current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 6aqh_A mol:protein length:508 Lysine--tRNA ligase, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500
# Score Template Links and tools%idFirst MAMTPPESVDPDLPEQFRIRQAKRADLLAQGRQPYPVDVPRTHTLLEIRQAYPDLPVDARTGEIVGVTGRVVFARNSGKLCFATLQEGDGTQLQAMISLAEVGQEALDNWKTYVDIGDIVFVHGEVITSKRGELSVLADSWQMAAKALRPLPVAHKEMSEESRVRQRYVDLIVRDQARKVARQRIAVMRAIRSALERRGFLEVETPMLQTLAGGAAARPFVTHSNALDTELYLRIAPELFLKRCLVGGFERVFELNRVFRNEGADSTHSPEFVMLETYQAYGTYDDSAVVTRELIQEVADEAIGTRQVPLPDGTVYDLDGEWESIQMYPSLSEALGEEITPDTPAETLWAIADRLGLDIPRDRGYGHGKLVEELWEHTVGAKLWAPTFVKDFPVETTPLTRSHRSIPGVTEKWDLYVRRIELATGYSELTDPIIQRERFEAQARAAAAGDDEAMALDEDFLAALEYGMPPSTGTGMGIDRLMMTLTGLSIRETVLFPIVKPRLast
1 -174.0006aqh_A mol:protein length:508 Lysine--tRNA ligase  ali model  100  1MAMTPPESVDPDLPEQFRIRQAKRADLLAQGRQPYPVDVPRTHTLLEIRQAYPDLPVDARTGEIVGVTGRVVFARNSGKLCFATLQEGDGTQLQAMISLAEVGQEALDNWKTYVDIGDIVFVHGEVITSKRGELSVLADSWQMAAKALRPLPVAHKEMSEESRVRQRYVDLIVRDQARKVARQRIAVMRAIRSALERRGFLEVETPMLQTLAGGAAARPFVTHSNALDTELYLRIAPELFLKRCLVGGFERVFELNRVFRNEGADSTHSPEFVMLETYQAYGTYDDSAVVTRELIQEVADEAIGTRQVPLPDGTVYDLDGEWESIQMYPSLSEALGEEITPDTPAETLWAIADRLGLDIPRDRGYGHGKLVEELWEHTVGAKLWAPTFVKDFPVETTPLTRSHRSIPGVTEKWDLYVRRIELATGYSELTDPIIQRERFEAQARAAAAGDDEAMALDEDFLAALEYGMPPSTGTGMGIDRLMMTLTGLSIRETVLFPIVKPR 502
2 -170.0005vl1_A mol:protein length:506 Lysine--tRNA ligase  ali model follow..  79  2....AMSSAESNIPEQFRIRRDKRARLLAEGYDPYPVAIERTHTLAEIRATYADLPTDSATEDIVGVAGRVVFARNTGKLCFATLQDGDGTQLQAMISLDEVGRESLDRWKADVDIGDVVYVHGTVISSRRGELSVLADSWRMAAKALRPLPVAHKEMSEESRVRQRYVDLIVRPQAREVARQRIAVIRAVRNALERRGFLEVETPMLQTLAGGAAARPFVTHSNALDIDLYLRIAPELFLKRCIVGGFDRVFELNRVFRNEGSDSTHSPEFSMLETYQTYGTYDDSALITRELIQEVADEAIGTRQLSMPDGSVYDIDGEWATMEMYSSLSEALGEQITPETTVARLRDIASGLDVEID-NSVFGHGKLVEELWEHAVGNKLTAPTFVKDFPVETTPLTRQHRSIPGVTEKWDLYVRGVELATGYSELNDPVVQRDRFADQARAAAAGDDEAMQLDEDFLTALEYGMPPCTGTGMGIDRLLMCLTGLSIRETVLFPIVRPH 498
3 -160.0003bju_A mol:protein length:521 Lysyl-tRNA synthetase  ali model follow..  37  1........MSVDPNQYYKIRSQAIHQLKVNGEDPYPHKFHVDISLTDFIQKYSHLQPGDHTDITLKVAGRIHAKRASGGKLIFYDLRGEGVKLQVMANSRNYSEEEFIHINNKLRRGDIIGVQGNPGKTKKGELSIIPYEITLLSPCLHMLPHLHFGLDKETRYRQRYLDLILNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHNELDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKMVSGMVKHITGSYKVTYGQAYDVDFTPPFRRINMVEELEKALGMKLPETNLFETEETRKILDDIAVECPPPRTTARLLDKLVGEFLEVTCINPTFICDHPQIMSPLAKWHRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKAKAAGDDEAMFIDENFCTALEYGLPPTAGWGMGIDRVAMFLTDSNIKEVLLFPAMKPE 508
4 -157.0005hgq_A mol:protein length:524 Lysine--tRNA ligase  ali model follow..  37  2.......ADPSDPQEYFKLRTALINERRSKGINPYPHKFHVSISLADFIAKYNSLEKDVINDIVQSVAGRVFSKRESGGKLIFYDLHGEGTRLQVLANARFHGDEAFDNLHDRIKRGDIIGVNGYPARSKSGELSIIPYEIIQLTPCLHMLPHTHFGLNQETRYRMRYLDLIMNPDVKNRFVTRSRMISFLRRYLDNLGFLEVETPMMNLIAGGATAKPFITHHNDLDMDLYLRVAPELYLKMLVVGGIDRVYEIGRVFRNEGIDQTHNPEFTSCEFYMAYADYEDLMKITEDMLARMVYYMHGTYKIQYHPVYEVDFTPPFRKVNIYDGLQEKLGIQFPPADTLDTDEANKFFDKLNVECPAPRTTARLLDKLIGEFLEPTFISPTFLTGHPQIMSPLAKWHRSIPGLTERFELFVVTKEIVNAYTELNDPLTQRLRFDEQAKQKQAGDDEAQNIDENYCTALEYGLPPTAGWGMGIDRLAMILTDSNIKEVLFFPAMRPD 511
5 -157.0005eln_A mol:protein length:535 Lysine--tRNA ligase  ali model follow..  34  3.MGTLEAQTQGPGSHYTDNRYKMMECIKDAGRPFYPHKFKISMSLPAYALKYGNVENGYIKDTTLSLSGRVTSIRSSSSKLIFYDIFCEEQKVQIIANIMDISTGEFSVSHSEIRRGDVVGFTGFPGKSKRGELSLFSKSVVLLSPCYHMLPTAISGLDQEVRYRQRYLDLMLNEESRKVFKLRSRAIKYIRNYFDRLGFLEVETPMLNMIYGGAAARPFITYHNELETQLYMRIAPELYLKQLIVGGLDKVYEIGKNFRNEGIDLTHNPEFTAMEFYMAYADYYDLMDLTEELISGLVLEIHGSLKIPYHKCIEIDFTTPWKRFSFVEEIESGLGEKLKRPLDSQENIDFMVEEKHEIELPHPRTAAKLLDKLAGHFVETKCTNPSFIIDHPQTMSPLAKWHREKPEMTERFELFVLGKELCNAYTELNEPLQQRKFFEQQADAKASGDVEACPIDETFCLALEHGLPPTGGWGLGIDRLIMFLADKNIKEVILFPAMRNV 516
6 -155.0003a74_A mol:protein length:493 Lysyl-tRNA synthetase  ali model follow..  40  1........SHEELNDQLRVRREKLKKIEELGVDPFGKRFERTHKAEELFELYGDLSKEEEQQIEVAVAGRIMTKRGMGKAGFAHIQDVTG-QIQIYVRQDDVGEQQYELF-KISDLGDIVGVRGTMFKTKVGELSIKVSSYEFLTKALRPLPEKYHGLDIEQRYRQRYLDLIMNPESKKTFITRSLIIQSMRRYLDSHGYLEVETPMMHAVAGGAAARPFITHHNALDMTLYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGISTRHNPEFTMLELYEAYADFRDIMKLTENLIAHIATEVLGTTKIQ-YGEHLVDLTPEWRRLHMVDAIKEYVGVDFWRQMSDEEARELAKEHGVEVA--PHMTFGHIVNEFFEQKVEDKLIQPTFIYGHPVEISPLAKKNPDDPRFTDRFELFIVGREHANAFTELNDPIDQRQRFEEQLKEREQGNDEAHEMDEDFLEALEYGMPPTGGLGIGVDRLVMLLTNSSIRDVLLFPQMRHK 493
7 -154.0001e1o_A mol:protein length:504 LYSYL-TRNA SYNTHETASE, HEAT INDUCIBLE  ali model follow..  38  3.QETRGANEAIDFNDELRNRREKLAALRQQG-VAFPNDFRRDHTSDQLHEEFDAKDNQESLNIEVSVAGRMMTRRIMGKASFVTLQDVGG-RIQLYVARDSLPEGVYNDQFKKWDLGDIIGARGTLFKTQTGELSIHCTELRLLTKALRPLPDKFHGLDQEVRYRQRYLDLIANDKSRQTFVVRSKILAAIRQFMVARGFMEVETPMMQVIPGGASARPFITHHNALDLDMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYHDLIELTESLFRTLAQEVLGTTKVT-YGEHVFDFGKPFEKLTMREAIKKYRPETDMALDNFDAAKALAESIGITVE--KSWGLGRIVTEIFDEVAEAHLIQPTFITEYPAEVSPLARRNDVNPEITDRFEFFIGGREIGNGFSELNDAEDQAERFQEQVNAKAAGDDEAMFYDEDYVTALEYGLPPTAGLGIGIDRMIMLFTNSTIRDVILFPAMRPQ 503
