current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 6dbb_A mol:protein length:511 Putative aldehyde dehydrogenase family protein, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .
# Score Template Links and tools%idFirst MAMQFNDILAALDIDLAQWKGNALTARSPLDGATLATLAVDTPADAERKIDAAHDAFLKWRTVPAPVRGELVRVFGNVLREHKAELGRLVTLEAGKITSEGLGEVQEMIDICDFAVGLSRQLYGLTIASERPGHRMMETWHPIGVCGVISAFNFPVAVWAWNAALAFVCGDSVVWKPSEKTPLTAIACHVLLQKALREFEKTHPGVAPAELGQLVLGMRDVGEVLTASKKVPVVSATGSVRMGQEVAKVLSQRLARGILELGGNNGMIVAPSADLDLVVRAVTFAAVGTAGQRCTTLRRLIVHRSLVEQLLPRIEKAYASVKVGNPLEEGTLVGPLVDRASFDAMQKALADAREQGGEVKGGERVDVGHADAYYVRPAIVRMPKQSAVVERETFAPILYVMVYDNFDDAIDVHNAVPQGLSSAIFTNDMREAEQFMSAAGSDCGIVNVNIGTSGAEIGGAFGGEKETGGGRESGSDAWKAYMRRATNTINYSRQLPLAQGVKFDVLast
1 -146.0006dbb_A mol:protein length:511 Putative aldehyde dehydrogenase family protein  ali model  100  1MAMQFNDILAALDIDLAQWKGNALTARSPLDGATLATLAVDTPADAERKIDAAHDAFLKWRTVPAPVRGELVRVFGNVLREHKAELGRLVTLEAGKITSEGLGEVQEMIDICDFAVGLSRQLYGLTIASERPGHRMMETWHPIGVCGVISAFNFPVAVWAWNAALAFVCGDSVVWKPSEKTPLTAIACHVLLQKALREFEKTHPGVAPAELGQLVLGMRDVGEVLTASKKVPVVSATGSVRMGQEVAKVLSQRLARGILELGGNNGMIVAPSADLDLVVRAVTFAAVGTAGQRCTTLRRLIVHRSLVEQLLPRIEKAYASVKVGNPLEEGTLVGPLVDRASFDAMQKALADAREQGGEVKGGERVDVGHADAYYVRPAIVRMPKQSAVVERETFAPILYVMVYDNFDDAIDVHNAVPQGLSSAIFTNDMREAEQFMSAAGSDCGIVNVNIGTSGAEIGGAFGGEKETGGGRESGSDAWKAYMRRATNTINYSRQLPLAQGVKFDV 505
2 -128.0004x0t_A mol:protein length:513 Alpha-aminoadipic semialdehyde dehydrogenase  ali model follow..  45  21LREENEGVYNGSWGG----RGEVITTYCPANNEPIARVRQASVADYEETVKKAREAWKIWADIPAPKRGEIVRQIGDALREKIQVLGSLVSLEMGKILVEGVGEVQEYVDICDYAVGLSRMIGGPILPSERSGHALIEQWNPVGLVGIITAFNFPVAVYGWNNAIAMICGNVCLWKGAPTTSLISVAVTKIIAKVLED------NKLPGAICSLTCGGADIGTAMAKDERVNLLSFTGSTQVGKQVGLMVQERFGRSLLELGGNNAIIAFEDADLSLVVPSALFAAVGTAGQRCTTARRLFIHESIHDEVVNRLKKAYAQIRVGNPWDPNVLYGPLHTKQAVSMFLGAVEEAKKEGGTVVYGGKVMDR-PGNYVEPTIVTGLGHDASIAHTETFAPILYVFKFKNEEEVFAWNNEVKQGLSSSIFTKDLGRIFRWLGPKGSDCGIVNVNIPTSGAEIGGAFGGEKHTGGGRESGSDAWKQYMRRSTCTINYSKDLPLAQGIKFQ. 513
