplasmic  ali model follow..  14  24..LSPGSCFFLPKGAYIYNALIEFIRSEYRKRGFQEVVTPNIFNSRLWTSGHWQHYSENMFSF--EVEKELFALKPMNCPGHCLMFDHRPRELPLRLADFGVLHRNELSGA-RVRRFQQDDAHIFCAMEQIEDKGCLDFLRTVYSVFGFSFKLNLSTRP----EKFLGDIEVWDQAEKQLENSLNEFGEK-------ELNSGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLTYVSHDGDDKKRPVIVHRAILGSVERMIAILTENY----------GGKWPFWLS----------------------------------PRQVMVVPVGPTCDEYAQKVRQQFHDAKFMADIDLDPGC---TLNKKIRNAQLAQYNFIL 360
36 -12.3004k86_A mol:protein length:535 Proline--tRNA ligase  ali model follow..  10  61....SGCYILRPWAYAIWEAIKDFFDAEIKKLGVENCYFPMFVSQSALKEKTHVADFAPEVAWVTRSGAEPIAIRPTVMYPAYAKWVQSHRDLPIKLNQWCNVVRWEFKHP-RTREFLWQEGHSAFATMEEAAEEILDLYAQVYEELLAI-TIEAFISASGRAIQGGTSHHLGQNFSKMFEIVFEDPKIPGEKQFAYQNSWGLTTRTIGVMTMVHGDIIPCGITNALSEEDKEALIAKCNDYRRRLLSVN-IRVRADLRD----NYSPGWKFHWELKGVPIRLEVGPR-SCQFVAVRRDTGEKLTVAENEAETKLQAILEDIQVTLFTRASEDLKT-HMVVANTMEDFQKILDSGKIVQIPFCGEIDCEDWIKKTTA........... 479
37 -12.3005ucm_A mol:protein length:579 Proline--tRNA ligase  ali model follow..  11  37..LASGLYTWLPMGLRVLRKVETIVREEMNAAGALEVLMPAVQPAELWESGRWEQYGPELLRLKDR-HEREFCVGPEVITDLARNELNSYKQLPINFYQIQTKFRDERPRFGRGREFIMKDAYSFHLSQDSLQQGMYQAYSKIFSRLGLDDMRLVDTPNTKTIAALVDGFQLPIEKTIKTLVVHGAEEGTLVALIVRGDHELNEIKAANQPLVASPLVFASEAEIRAAIGAGPGSLGPVNLPIACIVDRSVALMSDFAAGANIEDKHKGTLVIKRGIEVGHIFQLGTKYSEAMKLLSEQGKPVNLMGYGIGVSRVVAAAIEQALAPFQIALVPLKYETESVKQATDKLYAELTAAGFEVLLD--DRDKKTSPGVKFADMELIGIPHRI 533
38 -12.3005xif_A mol:protein length:500 Prolyl-tRNA synthetase (ProRS)  ali model follow..  32....SGCYIMRPWAFHIWEKVQRFFDDEIKKMGVENSYFPMFVSRHKLEKEKDEGFSPEVAWVTHYGDPEKIAIRPTIMYPAYAKWIRSHRDLPLKLNQWCSVVRWEFKQP-RTREFLWQEGHTAHATEEEAWLDILELYRRWYEECLAVTTVEAFIPENGRGIQAATSHLLGTNFAKMFEIEFEDEEGHKRLVHQTSWGCTRSLGVMIMTHGDDKGLV--IIPILFKDENTGEILGKCRELKTMLEKAD-IRVRIDDRS----NYTPGWKYHWEVKGVPLRLELGPK-KGTARVVRRDTGEAYQISWADLAPKLLELMEGIQRSLFEKAKARLHE-GIEKISTFDEVMPALNRKHLVLAPWCEDPESEEQIKKETQ........... 444
39 -12.1005xip_A mol:protein length:498 Prolyl-tRNA synthetase, putative  ali model follow..  10  33....SGCYIIRPWAYRIWEAVQKFFDDGIKRLGVENCYFPMFVSQAKLEKEKDEGFKPEVAWVTHYGDSELVAIRPTIMYPAYAKWIRSHRDLPLKLNQWNNVVRWEFKQPTRTREFLWQEGHTAHATEEEAYTLILELYRQWYEDYLAVPVIKIQAATSHLLQNFSRMFSIEFEDEKGAKQLVHQTSWGCTTRSLGVMIMTHGDDKGLVLPPRVVAVQAVIIPIIFKETGGMEIVAKCRELERLLNAAG-VRVKVDDRT----NYTPGWKFDWELKGVPLRLEIGPR-SCQTRVVRRDTSEARNVPWAEAASTIPAMLETMQKDLFNKAKAKFEA-SIEQITTFDEVMPALNRRHVVLAPWCEDPETETQIKRETQ........... 445