8 -153.0001bbu_A mol:protein length:504 PROTEIN (LYSYL-TRNA SYNTHETASE)  ali model follow..  37  3.QHAQGADAVVDLNNELKTRREKLANLREQG-IAFPNDFRRDHTSDQLHAEFDGKENEEALNIEVAVAGRMMTRRIMGKASFVTLQDVGG-RIQLYVARDDLPEGVYNEQFKKWDLGDILGAKGKLFKTKTGELSIHCTELRLLTKALRPLPDKFHGLDQEARYRQRYLDLISNDESRNTFKVRSQILSGIRQFMVNRGFMEVETPMMQVIPGGAAARPFITHHNALDLDMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYKDLIELTESLFRTLAQDILGKTEVT-YGDVTLDFGKPFEKLTMREAIKKYRPETDMALDNFDSAKAIAESIGIHVE--KSWGLGRIVTEIFEEVAEAHLIQPTFITEYPAEVSPLARRNDVNPEITDRFEFFIGGREIGNGFSELNDAEDQAQRFLDQVAAKDAGDDEAMFYDEDYVTALEHGLPPTAGLGIGIDRMVMLFTNSTIRDVILFPAMRPV 503
9 -153.0004ycv_A mol:protein length:516 Lysine--tRNA ligase  ali model follow..  33  1........MEVDPRLYFENRSKFIQDQKDKGINPYPHKFERTISIPEFIEKYKDLGNGEHEDTILNITGRIMRVSASGQKLRFFDLVGDGEKIQVLANYSFHNHENFAECYDKIRRGDIVGIVGFPGKSKKGELSIFPKETILLSACLHMLPMKYGLKDTEIRYRQRYLDLLINESSRHTFVTRTKIINFLRNFLNERGFFEVETPMMNLIAGGANARPFITHHNDLDLDLYLRIATELPLKMLIVGGIDKVYEIGKVFRNEGIDNTHNPEFTSCEFYWAYADYNDLIKWSEDFFSQLVYHLFGTYKISYNQPIEIDFTPPYPKVSIVEEIEKVTNTILEQPFDSNETIEKMINKEHKIELPNPPTAAKLLDQLASHFIENKYNKPFFIVEHPQIMSPLAKYHRTKPGLTERLEMFICGKEVLNAYTELNDPFKQKECFKLQQKDREKGDTEAAQLDSAFCTSLEYGLPPTGGLGLGIDRITMFLTNKSIKDVILFPTMRPA 507
10 -150.0004ex5_A mol:protein length:529 Lysine--tRNA ligase  ali model follow..  42  19.PIQPQAAVAADENQIVAERRDKLRALRDQG-IAYPNDFQPTHHAADLQTAYADADKEAAKSLEVAIAGRMMLKRVMGKASFATVQDGSG-QIQFFVTPADVGAETYDAF-KKWDLGDIVAARGVLFRTNKGELSVKCTQLRLLAKALRPLPDKFHGLDQETRYRQRYVDLIVTPETRTTFRARTKAIASIRKFMGDADFMEVETPMLHPIPGGAAAKPFVTHHNALDMEMFLRIAPELYLKRLIVGGFERVFEINRNFRNEGVSPRHNPEFTMMEFYAAYTDYRWLMDFTERLIRQAAVDALGTATIQ-YQGRELDLAQPFHRLTITQAIQKYAPSYTDGQLDDAFLRSELKRLGVDQPAFLNAGIGALQLALFEETAEAQLWEPTFIIDYPIEVSPLARESDTVAGITERFELFITGREIANGFSELNDPEDQAARFKKQVEQKDAGDEEAMFFDADYIRALEYGMPPTGGCGIGIDRLVMLLTDSTIRDVLLFPHLRRE 522
11 -147.0006chd_A mol:protein length:597 Lysine--tRNA ligase  ali model follow..  37  62.NGVGPEEESVDPNQYYKIRSQAIHQLKVNGEDPYPHKFHVDISLTDFIQKYSHLQPGDHTDITLKVAGRIHAKRASGKLIFYDLRGEGV-KLQVMANSRNYSEEEFIHINNKLRRGDIIGVQGNPGKTKKGELSIIPYEITLLSPCLHMLPHLHFGLDKETRYRQRYLDLILNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHNELDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKMVSGMVKHITGSYKVTYGQAYDVDFTPPFRRINMVEELEKALGMKLPETNLFETEETRKILDDIAVECPPPRTTARLLDKLVGEFLEVTCINPTFICDHPQIMSPLAKWHRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKAKAAGDDEAMFIDENFCTALEYGLPPTAGWGMGIDRVAMFLTDSNIKEVLLFPAMKPE 576
12 -134.0004up7_A mol:protein length:777 LYSINE--TRNA LIGASE  ali model follow..  35  2..........MLSKQLFLNRCKDVEEYQKAGHNPWPHKFNVSITVPEFIAKYSGLEKSQVSDDIVSVAGRVLSKRSSSSLMFIDLHDSQT-KLQIMLNKSAYENEDFVSLTKMIYRGDICGFTGHPTRTKTGELSLIPISGMILSPCLHMLPSMHYGLDQETRFRKRYLDLIVNPESVKNFVLRTKVVKAVRKYLDDKGFLEVETPILNTIPGGATARPFITHHNQLDIQMYMRIAPELYLKELVVGGINRVYEIGRLFRNEGIDQTHNPEFTTCEFYMAYADYNDIMKMTEELLGNMVKDITGGSTKLEIKDRLMDINNEEDIKMLEKFFKEPIPRPFNSAECSKVIEKHCTELNYYTAPFKRISYVHALEEKFGEKIPRPLDGPEALTFQPQLMSPLAKYHRSEPELTERFELFILKREIANAYTELNNPIVQRSNFEQQAKDKAAGDDEAQLVDEVFLDAIEHAFPPTGGWGLGIDRLAMLLADVNIKEVILFPTMRPE 564
13 -104.0003a5y_A mol:protein length:345 Putative lysyl-tRNA synthetase  ali model follow..  29  4.............................................................................................................................................................SSSGLVPRGSHMSETASSASIPNLLKRAAIMAEIRRFFADRGVLEVETPCMSQTVTDIHLVPFETRGHSQGMNLWLMTSPEYHMKRLLVAGCGPVFQLCRSFRNEEMGRYHNPEFTMLEWYRPHYDMYRLMNEVDDLLQQVLD------------------CPAAESLSYQQAFLRYLEIDPLSADK-TQLREVAAKLDLSNVADTEEDRDTLLQLLFTFGVEPNIEKPTFVYHFPASQASLAQISTEDHRVAERFEVYYKGIELANGFHELTDAREQQQRFEQDNRKRAARGLPQHPIDQNLIEALKVGMPDCSGVALGVDRLVMLALGATLAEVIAFSVDR.. 338
14 -99.8003g1z_A mol:protein length:326 Putative lysyl-tRNA synthetase  ali model follow..  30  10.............................................................................................................................................................................PSASIPNLLKRAAIMAEIRRFFADRGVLEVETPCMSQTVTDIHLFPFETRGHSQGINLYLMTSPEYHMKRLLAAGCGPVFQLCRSFRNEEMGRHHNPEFTMLEWYRPHYDMYRLMNEVDDLLQQVLDCQ------------------PAESLSYQQAFQRHLEIDPLSADKTQ-LREAAAKLDLSNIADTEEDRDTLLQLLFTMGVEPHIEKPTFIYHFPASQASLAQISTEDHRVAERFEVYYKGIELANGFHELTDAREQQQRFEQDNRKRAARGLPQQPIDQNLLDALAAGLPDCSGVALGVDRLVMLALGASLADVIAFTVDR.. 325
15 -97.9001efw_A mol:protein length:580 ASPARTYL-TRNA SYNTHETASE  ali model follow..  24  1......................................MRRTHYAGSLRETH--------VGEEVVLEGWVNRRRDLGGLIFLDLRDREG-LVQLVAHPASPAYATAERVRPVRAKGLVRLRPEPNPRLATGRVEVELSALEVLAEAKTPPFPVDAGWSEELRLKYRYLDLR-RRRMQENLRLRHRVIKAIWDFLDREGFVQVETPFLTKSTPEGARDFLVPYRHEPGLFYALPQSPQLFKQMLMVAGLDRYFQIARCFRDEDLRADRQPDFTQLDLEMSFVEVEDVLELNERLMAHVFREALGSGGVAKFLEPVREALLQATEARPGDTLLFVAGPRKVAATALGAVRLRAADLLGLKREGFRWVVDFPLLEWDEEEEAWTYMHHPFTSPHPEDLPLLEK--DPGRVRALAYDLVLNGVEVGGGSIRIHDPRLQARVFRLLGI----GEEEQREKFGFFLEALEYGAPPHGGIAWGLDRLLALMTGSSIREVIAFPKNKEG 554