3 -128.0004v6h_A mol:protein length:484 Succinate-semialdehyde dehydrogenase (NADP+)  ali model follow..  24  11..LRHQAYIGGEWQAAD--SDATFEVFDPATGESLGTVPKMGAAETARAIEAAQAAWAGWRMKTAKERAAILRRWFDLVIANSDDLALILTTEQGKPLAEAKGEIAYAASFIEWFAEEGKRVAGDTLPTPDANKRIVVVKEPIGVCAAITPWNFPAAMIARKVGPALAAGCPIVVKPAESTPFSALAMAFLAERA----------GVPKGVLSVVIGPKAIGTEITSNPIVRKLSFTGSTAVGRLLMAQSAPTVKKLTLELGGNAPFIVFDDADLDAAVEGAIASKYRNNGQTCVCTNRFFVHERVYDAFADKLAAAVSKLKVGRGTESGATLGPLINEAAVKKVESHIADALAKGASLMTGGKRHAL-GHGFFEPTVLTGVKPDMDVAKEETFGPLAPLFRFASEEELVRLANDTEFGLAAYLYSRDIGRVWRV--AEALEYGMVGINTGLI-SNEVAPFGGVKQSGLGREGSHYGIDDYVVIKYLCVAV.............. 484
4 -127.0003jz4_A mol:protein length:481 Succinate-semialdehyde dehydrogenase [NADP+]  ali model follow..  28  8..FRQQALINGEWLDAN--NGEAIDVTNPANGDKLGSVPKMGADETRAAIDAANRALPAWRALTAKERATILRNWFNLMMEHQDDLARLMTLEQGKPLAEAKGEISYAASFIEWFAEEGKRIYGDTIPGHQADKRLIVIKQPIGVTAAITPWNFPAAMITRKAGPALAAGCTMVLKPASQTPFSALALAELAIRA----------GVPAGVFNVVTGAGAVGNELTSNPLVRKLSFTGSTEIGRQLMEQCAKDIKKVSLELGGNAPFIVFDDADLDKAVEGALASKFRNAGQTCVCANRLYVQDGVYDRFAEKLQQAMSKLHIGDGLDNGVTIGPLIDEKAVAKVEEHIADALEKGARVVCGGKAHER-GGNFFQPTILVDVPANAKVSKEETFGPLAPLFRFKDEADVIAQANDTEFGLAAYFYARDLSRVFRV--GEALEYGIVGINTGII-SNEVAPFGGIKASGLGREGSKYGIEDYLEIKYMCIGL.............. 481
5 -127.0003rh9_A mol:protein length:506 Succinate-semialdehyde dehydrogenase (NAD(P)(+))  ali model follow..  26  8LLENLTGYIGGRWKDSA--GGATFDVYNPATGSVIAKVPSMPEEDVVAAVEAGQSALRLTNPWPIETRRKWLEDIRDGLKENREEIGRILCMEHGKPWKEAQGEVDYAAGFFDYCAKHISALDSHTIPEKPKDCTWTVHYRPVGVTGLIVPWNFPIGMIAKKLSAALAAGCPSVIKPASETPLTMIAFFSVMDKL----------DLPDGMVNLVMGASVIGKVLCEHKDVPMLSFTGSTEVGRKLIVDTAEQVKKLALELGGNAPFIVFDDADLEAAADNLIANKFRGGGQTCVCANRIFVHEKVADAFGQKLAERVNKMTVGDGMNDGIDIGPLINKQGFDKVKRHLQDALDKGASLVAGKQPAELGDGLFFPPTVVQGVDREMCCYQEETFGPLVPMALFRTEEEVIDAGNDTEFGLASYVFTADAERAQRV--AAGLRFGHVGWNTGTG-PTPEAPFGGMKASGIGREGGLEGLFEFVEAQTVPRGFAENL.......... 488
6 -127.0002jg7_A mol:protein length:510 ANTIQUITIN  ali model follow..  45  18LSEDNPGVYNGSWGG----SGEVITSYCPANNEPIARVTQATLAEYEETVQKTREAWKMWADIPAPKRGEIVRQIGDALRKKIKVLGSLVSLEMGKIYVEGVGEVQEYVDVCDYAVGLSRMIGGPVLPSERPGHALIEQWNPVGLVGIITAFNFPVAVYGWNNAIALTCGNVCLWKGAPTTPLTSVAVTKIVAEVLEQ------NNLPGAICSMTCGGADIGTAMAKDERVDLLSFTGSTHVGKMVAMMVQERFGRKLLELGGNNAIIVFEDADLNLVVPSAVFASVGTAGQRCTTTRRLMLHESVHDAVVERIAKAYKQVRIGDPWDPSTLYGPLHTKQAVDQYLAAIEQAKQQGGTLVCGGKVMDR-PGNYVEPTIITGLAHDAPIVHTETFVPILYVLKFKTEEEAFAWNNEVQQGLSSSIFTKDLGRVFRWLGPKGSDCGIVNVNIPTSGAEIGGAFGGEKHTGGGRESGSDSWKQYMRRSTCTINYSKDLPLAQGIKFE. 510