40 -12.0004hwo_A mol:protein length:411 Threonine--tRNA ligase  ali model follow..  16  20..EAPGMVFWHNDGWTIFRELEVFVRSKLKEYQYQEVKGPFMMDRVLWKTGHWDNYKDAMFTT--SSENREYCIKPMNCPGIFNQGLKSYRDLPLRMAEFGSCHRNEPSGS-RVRGFTQDDAHIFCTEEQIRDNGCIRLVYDMYSTFGFEK-IVVKLSTRP--EKRIGSDEMWDRAEADLAVALEENNIPFEYQLGEGAFYGPKIEFTLYDCLDRAWQCGTVQLDFSLP-------SRLSASYVGEDNERKVPVMIHRAILGSMERFIGILTEEF----------AGFFPTWLA----------------------------------PVQVVIMNITDSQSEYVNELTQKLSNAGIRVKADLRNEKIGFKIREH............. 346
41 -12.0004hvc_A mol:protein length:519 Bifunctional glutamate/proline--tRNA ligase  ali model follow..  10  45....SGCYILRPWAYAIWEAIKDFFDAEIKKLGVENCYFPMFVSQSALEKEKTVADFAPEVAWVTRSGAEPIAIRPTVMYPAYAKWVQSHRDLPIKLNQWCNVVRWEFKHPQRTREFLWQEGHSAFATMEEAAEEILDLYAQVYEELLAI-TIEAFISASGRAIQGGTSHHLGQNFSKMFEIVFEDPKIPGEKQFAYQNSWGLTTRTIGVMTMVHGDIIPCGITNALSEEDKEALIAKCNDYRRRLLSVN-IRVRADLRD----NYSPGWKFHWELKGVPIRLEVGPR-SCQFVAVRRDTGEKLTVAENEAETKLQAILEDIQVTLFTRASEDLKT-HMVVANTMEDFQKILDSGKIVQIPFCGEIDCEDWIKKTTA........... 463
42 -12.0004ncx_A mol:protein length:506 Proline--tRNA ligase  ali model follow..  36....SGCYILRPAAYYIWECVQAFFNKEIKKLNVENSYFPLFVTKNKLEKEKNEGFSPEVAWVTKYGDPEEIAIRPTIMYSVFPKWIRSYRDLPLKLNQWNTVVRWEFKQP-RTREFLWQEGHTAHKNEEEAV-KLVFDILDLYRRWGANFTSTAEAFISENGRAIQAATSHYLGTNFAKMFKIEFEDENEVKQYVHQTSWGCTTRSIGIMIMNVSKYKVVIVPIFYKTTDENAIHSYCKDIEKILKNAQ-INCVYDDRA----SYSPGYKFHWELRGIPIRIEVGPK-NNSCVIVRRDNNEKCNVKKESVLLETQQMLVDIHKNLFLKAKKKLDD-SIVQVTSFSEVMNALNKKKMVLAPWCEDIATEEEIKKETQ........... 448
43 -11.9001h4q_A mol:protein length:477 PROLYL-TRNA SYNTHETASE  ali model follow..  34....RGTIVVRPYGYAIWENIQQVLDRMFKETGHQNAYFPLFIPMSFLRKEAEEGFSPELAVVTHAGGEEPLAVRPTVIGYMWSKWIRSWRDLPQLLNQWGNVVRWEMRTRPRTSEFLWQEGHTAHATREEAEEEMLSIYARLAREYAAILKTEKEKFAGAVYTTTIEALMKDGKALQAGTSHYLGENFARAFDIKFQDRDLQVKYVHTTSWGLSWRFIGAIIMTIYKDESRERVLEAAQGLRQALLAQG-LRVHLDDRDQHTPGY----FHEWELKGVPFRVELGPK---VLASRLGGKETLPLAALPEALPGKLDAFHEELYRRALAFRE-----DHTRKVDTYEAFKEAVQEGFALAFHCGDKACERLIQEETTAT......... 443