16 -96.0004j15_A mol:protein length:521 Aspartate--tRNA ligase, cytoplasmic  ali model follow..  18  6.SGLVPRGSHMPSASASRKSQEKPREIMDAAEDYAKERYGISSMIQSQEKPDRVLVRIQKADEVVWVRARVHTSRAKGKQCFLVLRQQQF-NVQALVAVGDHASKQMVKFAANINKESIVDVEGVVRKVNQQDVELHVQKIYVISLAEPRLPEGRATVNQDTRLDNRVIDL-RTSTSQAVFRLQSGICHLFRETLINKGFVEIQTPKIISAASEGGANVFTVSY--FKNNAYLAQSPQLYKQMCICADFEKVFSIGPVFRAEDSNTRHLTEFVGLDIEMAFNYYHEVMEEIADTMVQIFKGLQE------------RFQTEIQTVNKQFPCEPFKFLEPTLRLEYCEALAMLREAGVEMGDEDDLST-PNEKLLGHLVKEKYDTDFYILDKYPLAVRPYTMPDPRNPKQSNSYDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEK--------IKAYIDSFRFGAPPHAGGGIGLERVTMLFLGHNVRQTSMFPRDPKR 512
17 -89.2001asy_A mol:protein length:490 ASPARTYL-tRNA SYNTHETASE  ali model follow..  20  6...........................DNYGKLPLIQSRDSDRTGQK-RVKFVDLDEAKDSDKEVLFRARVHNTRQQGALAFLTLRQQAS-LIQGLVKANKEGTISKNMVKGSLNLESIVLVRGIVKKVDEPNLEIHITKIYTISETPEALPAGLPVVNLDTRLDYRVIDL-RTVTNQAIFRIQAGVCELFREYLATKKFTEVHTPKLLGAPSEGGSSVFEVTY--FKGKAYLAQSPQFNKQQLIVADFERVYEIGPVFRAENSNTRHMTEFTGLDMEMAFEEYHEVLDTLSELFVFIFSELPKRFAHEIVEEFKLPKDGKMVRLTYKEGIE------------------MLRAAGKEIGDFEDLST-ENEKFLGKLVRDKYDTDFYILDKFPLEIRPYTMPDPANPKYSNSYDFFMRGEEILSGAQRIHDHALLQERMKAH------GLSPEDPGLKDYCDGFSYGCPPHAGGGIGLERVVMFYLDKNIRRASLFPRDPKR 487
18 -89.2004wj3_M mol:protein length:599 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  20  2.....................................GMMRSHYCGQLNESL--------DGQEVTLCGWVHRRRDHGGVIFLDVRDREG-LAQVVFDPD---RAETFAKADRVRSEFVVKITGKVRLRPSGSIEVLGYELEVLNQATPPFPLDEYSDGEETRLRYRFIDL-RRPEMAAKLKLRARITSSIRRYLDDNGFLDVETPILGRPTPEGARDYLVPSRTYPGHFFALPQSPQLFKQLLMVAGFDRYYQIAKCFRDEDLRADRQPEFTQIDIETSFLDESDIIGITEKMVRQLFKEVLDSPIVKFIPEANLNVILDRVGAVDGDIVFFGADKAKIVCDALGALRIKVGHDLKLLT--REWAPMWVVDFPMFEENDDGSLSALHHPFTSPKCTPAELEANPGAALSRAYDMVLNGTELGGGSIRIHDKSMQQAVFRVLGI----DEAEQEEKFGFLLDALKYGAPPHGGLAFGLDRLVMLMTGASIREVIAFPKTQSA 563
19 -86.6001eqr_A mol:protein length:590 ASPARTYL-TRNA SYNTHETASE  ali model follow..  21  2........................................RTEYCGQLRL--------SHVGQQVTLCGWVNRRRDLGSLIFIDMRDREG-IVQVFFDPDRADALK---LASELRNEFCIQVTGTVRARATGEIEVLASSLTIINRA-DVLPLDSNHVTEEARLKYRYLDL-RRPEMAQRLKTRAKITSLVRRFMDDHGFLDIETPMLTKATPEGARDYLVPSRVHKGKFYALPQSPQLFKQLLMMSGFDRYYQIVKCFRDEDLRADRQPEFTQIDVETSFMTAPQVREVMEALVRHLWLEVKGVDLGDFLNAEIIEDILDRTAAQDGDMIFFGADNKKIVADAMGALRLKVGKDLGLTDESKWAPLWVIDFPMFEDDGEGGLTAMHHPFTSPKDMTAAELKAAPENAVANAYDMVINGYEVGGGSVRIHNGDMQQTVFGILGI----NEEEQREKFGFLLDALKYGTPPHAGLAFGLDRLTMLLTGTNIRDVIAFPKTTA. 559
20 -85.9001b8a_A mol:protein length:438 PROTEIN (ASPARTYL-TRNA SYNTHETASE)  ali model follow..  20  1......................................MYRTHYSSEITEEL--------NGQKVKVAGWVWEVKDLGGIKFLWIRDRDG-IVQITAPKKKVDPELFKLIPK-LRSEDVVAVEGVVNFTPKAKFEILPEKIVVLNRAETPLPLDPTGAELDTRLNNRFMDL-RRPEVMAIFKIRSSVFKAVRDFFHENGFIEIHTPKIIATATEGGTELFPMKY--FEEDAFLAESPQLYKEIMMASGLDRVYEIAPIFRAEEHNTRHLNEAWSIDSEMAFEDEEEVMSFLERLVAHAINYVREHKELDILNFELEEPKLPFPRVSYDKALEILGDLGKEIPWGEDI-------------------DTEGERLLGKYMMENENAPLYFLYQYPSEAKPFIMKYDNKPEICRAFDLEYRGVEISSGGQREHRHDILVEQIKEKGLNPES--------FEFYLKAFRYGMPPHGGFGLGAERLIKQMLDPNIREVILFPRDRRR 435
21 -85.8003i7f_A mol:protein length:548 Aspartyl-tRNA synthetase  ali model follow..  20  4.SMAATQEKKPQLPPVVLLKTPELVSGENFKVMPMHQSQPCYKTGLKYTEIEE---VPAMAEKTVTIRARVQAVRGKGNMVFLFLRKGIY-TCQALVMKSETISKEFVQFCQKISAESICDITGIVKAVEKQDVEIHVTSIAVVSLAEYPLPMQIEDVSQDTRLDNRMLDL-RTVTNIAIFRIQSACCGLFREFLTSQKFVEIHTPKLIGCSSEGGSNIFEVKY--FDRKAYLAQSPQLYKQMAIMGDFRKVFEVGPVFRAENSNTRHLTEFEGLDIEMEIVNYHECIDVMEKLFTFIFDEIPKRFPIRKQYPFEDLIYRPFLRLTYKEAIE------------------MLRASGETIGDYDDFT-TPQEVKLGELIKAKYNTDFYILDKFPAAIRPFTMPDIDDPNYSNSYDVFVRGQEITSGAQRIHDPEFLMKRCIEK------GVDPAT--LKDYIESFRFGSWPHAGCGIGLERITMLYLGPNIRKVTLFPRDPIR 545
22 -85.6004o2d_A mol:protein length:620 Aspartate--tRNA ligase  ali model follow..  22  2......................AMGTLEAQTQGPGSM-VLRTHAAGSLRPAD--------AGQTVTLAGWVARRRDHGGVIFIDLRDASG-VSQVVFREGDVLAA-----AHRLRAEFCVAVTGVV-EIPTGQIEVNATELTVLGESA-PLPFQLDEQGEEARLKYRYLDL-RREGPGNALRLRSKVNAAARSVLAEHDFVEIETPTLTRSTPEGARDFLVPARLQPGSFYALPQSPQLFKQLLMVAGMERYYQIARCYRDEDFRADRQPEFTQLDMEMSFVEADDVIAISEQVLKAVWATIGYDLPMRRFGSDKPDLRFGIELVECTEYFKDTLGGPVAKNLSDAERDGLVAHVGANFPMFEAADEATAAGDVAVGSGAWTAMHHAFTAPKPDSVDTFDS--DPGNALSDAYDIVCNGNEIGGGSIRIHRRDIQERVFAMMGI----DHDEAQEKFGFLLDAFSYGAPPHGGIAFGWDRITALLAGVSIREVIAFPKSGG. 575