7 -126.0005vbf_A mol:protein length:478 NAD-dependent succinate-semialdehyde dehydrogenase  ali model follow..  26  5..APLRLYIDGRFHDAD--GRRTQPVVDPGTTRVLGELPHATAHDIDAAVQAAHRAFVTWRHESPLVRSDLLRRAAALARERAETIGRHITMDQGKPLREAIAEVVSAAEQLEWHAEEGRRTYGRVVPARSPDVMQTVLREPIGVCAAFSPWNFPFSQAMHKIAAALASGCTLVLKGPEESPSAIVALAQLFHDA----------GLPPGCLNIVWGPGDVSKQLIEAPQVRKISFTGSVPVGKQLAALAASLMKRMTMELGGHAPVLVCADADVERAAAMLAAYKFRNAGQVCVSPTRFFVQRAAFDRFVCAYLDAVGTIRVGYGLDAGVTMGPLAHARRVDEIDAFVADATAKGAQIATGGMRLPG-PGHYFAPTVVLGPTRDTRLMNDEPFGPIVGIVPFDDLDDALAEANRLPFGLASYAFTTSARNAHRI--SRALEAGMVNINHFGM-GPAEIPFGGVKDSGFGSEGGMEAFDGYLVTKFVTQM............... 477
8 -126.0004pxn_A mol:protein length:525 Uncharacterized protein  ali model follow..  48  29.QRNPGAFACGAWGG----SGPTVTSTSPTNNQVIAEVVEASVHDYEEGMRACFDAAKTWMAIPAPKRGEIVRQIGDALRAKLHHLGRLVSLEMGKILPEGIGEVQEIIDMCDYAVGLSRQLNGSIIPSERPNHMMMEVWNPLGVVGVITAFNFPCAVLGWNACIALVCGNCVVWKGAPTTPLITIAMTKIVASVLEK------NNLPGAIFTSFCGGTEIGQAIALDIRIPLVSFTGSTRAGLMVQQQVSARFGKCLLELSGNNAIIVMDDADIQLAVRSVLFAAVGTAGQRCTTCRRLILHENIYQTFLDQLVEVYKQVRIGDPLEKGTLLGPLHTPASKENFLKGIQTIKSQGGKILFGGSAIES--EGNFVQPTIVEITPSAPVVKEELFGPVLYVMKFQTLKEAIEINNSVPQGLSSSIFTKRPDIIFKWLGPHGSDCGIVNVNIPTNGAEIGGAFGGEKATGGGREAGSDSWKQYMRRATCTINYGSELPLAQGINF.. 518
9 -126.0003k2w_A mol:protein length:497 Betaine-aldehyde dehydrogenase  ali model follow..  25  11..KNKVNFIGGQYVPSN--ESDTIDILSPSTGKVIGEIPAGCKADAENALEVAQAAQKAWAKLTARTRQNMLRTFANKIRENKHILAPMLVAEQGKLLSVAEMEVDVTATFIDYGCDNALTIEGDILPSDNQDEKIYIHKVPRGVVVGITAWNFPLALAGRKIGPALITGNTMVLKPTQETPLATTELGRIAKEA----------GLPDGVLNVINGGSVVGQTLCESPITKMITMTGSTVAGKQIYKTSAEYMTPVMLELGGKAPMVVMDDADLDKAAEDALWGRFANCGQVCTCVERLYVHASVYDEFMAKFLPLVKGLKVGDPMDADSQMGPKCNQREIDNIDHIVHEAIKQGATVATGGKTATVEGGCWYEPTVLVDVKQDNIVVHEETFGPILPIVKVSSMEQAIEFCNDSIYGLSAYVHTQSFANINQA--ISDLEVGEVYINRGMG-EQHQGFHNGWKQSGFGGEDGKFGLEQYLEKKTVYINEAE............ 490
10 -125.0004zz7_A mol:protein length:501 Methylmalonate-semialdehyde dehydrogenase  ali model follow..  27  6...TIGHLINGQLVTE---NTRSQNVFNPATGEIGKQLDLASTKTVEQAISAAQHAFPTWRNTPPLKRARVMFRFKELLEQHADEICRLIGEEHGKIAHDAMGELQRGIENVEYACGAPELLKGEHSRNVGPGIDSWSEFQPMGVVAGITPFNFPVMVPLWMFPMAIVCGNCFVLKPSERDPSSTLYIAQLLQEA----------GLPDGVMNVVNGDKEAVDALLHDDRVKAVSFVGSTPIAEYIYRTASANGKRCQALGGAKNHAIVMPDADMDNAVNQLLGAAFGSSGERCMALSAVAVGDAAGDALVSKMTQAMQKLKVGPSTDSGNDFGPVITRQHQEKVIGYINSAEQQGATIVVDGRQPKVENGFFVGGTLIDHVTPEMTSYQEEIFGPVLQVVRVATMQDAMDLIDAHEYGNGTCIFTRDGEAARYF--SDNIQVGMVGINIPLPVPVAYHSFGGWKRSLFGHAYGPDAVRFYTKRKTVTQRWPSA........... 487