44 -11.9005f9y_A mol:protein length:511 Aminoacyl-tRNA synthetase  ali model follow..  10  40....SGCYILRPWSYFIWETIQSVFDQKIKQHDVQNAYFPIFVTQKKLETEKDEGFSPEVAWVTKSGKSDLIAIRPTIMYPYFAKWIRSHRDLPLKINQWTSIVRWEFKHP-RTREFLWQEGHTAHSTRKEAL-EMVDIILNEYASIAVQAATSHLLG-----QNFSKMFGVEFEDEKGNKEYAHQTSWGLTTRAIGVMIMTHGDNKGLVLPPKVAPVQVIIIPIIFKTVITEEQKKICNEVECILKKAG-VRVKID-------NYTPGWKYHWEVKGVCLRFEVGPR--DIEKRSVRVVVRDNMEKMDIPISELESKIPKLLEEFQNRLLFKAKQRQNESIIRV-KVMDTLNQKKMVIAPWCEDVSCEEEIKKETA........... 452
45 -11.1003ica_A mol:protein length:213 Phenylalanyl-tRNA synthetase beta chain  ali model follow..  12  1............SNADRRYKWQTVVSEQLVGAGFNEILNNSLTAGSYY-EGLKSHPREMAVELMNPLSQELNCMRQTLLFGGLETLSHNRKHLSLYLFEWGKCYRFHAAKRTDEAEDDRLGIWICGQRVHNS-FELKAVVEQVLCRVGIET............................................................................................................................................................................................................................................. 155
46 -11.0003g1z_A mol:protein length:326 Putative lysyl-tRNA synthetase  ali model follow..  10  1.....GMSET--PNLLKRAAIMAEIRRFFADRGVLEVETPCMS--QATVTDIHLFPFETRFVGPGHSQGINLYLMTSPEYHMKRLLAAGCG----PVFQLCRSFRNEEMGRHHNPEFYRPHYDMYRLMNEVDDLLQQVLDCQPAESLSYQQAFQRHLEIDPLSADKTQLREAAAKLDLSNIADTEEDRDTLLQLLFTMGVEPHIGKEKPTFIYHFPASQASLAQISTEDHRVAERFE----------------------------YYKGIELANGFHELTDAREQQQRFEQDNRKRAARGLPQDCSGVALGVDRLVMLALGAESLADV............................................................ 318
47 -11.0003a31_A mol:protein length:471 Probable threonyl-tRNA synthetase 1  ali model follow..  13  40.....GVPLFSLGGGPIRYALAEVLAKFHARRGYYVVETPIIASTELFVSGHIEFYRNNMYLF--DIEGHEFAVKPMNCPYHILLFLNEVLPLPFKVFEFGRVHRYEPSGS-RVRGFTQDDAHIIVPGGRVIDFEEMKLVLERLFKLGVSSTFKVRLSMSD--KEFMGSKEEWEGAEEALREAASRINEKYGIDIVELEGEAA---KLDFIMMVEESGVSKEWQMGTIQFDFNLPRRFRLYDVVREEFGIEEVYIIHRALLGSIERFLGVYLEHR----------RGRMPFTLAPIQF---------------AVIAVKTGGEVD-------------REIEDLASSIAKGLLDKGFRVAVKGSSKT---GLSSDVRHIESTAKPAVN 400
48 -10.9003ig2_A mol:protein length:213 Phenylalanyl-tRNA synthetase beta chain  ali model follow..  15  1............SNADKSNKLQNLVAEQLVGCGFNEILNNSLTRAAYY-DGLESYPSKNLVMLLNPLSADLNCMRQTLLFGGLESIAHNANRK-LKFFEFGNCYHFDAEKKAPYSEDYHLGLWVTGKMVSNS-YELKAYVENIFKRLGLDL............................................................................................................................................................................................................................................. 155