23 -85.5004ah6_A mol:protein length:617 ASPARTATE--TRNA LIGASE, MITOCHONDRIAL  ali model follow..  20  2...............................IPEFSSFVVRTNTCGELRSSH--------LGQEVTLCGWIQYRRQNT---FLVLRDFDG-LVQVIIPQDESAASVKKIL-CEAPVESVVQVSGTVIKMPTGEIEIKVKTAELLNACKKPFEIKNFVKTEALRLQYRYLDLR-SFQMQYNLRLRSQMVMKMREYLCNLGFVDIETPTL-FKRTPGGAKEFLVPSREPGKFYSLPQSPQQFKQLLMVGGLDRYFQVARCYRDEGSRPDRQPEFTQIDIEMSFVDQTGIQSLIEGLLQYSWPNDKDPVVLATYGTDKPDTRFGMKIIDISDVFRNTEIGFLQDALSKPECADLLETRGVVLRDPTLFSFLWVVD-LPKEENPRELESAHHPFTAPHPSDIHLLYTEPKKARSQHYDLVLNGNEIGGGSIRIHNAELQRYILATL-------LKEDVKMLSHLLQALDYGAPPHGGIALGLDRLICLVTGSSIRDVIAFPKSFR. 570
24 -82.6004rmf_A mol:protein length:609 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  23  3........................................RTHAAGSLRP--------ADAGQTVTLAGWVARRRDHGGVIFIDLRDASG-VSQVVFREGDVLAA-----AHRLRAEFCVAVTGVV-EIPTGQIEVNATELTVLGESA-PLPFQLDEQGEEARLKYRYLDL-RREGPGNALRLRSKVNAAARSVLAEHDFVEIETPTLTRSTPEGARDFLVPARLQPGSFYALPQSPQLFKQLLMVAGMERYYQIARCYRDEDFRADRQPEFTQLDMEMSFVEADDVIAISEQVLKAVWATIGYDLPMRRFGSDKPDLRFGIELVECTEYFKDATRIEIAKRLDLIDPNAWAFTWVVDFPMFEAADEATAAGDVAVGSGAWTAMHHAFTAPKPDSVDTFDS--DPGNALSDAYDIVCNGNEIGGGSIRIHRRDIQERVFAMMGI----DHDEAQEKFGFLLDAFSYGAPPHGGIAFGWDRITALLAGVSIREVIAFPKSGG. 559
25 -82.0005xix_A mol:protein length:472 Asparagine--tRNA ligase, cytoplasmic  ali model follow..  17  3.............SSSSGLVPRGSHMAKKITIKNDPSLPEPKCVKIG--------ALEGYRGQRVKVFGWVHRLRRQGKLMFLVLRDGTG-YLQCVLADELCQCYNG----VLLSTESSVAVYGMLNLTPKGKQALSCDFWELIGLAPAGGADNLINSDVDVQLNNRHMMI-RGENMSKILKARSMVTRCFRDHFFDRGYYEVTPPTLVQTQVEGGATLFKLDY--FGEEAFLTQSSQLY-LETCLPALGDVFCIAQSYRAEQSRTRHLAEYTHVEAECPFLTFDDLLNRLEDLVCDVVDRILKSPAGSELNPNFQPPKRPFKRMNYSDAIV------------------WLKEHDVKKEDGTFYEFGEDIPEAPERLMTDTINEPILLCRFPVEIKSYMQRCPEDSRLTESVDVLMNVGEIVGGSMRIFDSEEILAGYKREGIDPTP--------YYWYTDQRKYGTCPHGGYGLGLERFLTWILNYHIRDVCLYPRFVQR 463
26 -81.7005w25_A mol:protein length:616 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  21  2.........................GSSSSGLVPRGSHVLRSHAAGLLREGD--------AGQQVTLAGWVARRRDHGGVIFIDLRDASG-IAQVVFRDPQ--DTEVLAQAHRLRAEFCVSVAGVVEEIATGEIEVNATSLTVLGEC-APLPFQLDEPGEELRLKYRYLDL-RRDDPAAAIRLRSRVNAAARAVLARHDFVEIETPTITRSTPEGARDFLVPARLHPGSFYALPQSPQLFKQLLMVAGMERYYQIARCYRDEDFRADRQPEFTQLDMEMSFVDAEDIIAISEEVLTELWALIGYRIPMRRFGTDKPDLRFGLELVECTDFFSDTVLVAEDGTLGGPVAKNLTEAERTGLADHVGAKPGDCIAAGEVAVGSGAWTAVHHAFTAPKPEWEDRIESDTGSVLADAYDIVCNGHEIGGGSVRIHRRDIQERVFAVMGL----DKAEAEEKFGFLLEAFMFGAPPHGGIAFGWDRTTALLAGMSIREVIAFPKTGG. 578
27 -80.9003m4p_A mol:protein length:456 Asparaginyl-tRNA synthetase, putative  ali model follow..  16  2......................PGSMMTEATTTPVETPIVCNIR-----------DAAGLEGKLVTFKGWAYHIRKARKLIFVELRDGSG-YCQCVIFGKELCEPEK---VKLLTRECSLEITGRLNAYAGLNLEMQVTEWKVIGESPIDLENIINKSSIPQKMQNRHIVI-RSEHTQQVLQLRSEIQWYFRKYYHDNHFTEIQPPTIVKTQCEGGSTLFKLQY--FNEPAYLTQSSQLY-LESVIASLGKSFCMLSSYRAEQSRTRHLAEYLHLEAELPFISFEDLLNHLEDLVCTVIDNVMAVHKIRKMNPHLKLPTRPFKRMTYADAIKYCNDHGILNKDKPFE-------------------YGEDISEKPERQMTDEIGCPIFMIHFPSKMKAFMSKVPGHPDLTESVDLLMPGVEIVGGSMRIWNYDELMGAYKANGLNPDP---------YWYTQQRKYGSCPHGGYGLGVERLVMWLLGDHIRKVCLYPRYLER 453
28 -80.0001wyd_A mol:protein length:429 hypothetical aspartyl-tRNA synthetase  ali model follow..  23  1......................................MYRSHFIADVTPEY--------DGKEVIWAGWVHLLRDLGGKKFIILRDKTG-LGQVVVDKNSSAFGIS----QELTQESVIQVRGIVKADKRAPIELHAEEITLLSKAKAPLPLDVSGADIDTRLRERVLDL-RRQEMQAVIKIQSLALKAFRETLYKEGFIEIFTPKIIASAGGAQLFPVIYFGK----EAFLAQSPQLY-KELMAGVVERVFEVAPAWRAEESDTFHLAEFISMDVEMAFADYNDVMQLLEKILHNIVKTIKEEGELKILNYEPPEVKIPIKRLKYTEAIEILRSKGYNIKFGDD-----------------------IGTPELRILNEELKEDLYFIVDWPSDARPFTKSKSENPELSESFDLIYKFLEIVSGSTRNHKREVLEEALKKKGLKPES---------EFFLKWFDYGMPPHAGFGMGLARLMVMLTGQSVKEIVPFPRDKKR 426
29 -79.7001x54_A mol:protein length:434 Asparaginyl-tRNA synthetase  ali model follow..  19  11........................................................KPELDGKKVRLAGWVYTNMRVGKKIFLWIRDSTG-IVQAVVAKNVVGEETFEKAKK-LGRESSVIVEGIVKADEPGGAEVHVEKLEVIQAVSEFPIPENPEASPELLLDYRHLHI-RTPKASAIMKVKETLIMAAREWLLKDGWHEVFPPIL--VTGAVEGGATLFKLKYFDKYAYLSQSAQLYLE-AAIFGLEKVWSLTPSFRAEKSRTRHLTEFWHLELEAAWMDLWDIMKVEEELVSYMVQRTLELRKFRDDLTTLKNTEPPFPRISYDEAIDILQSKGVN------------------------VEWGDDLGADEERVLTEEFDRPFFVYGYPKHIKAFYMKEDPN----DPRKVLASDMLAPEGYGEIIGGSQREDDYDKLLNRILEEGMDPKDY-EWYLDLRRYGSVPHSGFGLGVERLVAWVLKDHIRWAALFPRTPAR 431
30 -78.3001n9w_A mol:protein length:422 aspartyl-tRNA synthetase 2  ali model follow..  23  7.......................................................DLKAHVGQEVELLGFLHWRRDLGRIQFLLLRDRSG-VVQVVTGGL-----------KLPLPESALRVRGLVVENAKGGLEVQAKEVEVLSPALEPTPKEEWRANPDTLLEYRYVTL-RGEKARAPLKVQAALVRGFRRYLDRQDFTEIFTPKV--VRAGAEGGSGLFGVDYFEKRAYLAQSPQLY-KQIMVGVFERVYEVAPVWRMEHHTSRHLNEYLSLDVEMGFADEEDLMRLEEALLAEMLEEALNTDEIRLLGATWPSFPQDIPRLTHAEAKRILKEELGYPVGQD---------------------SEEAERLLGEYAKERWGSDWLFVTRYPRSVRPFYT-YPEEDGTTRSFDLLFRGLEITSGGQRIHRYEELLESLKAKGMDPEA---------HGYLEVFKYGMPPHGGFAIGAERLTQKLLGPNVRYARAFPRDRHR 419