11 -125.0002hg2_A mol:protein length:479 Aldehyde dehydrogenase A  ali model follow..  28  3VPVQHPMYIDGQFVTWR--GDAWIDVVNPATEAVISRIPDGQAEDARKAIDAAERAQPEWEALPAIERASWLRKISAGIRERASEISALIVEEGGKIQQLAEVEVAFTADYIDYMAEWARRYEGEIIQSDRPGENILLFKRALGVTTGILPWNFPFFLIARKMAPALLTGNTIVIKPSEFTPNNAIAFAKIVDEI----------GLPRGVFNLVLGGETVGQELAGNPKVAMVSMTGSVSAGEKIMATAAKNITKVCLELGGKAPAIVMDDADLELAVKAIVDSRVINSGQVCNCAERVYVQKGIYDQFVNRLGEAMQAVQFGNPAERDIAMGPLINAAALERVEQKVARAVEEGARVAFGGKAVEG-KGYYYPPTLLLDVRQEMSIMHEETFGPVLPVVAFDTLEDAISMANDSDYGLTSSIYTQNLNVAMKA--IKGLKFGETYINRENF-EAMQGFHAGWRKSGIGGADGKHGLHEYLQTQVVYLQ............... 478
12 -124.0004lih_A mol:protein length:504 Gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase  ali model follow..  28  18LEIEGRAFIDGASRDAH--GGRTFDCVSPIDGRVLAKVADCGEADVNAAVAAARRAFDAWAGLNPRARKAVLLRWAALMREHLDELSLLETLDAGKPIGDTTTDVPGAAYCVEWFAEAIDKVGGEVAPAD-HHLVGLVTREPVGVVAAVVPWNFPILMAAWKFGPALAAGNSVVLKPSEKSPLTAIRVAQLAFEA----------GIPAGVFNVVPGAGEPGKLLALHRDVDCIAFTGSTAVGKLIMQYAAQNLKRAWLELGGKSPNIVLPDCDLDRAAQTAAGAIFYNMGEMCTAGSRLLVHRDIKDAFIEKLVAAARAYVPGNPLDPSVSMGAIVDGIQLERVLGYIEAGRGEGRLVTGGARVNAETGGFYVEPTVF-EVKPDAKIAREEIFGPVLSVIVFDDVDEAVRIANDTEYGLAAAVWTSNLTTAHDV--SRRLRAGTVWVNCYDEGGDMNFPFGGYKQSGNGRDKSLHALEKYTELKSTLIRLR............. 498
13 -124.0005x5t_A mol:protein length:505 Alpha-ketoglutaric semialdehyde dehydrogenase  ali model follow..  27  25..TDTQLLIDGEWVDAA--SGKTIDVVNPATGKPIGRVAHAGIADLDRALAAAQSGFEAWRKVPAHERAATMRKAAALVRERADAIAQLMTQEQGKPLTEARVEVLSAADIIEWFADEGRRVYGRIVPPRNLGAQQTVVKEPVGPVAAFTPWNFPVNQVVRKLSAALATGCSFLVKAPEETPASPAALLRAFVDA----------GVPAGVIGLVYGPAEISSYLIPHPVIRKVTFTGSTPVGKQLASLAGLHMKRATMELGGHAPVIVAEDADVALAVKAAGGAKFRNAGQVCISPTRFLVHNSIRDEFTRALVKHAEGLKVGNGLEEGTTLGALANPRRLTAMASVIDNARKVGASIETGGERIGS-EGNFFAPTVIANVPLDADVFNNEPFGPVAAIRGFDKLEEAIAEANRLPFGLAGYAFTRSFANVHLL--TQRLEVGMLWINQPAT-PWPEMPFGGVKDSGYGSEGGPEALEPYLVTKSVTVM............... 497