49 -10.8003i7f_A mol:protein length:548 Aspartyl-tRNA synthetase  ali model follow..  10  244..............FRIQSACCGLFREFLTSQKFVEIHTPKL-------IGCSSEGGSNIFEVKYFDRKAYLAQSPQLYKQMAIMGDFR------KVFEVGPVFRAENSNTRRHTEFEGLDIEM------------------------------------EIVENYHECIDVMEKLFTFIFDEIPKRFPDELKVIRKQYPFEDLIYR---------TYKEAIEMLRASGETIGDYDDFTTPQEVKLGELIKAKYNTDFYILDKFPFYT--SYDVFVRG--QEITSGAQPEFLMKRCIEKGVDPPHAGCGIGLERITMLY..................................................................... 527
50 -10.8003m4p_A mol:protein length:456 Asparaginyl-tRNA synthetase, putative  ali model follow..  156..............LQLRSEIQWYFRKYYHDNHFTEIQPPTI-------VKTQCEGGSTLFKLQYFNEPAYLTQSSQLYLESVIASLG-------KSFCMLSSYRAEQSRTVRHAEYLHLEAEL----PFISFEDLLNHLEDLVC---------------------------------TVIDNVMAVHGDKIRKMNPHLKLPTRPFKRMTYADAIKYCNDHGILNKDKPFEYGEDISEKPE--RQMTDEIGCPIFMIHFPSKMKAFYM---VDLLMPGVGEIVGGSMRYDELMGAYKANGLNPPHGGYGLGVERLVMWL..................................................................... 435
51 -10.7005xix_A mol:protein length:472 Asparagine--tRNA ligase, cytoplasmic  ali model follow..  164..............LKARSMVTRCFRDHFFDRGYYEVTPPTL-------VQTQVEGGATLFKLDYFGEEAFLTQSSQLYLETCLPALG-------DVFCIAQSYRAEQSRTRRHAEYTHVEAEC----PFLTFDDLLNRLEDLVCDV---------------VDRILKSPAGSIVHELNPNFQPPKRPFKRMN------------------YSDAIVWLKEHDVKKEDGTFYEFGEDIPEAPERLMTDTINEPILLCRFPVEIKSFYM---VDVLMPNVGEIVGGSMRSEEILAGYKREGIDPPHGGYGLGLERFLTWI..................................................................... 445
52 -10.7003a5y_A mol:protein length:345 Putative lysyl-tRNA synthetase  ali model follow..  28............PNLLKRAAIMAEIRRFFADRGVLEVETPCMS--QATVTDIHLVPFETRFVGPGHSQGMNLWLMTSPEYHMKRLLVAGCG----PVFQLCRSFRNEEMGRYHNPEFTM--LEWYRPHYDMYR--LMNEVDDLLQQV----LDCPAAESLSYQQAFLRYLEIDPLSADK-TQLREVAAKLDLSNVADTEEDRDTLLQLLFTFGVEPNIGKEKPTFVYHFPASQASLAQIST---------------DHRVAERFEYYKGIELANGFHELTDAREQQQRFEQDNRKRAARGLPQDCSGVALGVDRLVMLALGAETLAEV............................................................ 331