31 -77.1002xti_A mol:protein length:437 ASPARAGINYL-TRNA SYNTHETASE, CYTOPLASMIC, PUTATIVE  ali model follow..  19  10..........................................................KHRNERVCIKGWIHRMRRQGKLMFFILRDGTG-FLQVLLMDKLCQTYDALT----VNTECTVEIYGAIKEVPEGKEALIADFWKIIGNAPPGGNVLNEEASVDKMLDNRHLVI-RGENAAALLRLRAAATRAMREHFYNAGYVEVAPPTLVQTQVEGGSTLFNLDY--FGEQSFLTQSSQLYLETC-IPTLGDVFCIAQSYRAESRTRRHLAEYAHVEAECPFITLDDLMEKIEELVCDTVDRLLADEEAKKINPKFQPPERPFLRMEYKDAIK------------------WLQEHNVENEFGNTFTYGEDIAEAAERFMTDTINKPILLNRFPSEIKAFMQRDAKDNTLTESVDLLMPGVEIVGGSMRIWKFDELSKAFKNVEIDPKP--------YYWYLDQRLYGTCPHGGYGLGLERFICWLTNNHIRDVCLYPRFVGR 434
32 -57.9002zni_A mol:protein length:308 Pyrrolysyl-tRNA synthetase  ali model follow..  16  4............................................................................................................SSSGLVPRGSHMFLTRRDQYQRLKELNASGEQLEMGFSDALSRDRAFQGIHQLMSQGKRHLEQLRTVKHRPAL---LELEEKLAKALHQQGFVQVVTPTIITKMTIGEDHPLFSQVFWLDGKKCLRLAPNLYTLWRLWDKPIRIFEIGTCYRKESQGAQHLNEFTMLNLTELGTPLEERHQRLEDMARWVLEAAGIRTESSVVYGDTVDVMKGDLELASGAMGPHFLDEKWEIFDPWVGL---------------GFGLERLLMIREGTQHVQSMARSLSYLDGVR............................................................................................................ 298
33 -48.6003p8t_A mol:protein length:294 AsnS-like asparaginyl-tRNA synthetase related protein  ali model follow..  17  2......................................................................................................................................................................NAVEI--SRDIYKAIDIQTKILDYMTKFFTDRGFKWLLPIMLSPIPDPAGEGIRPAEVDVYGVRMRLTHSMILHKQLAIAMGLEKIFVLSPNIRLESRDGRHSYEFTQLDFEIEGAKMKDVMRLIEELIYGLFRKAEEWT------GREFPRARHFKVYDYKDILEEFGS---------------------------------------DEKASMEMEEPFWIVNIPREFYD---REENGVWKNYDLILPYGYGEVSSGGEREWEYEKIVAKIRAAGLKEDS---------RPYLEIARAGLKPSAGAGIGVERLVRFIVGKHIAEVQPFP..... 285
34 -46.2001nnh_A mol:protein length:294 asparaginyl-tRNA synthetase-related peptide  ali model follow..  15  2......................................................................................................................................................................NAVEI--SREISPTLDIQTKILEYMTDFFVKEGFKWLLPVIISPIPDPAGEGMEPAEVEIYGVKMRLTHSMILHKQLAIAMGLKKIFVLSPNIRLESRDGRHAYEFTQLDFEVERAKMEDIMRLIERLVYGLFRKAEEWT------GREFPKTKRFEVFEYSEVLEEFGS---------------------------------------DEKASQEMEEPFWIINIPREFYDR---EVDGFWRNYDLILPYGYGEVASGGEREWEYEKIVAKIRKAGLNEDS---------RPYLEIAKAGLKPSAGAGIGVERLVRFIVGKHIAEVQPFP..... 285
35 -40.0004lns_A mol:protein length:351 Asparagine synthetase a  ali model follow..  13  4.....................................................................................................................................................................DGYSSYV--LLQEQILTVKRSFSEALEKEL---NLVEVRAPILFRVGDGTQDNLSGFEKAIPNASFEVVHSLAKWLANYKFAPGHGLYTHMTALRDDVLDNIHSVVVDQWDWEMVMKDDQRNLAFLKEVVCKVYAAIRKTELAVCEKKQKPILPETIQFVHAEHLLLA-----YPNLTAKEREREIAREYGAVFGIGAVLSSGDRHDARAPDYDDWTSPVEASQVVFPRTSKPIPTMNSLSSLKGLNGDILLYNPTLDDSL-EVSSMGIRVNAEALRHQISLTGDDSLLKSE--HQQLLNGEFPQTVGGGIGQSRMVMFMLRKHIGEVQVWP..... 341
36 -39.6004bw9_A mol:protein length:291 PYRROLYSINE--TRNA LIGASE  ali model follow..  15  2..........................................................................................................GSSSSGLVPRGSHMASAPALTKSQTDRLEVLLNPKDEISLNS---GKPFRELESELLRRKKDLQQIYAEERENY---LGKLEREITRFFVDRGFLEIKSPILIPLMGIDNDTELSKQIFRVDKNFCLRPMLAPNLGNYLLPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGRENLESIITDFLNHLG----------------IDFKIVGDSCMVFGDTLDVMHGDLELSSAVVGPRPLDREWGID--------------------------KPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGIST................................................................................ 283
37 -37.0002e3c_A mol:protein length:291 Pyrrolysyl-tRNA synthetase  ali model follow..  17  6..............................................................................................................SGLVPRGSHMASAPALTKSQTDRLEVLLNPKDEISLNS---GKPFRELSELLSRRKKDLQQIYAEEREN---YLGKLEREITRFFVDRGFLEIKSPILIPLMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLLPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCENLESIITDFLNHLGIDFKIVGDSCMVYGDTLDVMHGDLELSGPIPLDREWGIDKPWIGAGFGLERLLK..................................................................................................................................................... 260
38 -36.1004tqd_A mol:protein length:291 Pyrrolysine--tRNA ligase  ali model follow..  16  6..............................................................................................................SGLVPRGSHMASAPALTKSQTDRLEVLLNPKDEISLNS---GKPFRELSELLSRRKKDLQQIYAEEREN---YLGKLEREITRFFVDRGFLEIKSPILIPLMGIDNDTELSKQIFRVDKNFCLRLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLSFIQMGSGRENLESIITDFLNHLGIDFKIVGDSCMVYGDTLDVMHGDLELSGPIPLDREWGIDKPWIGAGFGLERLL...................................................................................................................................................... 259