53 -10.6004j15_A mol:protein length:521 Aspartate--tRNA ligase, cytoplasmic  ali model follow..  210..............FRLQSGICHLFRETLINKGFVEIQTPKII-------SAASEGGANVFTVSYFKNNAYLAQSPQLYKQMCICADFE------KVFSIGPVFRAEDSNTHRHTEFVGLDIEMAFNYHYH---EVMEEIADTMVQIGLQERFQTEIQTVNKQFPCEPFKFLEPTLRLEYCEALAMLREAGVE--------------MGDEDDLSTPNEKLLGHLVKEKYDTDFYI--LDKYPLAVRPFYTMPDPRNPKQSNSYDMFMR----------GEEILSGAQPQLLTERALHHGIDLPHAGGGIGLERVTMLF..................................................................... 494
54 -10.6003ugq_A mol:protein length:460 Threonyl-tRNA synthetase, mitochondrial  ali model follow..  11  49.....GSMFFLPNGAKIFNKLIEFMKLQQKKFGFNEVVTPLIYKKTLWKSGHWENYADDMFKVETDEEKEEYGLKPMNCPGIFGKKDRSYNELPLRFSDFSPLHRNEASGA-RLRKFHQDDGHIFCTPSQVKSFNSLKLIDIVYNKIFPFVESNYFINFSTRPDHFIGDLKVWNHAEQVLKEILEESGKPWKLNPGDGAFYGPKLDIMVTDHLRKTHQVATIQLDFQLP-------ERFDLKFKDQDNSYKRPIMIHRATFGSIERFMALLIDSN----------EGRWP-----------------FWLNPYQAVIIPVNTKNVQQLDMCTALQKKLRNELEADDMEPVPLNDWHFNVDLDIRNEPVGYRIKSA............. 402
55 -10.4003qne_A mol:protein length:485 Seryl-tRNA synthetase, cytoplasmic  ali model follow..  10  180.........LRNYGVFLNQALINYGLSFLSSKGYVPLQAPVMMNKEVMAKAQLSQFDEELYKVIDGEDEKYLIATSEQPISAYEWFESPAEQLPVRYAGYSSCFRREAGSHGRVHAFEKIEQFVLTEPEKSWEERMIGCSEEFYQSLGLPRVVGIVSGELN................................................................................................................................................................................................................................... 345
56 -10.3001qf6_A mol:protein length:642 THREONYL-TRNA SYNTHETASE  ali model follow..  16  262.....GMVFWHNDGWTIFRELEVFVRSKLKEYQYQEVKGPFMMDRVLWKTGHWDNYKDAMFTT--SSENREYCIKPMNCPGHVQIFNQGLRDLPLRMAEFGSCHRNEPSGS-RVRGFTQDDAHIFCTEEQIRDNGCIRLVYDMYSTFGFEK-IVVKLSTRP--EKRIGSDEMWDRAEADLAVALEENNIPFEYQLGEGAFYGPKIEFTLYDCLDRAWQCGTVQLDFSLP-------SRLSASYVGEDNERKVPVMIHRAILGSMERFIGILTEEF----------AGFFPTWLA----------------------------------PVQVVIMNITDSQSEYVNELTQKLSNAGIRVKADLRNEKIGFKIREH............. 585
57 -10.2002xti_A mol:protein length:437 ASPARAGINYL-TRNA SYNTHETASE, CYTOPLASMIC, PUTATIVE  ali model follow..  134..............LRLRAAATRAMREHFYNAGYVEVAPPTL-------VQTQVEGGSTLFNLDYFGEQSFLTQSSQLYLETCIPTLG-------DVFCIAQSYRAEKSRTRRHAEYAHVEAEC----PFITLDDLMEKIEELVCDT---------------------VDRLLADEEAKKLLEHINPKFQPPERPFLRMEYKDAI-----------KWLQEHNVENEFGNTFTYGEDIAEAAERFMTDTINKPILLNRFPSEIKAFYM---VDLLMPGVGEIVGGSMRFDELSKAFKNVEIDPPHGGYGLGLERFICWL..................................................................... 416