39 -34.50011as_A mol:protein length:330 ASPARAGINE SYNTHETASE  ali model follow..  14  1........................................................................................................................................................................MKTAYIAKQRQISFVKSHFSRQLEERL---GLIEVQAPILSRVGDGAEKAVQVKVKALPDAQFEVVHSLAKWKRQTLFSAGEGLYTHMKALREDRLSPLHSVYVDQWDWERVMGDGERQFSTLKSTVEAIWAGIKATAAVSEEFGLAPFLPDQIHFVHSQELLSR-----YPDLDAKGRERAIAKDLGA------------FLVGIGGKLSDRHDVRAPDYDDWSTPSELGHAGLNGD--ILVWNPVLEDAFELSSMGIRVDADTLKHQLALTGDEDRLE---------EWHQALLRGEMPQTIGGGIGQSRLTMLLLQPHIGQVQVWP..... 319
40 -26.6003qtc_A mol:protein length:290 Pyrrolysyl-tRNA synthetase  ali model follow..  16  3..............................................................................................................GGLVPRGSHGASAPALTKSQTDRLEVLLNPKDEISLN-----SGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLMGIDNDTELSKQIFRVDKNFCLRPMLTPNLYNYLRK---KIFEIGPCYRKESDGKEHLEEFTMLVFWQMGSGRENLESIITDFLNHLG----------------IDFKIVGDSCMVFGDTLDVMHGDLELSSALVGPIPLDREWGID--------------------------KPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGIST................................................................................ 280
41 -25.1005k1p_A mol:protein length:274 Pyrrolysine--tRNA ligase  ali model follow..  21  32..............................................................................................................................................................ELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLLPDPIKIFEIGPCYRKESDGKEHLEEFTMLAFAQMGSGRENLESIITDFLNHL............................................................................................................................................................................................................ 184
42 -24.2004q6g_A mol:protein length:267 Pyrrolysine--tRNA ligase  ali model follow..  20  31..............................................................................................................................................................ELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLMGIDNDTELSKQIFRVDKNFCLRPMVAPNIFNYARKLDRKIFEIGPCYRKESDGKEHLEEFTMLNFFQMGSGRENLESIITDFLNHL............................................................................................................................................................................................................ 183
43 -19.3004cs2_A mol:protein length:274 PYRROLYSINE--TRNA LIGASE  ali model follow..  21  32..............................................................................................................................................................ELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLMGIDNDTELSKQIFRVDKNFCLRPMLAPNLANYLRKLDRKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGRENLESIITDFLNHL............................................................................................................................................................................................................ 184
44 -18.5004gla_C mol:protein length:109 OBody NL8  ali model follow..  19  2................................SVYPKK---THWTAEITPNL--------HGTEVVVAGWVASLGDYGRVKIVKVSDREGAAVPVYLEAGKTPDHLFKVFAE-LSREDVVVIKGIVEASKGRGVEIFPSEIWILNKA................................................................................................................................................................................................................................................................................................................................................................... 107
45 -16.6004gn5_A mol:protein length:113 OBody AM3L15  ali model follow..  19  3......................................PKKTHWTAEITPNL--------HGSEVVVAGWVAHLGDYGRVKIVKVSDREGGAAVPVYLERGKTPDHLFKVFAELSREDVVVIKGIVEAGWDTGVEIFPSEIWILNKA-KPLP.............................................................................................................................................................................................................................................................................................................................................................. 111
46 -16.5004glv_B mol:protein length:107 OBody AM3L09  ali model follow..  17  3......................................PKKTHWTAEITPNL--------HGSEVVVAGWVAHLGDYGRVKIVKVSDREGGAAVPVYLERGKTPDHLFKVFAELSREDVVVIKGIVEATTVTRWDIFPSEIWILNKA................................................................................................................................................................................................................................................................................................................................................................... 107
47 -15.9004gn4_B mol:protein length:108 OBody AM2EP06  ali model follow..  18  5.......................................KKTHWTAEITP--------NLHGSEVVVAGWVAHLGDYGRVKIVKVSDREGGAAVPVYLERGKTPDHLFKVFAELSREDVVVIKGIVEASEATGVEIFPSEIWILNKA................................................................................................................................................................................................................................................................................................................................................................... 108
48 -14.3005gro_A mol:protein length:115 Aspartate--tRNA(Asp/Asn) ligase  ali model follow..  19  15........................................................SEKDVGKIVKVAGWCNTYRDHGGVVFIDLRDKSGL-VQLVCDPSSKAYEKALE----VRSEFVLVAKGKV-KLKTGKIEIVLEELIIENKS................................................................................................................................................................................................................................................................................................................................................................... 109
49 -14.1004gn3_B mol:protein length:113 OBody AM1L10  ali model follow..  19  8.......................................KKTHWTAEITP--------NLHGTEVVVAGWVASLGDYGRVKIVKVSDREGGAAVSVYLEYGKTPDHLFKVFAELSREDVVVIKGIVEASKAAAVEIFPSEIWILNKA................................................................................................................................................................................................................................................................................................................................................................... 112
50 -11.9001b70_A mol:protein length:350 PHENYLALANYL-TRNA SYNTHETASE  ali model follow..  17  1....................................................................................MLEEALAAIQNARDLEELKALKARYLGKKGLLTQEMKGLSALPLEERRKRGQELNAIKALEAALEAREKALEEAALKEALERERVDVSLPGASLFSGGLHTLMERELVEIFRALGYQAVEGPEVESEFFNFDALNIPEHHPARDMRLLLRTHTSPMQVRYMVAHTPRIVVPGRVFRFEQTDATHEAVFHQLE-----------------------------------------------------------GLVVGEGIAMAHLKGAIYE---------------LAQALFGPDSKVRF-QPVY---FP--VEPGAQFAVWWPEGGKWLELGGAGM------------------VHPKVFQAVDAYRERLGLPPAYRGVTGFA------FGLGVERLAMLRYGPDIRYFF........ 336
51 -11.7002rhq_A mol:protein length:294 Phenylalanyl-tRNA synthetase alpha chain  ali model follow..  14  7.............................................................................................................................................GLVPRGSHMGTELMEKLNQQLAEETIDVTLPSRQISIGSKHPLTRTVEEIEDLFLGLGYEIVDGYEVEQDYYNFEALNLPKSHPAITDEILMRTHTSPVQARTMEKRNGKIICPGKVYRRDSDDATHSHQFTQIEGLVVDKNIK--MSDLKGTLELVAKKLFGADREIRLRPSYFPFTEPSVEVDVSCFKCKGKGCNVCKHTG------------------------------WIEILGAGMVHPNVL--------------------------------------------------------------EMAGFDSNEYSGF--------AFGMGPDRIAMLKYG--IEDIRYF...... 269
52 -11.3003hri_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  12  35..................................................................................................................................................................................ETMRLRKYLFDVFHSTARKFGFEEYDSPVLESEAGEEITEQMFNFITKGGHRVALRPEMTPSLARQLLAKGRKWYSIPQCWRYEAITRGRRREHYQWNM-SVSSEVE-LVCAACTAMQSLGLS-------------SKDVGVKINSRKILQTVVEQAGVSADKFAPVCVIVDKMEKLPRE----------EVVAQLAAIGLESNVVDAITSTLSLKTIDEIAQRIGEEHEAVRELRDFITQIE-------------------------AYGFGDWVIFDASVVRGLAY---PCVGFGFGDCVIVELLNEKKL............ 348
53 -11.1003net_A mol:protein length:465 Histidyl-tRNA synthetase  ali model follow..  13  24..................................................................................................................................................................................SEKRLELYLLDTIRRVYESYGFTPIETPAVERLEPPNRQAEKDKSGDTGSEARALKFDQTVPLAAYIARHLNARYQMDVVFRGERAKDGRFRQFRQCDI---VVGREKLSLLYDAQMPAIITEIFEAVNIG-------DFVIRINNRKVLTGFFQSLNISETQIKSCISIIDNLEKIGEAKVKLELEKEGINPEQTQKDFVKIDGSVDDVLDKLKHLSQTLPESEQFNLGVSELETVFCIDLAIARGLNYYTGTVYETTLIGHEALGSICSGGR-----EELVGTFIGEKMPGVGISIGLTRLISRLLKAGI............ 363
54 -11.1004g85_A mol:protein length:517 Histidine-tRNA ligase, cytoplasmic  ali model follow..  12  33...............................................................................................................................KQQKASAELIEEEVAKLLKLKAQLGPDESKQKFVLKTPKGTRDYSPRQ-----MAVREKVFDVIIRCFKRHGAEVIDTPVFELKE-GEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAMN--KRYHIAKVYRRD------NPAMTR-EFYQCDFDI-ECLKIMCEILSSLQIG---------------DFLVKVNDRRILDGMFAICGVSDSKFRTICSSVDKLDKVSWEEVKNEMVGEKGLAPEVADRIGDGVSLVEQLLQDPKLSQNKQALEGLGD-GIDDKISFLARGLDYYTGYEAVLLQTPAQAGEEPLGVGSVAAGGRYDGLVGMFDPKGR----PCVGLSIGVERIFSIVEQRLE............ 409