58 -10.0001asy_A mol:protein length:490 ASPARTYL-tRNA SYNTHETASE  ali model follow..  11  181..............FRIQAGVCELFREYLATKKFTEVHTPKL-------LGAPSEGGSSVFEVTYFKGKAYLAQSPQFNKQQLIVADFE------RVYEIGPVFRAENSNTHRHTEFTGLDMEMAFEEHYH---EVLDTLSELFVFI-FSELPKRFAHEIELVRKQYPVEEFKLPKDGKMVRLTYKEGIEMLRAAGKEIGDFEDLS---------TENEKFLGKLVRDKYDTDFYI--LDKFPLEIRPFYTMPDPANPKYSNSYDFFMR----------GEEILSGAQHALLQERMKAHGLSPPHAGGGIGLERVVMFY..................................................................... 469
59 -9.9601b8a_A mol:protein length:438 PROTEIN (ASPARTYL-TRNA SYNTHETASE)  ali model follow..  137..............FKIRSSVFKAVRDFFHENGFIEIHTPKI-------IATATEGGTELFPMKYFEEDAFLAESPQLYKEIMMASGLD------RVYEIAPIFRAEEHNTTRHNEAWSIDSEM------------------------------------AFIEDEEEVMSFLERLVAHAINYVREHNAKELDILNFELEEPKLPFPRVSYDKALEILGDLGKEIPWGEDIDTEGERLLGKYMMENENAPLYFLYQYPSEAKPFKPEICRAFDLEYRG--VEISSGGRHDILVEQIKEKGLNPPHGGFGLGAERLIKQM..................................................................... 417
60 -9.8201nj8_A mol:protein length:459 Proline-tRNA Synthetase  ali model follow..  28....KGCGVYLPYGFKIRRYTFEIIRNLLDESGHDEALFPMLIPEDLLAKEFEDEVYWVTHGGKTQLD-VKLALRPTPIYYMMKLWVKVHTDLPIKIYQIVNTFRYETKHT-LREIMTFKEAHTAHSTKEEAENQAISIYKKFFDTLGIPTVHNLGQNFSKTFEIIFET---PTGDKDYAYQTCYGISDRVIASIIAIHGDEKGLILPPIVAPIQVVIVP-----LIFKGKEDIVMEKAKEIYEKLKG--KFRVHIDDR-----DIRPGRKFDWEIKGVPLRIEVGPK--DIENKKITLFRRDTMEKFQVDETQLMEVVEKT----------------NNIMENIKNRAWEKFENFITILEDINPDEIKNILSEK............. 416
61 -9.7101nj1_A mol:protein length:501 Proline-tRNA Synthetase  ali model follow..  55....KGMHVWMPHGFMIRKNTLKILRRILDR-DHEEVLFPLLVPEDELAKEAIKGFEDEVYWVTLSKLQRKLALRPTVMYPMFALWVRSHTDLPMRFYQVVNTFRYETKHT-VREITTFKEAHTIHATASEAEEQAVEIYKEFFNSLGIPYLITRRPPWDKFPGSIGTVHNLGQTFARTFIKFETPEGDHEYVHQTCYGLSDRVIASVIAIHGDESGLHQVVIVPIIFKKAAEEVMEACRELRSRLEAAG-FRVHLDDR-----DIRAGRKYEWEMRGVPLRVEIGPR--DLEKGAAVISRRDTGEKVTADLQGIEETLREL----------------KDILENLRTRAWERMESEIREAETLEEASRIVDEKRGIISF......... 447