55 -10.9003rac_A mol:protein length:373 Histidine-tRNA ligase  ali model follow..  14  29............................................................................................................................................................................MQDGYPDFAKRRRAVETRLLSFVEDAGYEPVTSGLFEYVRSPESSRDWIRLFDGGGDAVALRPEMTPSIARMAAPRVARWCYCERVYRRTDDPASLSWA-KAAESTQVGIER-DVLRLLHEASAAAGVR---------------HHRIVVSHARLVPRLLDALGISASLSRAFLACLTSGNYVQFRLWQLHAAKDVDLLANLLTWSPAERDAAKRSREASDRELEALLRDAVDPRAAADVRDAWRYLCRLAEALHDSG-------------------ASDVVTFDLALHRELDYGL-PAVGFAFEVERVMAVLEAQEEGE.......... 370
56 -10.6003hrk_A mol:protein length:456 Histidyl-tRNA synthetase  ali model follow..  13  35..................................................................................................................................................................................EAMRCRRHLFDVFHATAKTFGFEEYDAPVLESEAGEEITEQMFNFITKGGHRVALRPEMTPSLARLLLGK--KWYSIPQCWRYEAITRGRRREHYQWNM-SVSAEVE-LVCAACWAMRSLGLS---------------DVGIKVNSRKVLQTVVEQAGVTSDKFAPVCVIVDKMEKIPRE--------EAQLAVLGLEPTVVDAITTTLSLKSIDEIAQRVGEEHEAVKELRQFFEQVLFDASVVRGLAYYTGIVFEGFDREGKFRALCGGGR------DNLLTTYGSPTPPCAGFGFGDCVIVELLQEKRL............ 348
57 -10.5001wu7_A mol:protein length:434 Histidyl-tRNA synthetase  ali model follow..  11  18..................................................................................................................................................................................EDMDVEKFIFKTAEEAAEAFGFRRIDFPSLEYLSGEELLQQTYSFVDKGGREVTLIPEATPSTVRMVTSRKDRWYSFPKVWRYEEPQAGRYREHYQFNADIFGSDSPEADAEVIALASSILDRLGLQDIYEIRINSRKIMEEIIGGMTSSDPFSVFSIIDRYHKISREEFVDQLRSAGIGEDGVSMIADLCSGTRGIDEMARITGKSSEEIARMAAVEDLLASYG---------VKNVRYDFSIVRGLSYYTGIVFEAYDRSGQFRAILGGGR------DNLASLMSGESVPAVGFGMGDAVISLLLKRENV............ 326
58 -9.8703od1_A mol:protein length:400 ATP phosphoribosyltransferase regulatory subunit  ali model follow..  12  16............................................................................................................................................................................MRDTLPEWYKTKKNICDQMTEEINLWGYDMIETPTLEYYVSAILDQQLFKLLDQQGNTLVLRPDMTAPIARLVASSLKRLAYQSNVYRAQQNEGGKPAEFEQVELIGDGTASADVIALMIAALKRAGLS---------------EFKVAIGHVGYVNALLMDVVGNEQRADRLRRFLYEKNYVGYREHVKSLNLSTIDKSRLMN-------------------------SLRGGRAAIEEARGLIQTEKGKTALAEMTKLYEVLESY---------GASEYVKFDLTLVLHMSYRPAQATGFGVRIDLLVEALNGEIISN.......... 334
59 -9.8104g84_A mol:protein length:464 Histidine--tRNA ligase, cytoplasmic  ali model follow..  12  2.....................................................................................................................................................PGSEFELRRQFVLKTPKGTRDYSPRQ-----MAVREKVFDVIIRCFKRHGAEVIDTPVFELKE-GEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAMN--KRYHIAKVYRRDAMTRGRYREFYQCDFFDPMIPDAECLKIMCEILSSLQIG---------------DFLVKVNDRRILDGMFAICGVSDSKFRTICSSVDKLDKVSWEEVKNEMVGEKGLAPEVADRIGDGVSLVEQLLQDPKLSQNKQALEGLGD-GIDDKISFLARGLDYYTGYEAVLLQTPAQAGEEPLGVGSVAAGGRYDGLVGMFDPKGR----PCVGLSIGVERIFSIVEQRLE............ 356
60 -9.4802el9_A mol:protein length:431 Histidyl-tRNA synthetase  ali model follow..  12  2.......................................................................................................................................................PGYQDPMAKNIQAIRGMNDYLPGE-----TAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTVTDVVEKEMYTFEDRNGDSLTLRPEGTAGCVRAGIEH--RLWYIGPMFRHERPQKGRYRQFHQLEVFGLQGPDIDLIMLTARWWRALGISEHVTLELNSIGSLE-------ARANYRDALVAFLEQHKEKLDEDCKRRMYTNPLRVDSKNPEVQALLNDAPALGDYLDEESREHFAGLCKL---LESAGIAYTVNQRLVRGLDYYNR-FEWVTNSLGSQGTVCAGGRY------------------DGLVEQLGGRATPAVGFAMGLERLVLLVQAVNP............ 328
61 -9.0003pco_A mol:protein length:327 Phenylalanyl-tRNA synthetase, alpha subunit  ali model follow..  12  4.................................................................................LAELVASAKAAISQASDVAALDNVRVEYLGKKGHLTLQMTTLRELPPEERPAAGAVINEAKEVQQALNARKAELESAALNARLAAETIDVSLPGRRIENGGLHTRTIDRIESFFGELGFTVATGPEIEDDYHNFDALNIPGHHPARADHDTFWFDTTRLLRTQTSGVQIRTMKAPGRVYRNDYDQTHTPMFHQMEGLIVDTNIS--FTNLKGTLHDFLRNFFEEDLQIRFRPSYFPFTEPSAEVDVMGKNGKWL-----------------------------------------EVLGCGMVHPNVL--------------------------------------------------------------RNVGIDPEVYSGF--------AFGMGMERLTMLRYG--VTDLRSF...... 315

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 7 6 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Awobuluyi M, Yang J, Ye Y, Chatterton JE, Godzik A, Lipton SA, Zhang D. Subunit-specific roles of glycine-binding domains in activation of NR1/NR3N-methyl-D-aspartate receptors. Mol Pharmacol. 2007 Jan;71(1):112-22. Epub 2006 Oct 17.