62 -9.7004lns_A mol:protein length:351 Asparagine synthetase a  ali model follow..  11............LLQEQILTVKRSFSEALKELNLVEVRAPILFRVGDGTQDNLSGFEKAVQVPVKAIPNASFEVVHSLAKWKRRTLANYKFAPGHGLYTHMTALRVDDVLDNIHSVVDQWDWEM----VMKDDQRNLAFLKEVVCKV------------YAAIRKTELAVCEKYKQKPILPETIQFVHAEHLLLAYPNLTAKEREREIAREYG--AVFLIGIGAVLSSGDRHDARAPDYDDWTSPVEAS-SKPIPTMNSLSSLKGLNGDILLYNPTLDDSLEVSSMGNAEALRHQISLTGDDSQTVGGGIGQSRMVMFMLRKKHIGEVQCSVW....................................................... 340
63 -9.6001x54_A mol:protein length:434 Asparaginyl-tRNA synthetase  ali model follow..  10  135..............MKVKETLIMAAREWLLKDGWHEVFPPIL-------VTGAVEGGATLFKLKYFDKYAYLSQSAQLYLEAAIFGLE-------KVWSLTPSFRAEKSRTRRHTEFWHLELEA----AWMDLWDIMKVEEELVSYM------------QRTLELRKKEIEMFRDDLTTLKNTEPPFPRISYDEAIDILQSKGVNVEWGDDLGADEERV--LTEEFDRPFFVYGYPKHIKAFYMKEDPN---------------DPRKVLASDMLAPEGYGEIIGGSDYDKLLNRILEEGMDPPHSGFGLGVERLVAWV..................................................................... 413
64 -9.4801n9w_A mol:protein length:422 aspartyl-tRNA synthetase 2  ali model follow..  125..............LKVQAALVRGFRRYLDRQDFTEIFTPKV-------VRAGAEGGSGLFGVDYFEKRAYLAQSPQLYKQIMVGVFE-------RVYEVAPVWRMEEHHTSRHNEYLSLDVEMGFIADEE---DLMRLEEALLAEMEALNTAGDEIRLLGATWPSFPQDIPRLTHAEAK-RILKEELGYPVGQDLSEEAERLLGEYAKERWGSDWLFVTRYPRSVRPFYTYPE----------------------EDGTTRSFDLLFR----------GLEITSGGRYEELLESLKAKGMDPPHGGFAIGAERLTQKL..................................................................... 401
65 -9.45011as_A mol:protein length:330 ASPARAGINE SYNTHETASE  ali model follow..  10  1......MKTAYIAKQRQISFVKSHFSRQLERLGLIEVQAPILSRVGDGTQDNLSGAEKAVQVKVKALPDAQFEVVHSLAKWKRQTLGQHDFSAGEGLYTHMKALRPDEDRLSPLHYVDQWDWER----VMGDGERQFSTLKSTVEAI------------WAGIKATEAAVSEEFGLAPFLPDQIHFVHSQELLSRYPDLDAKGRERAIAKDLGALVGIGGKLSDGHRHDVRAPDYDDWSTPSELGHAGLNGDILVWNPVLEDAFE-----------------LSSMGDADTLKHQLALTGDEDQTIGGGIGQSRLTMLLLQLPHIGQVQAGVW....................................................... 318
66 -9.4201b76_A mol:protein length:442 Glycine--tRNA ligase  ali model follow..  29....QGVYDYGPLGVELKNNLKQAWWRVYERDDMEGLDASVLTHRLVLYSGHEATFADPMVDNAKGGRGLLAYLRPETAVNFKNVLDATSRKLGFGIAQIGKAFRNEITPRNRVREFEQMEIEYFVRPGEDEYRYWVEERLKWWQEMGLSRE-NLVPYQYRFPHGSLELEGIAQRTDFDLGSHTKDQEALGITARVLRNEHSTQRLAYRDPETGKWFVPYVIEPSAGVDRGVLALLAEAFTREELPNGEERIVLKLKPQL---------------APIKVAVIPLVKNRPEITEYAKRLKARLLALGLGRVLYEDTGNIGKAYRRHDEVGTPFAVTVDYDTIGQSKDGTTRVRDRDTMEQIRLHVDELEGFLRERLRW.......... 442
67 -9.3805vl1_A mol:protein length:506 Lysine--tRNA ligase  ali model follow..  13  170......VRPQAREVARQRIAVIRAVRNALERRGFLEVETPMLQ-------TLAGGAAARPFVTHSNALDIDLYLRIAPELFLKRCIVGGFD----RVFELNRVFRNEGSDSTHSPEFSM--LETYQTYGTYDDSELIQEVADEARQLSMPDGSVYDIDTMEMYSSLSEALGEQITPETTVARLRDIASGLDVEIDNSVFGHGKLVEELWEHAVGNKLT-VETTPLTRQHRSIPGVTEKWDLYVRGVELATGYSELNDPVVQRD--------FADQARAAAAGDDEAMQLDEDFLTALEYGMP-PCTGTGMGIDRLLMCLTGLS................................................................. 485
68 -9.3401efw_A mol:protein length:580 ASPARTYL-TRNA SYNTHETASE  ali model follow..  12  137.......RRRMQENLRLRHRVIKAIWDFLDREGFVQVETPFL-------TKSTPEGARDFLVPYRHEPGLFYALPPQLFKQMLMVAGLD------RYFQIARCFRDEDLRADRQPDFTQLDLEM-----SFVEVEDVLELNERLMAHVFREALGVELPLPFPRLSYEEAMERYGSDKPDLRFGLELKEVGPLFRQSGSRKEVAELEEVAKRHKAQGLAWARVEEGGFSGGVAKFLEPVREALLQATEARPGDTLLFVAGPRKVAATALGAVYDLVLNGV--EVGGGSKFGFFLEAL-EYGAP-PHGGIAWGLDRLLALMTGSPSIREVIAFPKNKEGKDPLTGAPSPVPEQLRELGLMVV............................ 578
69 -9.1301wyd_A mol:protein length:429 hypothetical aspartyl-tRNA synthetase  ali model follow..  134..............IKIQSLALKAFRETLYKEGFIEIFTPKI-------IASATEGGAQLFPVIYFGKEAFLAQSPQLYKELMAGVVE-------RVFEVAPAWRAEESDTPFHAEFISMDVEM----AFADYNDVMQLLEKILHNI------------KTIKEEGKEELKILNYEPPEVKIPIKRLKYTEAIEILRSKGYN---------IKFGDDIGTPELRILNEELKEDLYF--IVDWPSDARPFYTKSKSENPELSESFDLIYK----------FLEIVSGSKREVLEEALKKKGLKPPHAGFGMGLARLMVML..................................................................... 408
70 -9.1001wle_A mol:protein length:501 Seryl-tRNA synthetase  ali model follow..  11  201....SGHR-LRGAGALLQHGLVNFTLNKLIHRGFTPMTVPDLLRGVVFEGGMTPNAKPSQIYNIDPSRFEDLNLAGTAEVGLAGYFMDHFRDLPIRMVCSSTCYRAETDTGKEPWGLYRV-VEMFGVTGPGLEQEFLSLQMEILTELGLHDMPTQELGLPAYRKFDIEAWMPGRGRFGEVTSASNCTDFQSRRLHIMFQTEAGELQFAHTVNATGCAVPRLLIALLESYQQKDGSVLVPPALQPYL.............................................................................................................................................. 462

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 4 6 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Sasin JM, Godzik A, Bujnicki JM. SURF'S UP! - protein classification by surface comparisons. J Biosci. 2007 Jan;32(1):97-100.