14 -124.0001t90_A mol:protein length:486 Probable methylmalonate-semialdehyde dehydrogenase  ali model follow..  26  4..RKLKNYINGEWVESK--TDQYEDVVNPATKEVLCQVPISTKEDIDYAAQTAAEAFKTWSKVAVPRRARILFNFQQLLSQHKEELAHLITIENGKNTKEALGEVGRGIENVEFAAGAPSLMMGDSLASIATDVEAANYRYPIGVVGGIAPFNFPMMVPCWMFPMAIALGNTFILKPSERTPLLTEKLVELFEKA----------GLPKGVFNVVYGAHDVVNGILEHPEIKAISFVGSKPVGEYVYKKGSENLKRVQSLTGAKNHTIVLNDANLEDTVTNIVGAAFGSAGERCMACAVVTVEEGIADEFMAKLQEKVADIKIGNGLDDGVFLGPVIREDNKKRTLSYIEKGLEEGARLVCDGRENVSDDGYFVGPTIFDNVTTEMTIWKDEIFAPVLSVIRVKNLKEAIEIANKSEFANGACLFTSNSNAIRYF--RENIDAGMLGINLGVPAPMAFFPFSGWKSSFFGHANGKDSVDFYTRKKVVTARYPAP........... 483
15 -123.0006fk3_A mol:protein length:536 Aldehyde dehydrogenase  ali model follow..  30  11.TLEFGHLVGGEEVL----EGPLLERRNPSDREVVARFPEADKDLVRKAALKAREAFAEWSRTPAPIRGQVLFNLVKILEREKPTLTRLMVREVGKTPKEAAGDVQEAIDTALFFASEGRRLYGQTVPSEMRDKELFTFRRPLGVVGIITAGNFPIAVPSWKLIPAVLTGNTVVWKPSEDAPTLSFVFAKLFEEA----------GLPPGVLNVVFGGGQWMVELMDEGLFQKFAFTGSTQVGRWIGEVAGRNLIRPTLELGGKNPLVVMRDADLDLAVEGAWWSAFATGGQRCTSAGNILVDAPIYEEFKRRFLERVEATLVGNPLHPEVTYGPFINERFFARWQEHYRVGEAEGARLLFGRGRITREEAGLYGWPTVWEVRPGTRLFTEEVFGPTINLVKVDGIEEAIAVANSTPYGLSSAIYTNHRHWAYLF--KVGIRAGMTSINNATVGAEAHLPFGGVKASGNGRESGIWVLEEYTYWHAVNEEYSGRLQLAQ...... 510
16 -123.0003r64_A mol:protein length:508 NAD dependent benzaldehyde dehydrogenase  ali model follow..  25  11..DATKHLIGGQWVEGN--SDRISTNINPYDDSVIAESKQASIADVDAAYEAAKKAQAEWAATPAAERSAIIYRAAELLEEHREEIVEWLIKESGSTRSKANLEITLAGNITKESASFPGRVHGRISPSNTPGKENRVYRVAKGVVGVISPWNFPLNLSIRSVAPALAVGNAVVIKPASDTPVTGGVIARIFEEA----------GVPAGVISTVAGGSEIGDHFVTHAVPKLISFTGSTPVGRRVGELAINPMKTVALELGGNAPFVVLADADIDAAAQAAAVGAFLHQGQICMSINRVIVDAAVHDEFLEKFVEAVKNIPTGDPSAEGTLVGPVINDSQLSGLKEKIELAKKEGATVQVEGPI----EGRLVHPHVFSDVTSDMEIAREEIFGPLISVLKADDEAHAAELANASDFGLSAAVWSKDIDRAAQF--ALQIDSGMVHINDLTVNDEPHVMFGGSKNSGLGRFNGDWAIEEFTTDRWIGIKRSAE........... 488
17 -123.0003ek1_A mol:protein length:504 Aldehyde dehydrogenase  ali model follow..  27  25..LKSQCLVNGRWIDAA--DGTTIKVTNPADGSVIGTVPSLSVATIKEAIDASAKALSGWAAKTAKERAGILRKWFDLIIANADDIALIMTSEQGKPLAEARGEVLYAASFIEWFAEEAKRVYGDTIPAPQNGQRLTVIRQPVGVTAAITPWNFPAAMITRKAAPALAAGCTMIVRPADLTPLTALALGVLAEKA----------GIPAGVLQIVTGAREIGAELTSNDTVRKLSFTGSTEVGRLLMAQCAPTIKRISLELGGNAPFIVFDDADLDAAVDGAMVSKYRNAGQTCVCANRIYVQRGVYDKFAEKLAAKVKELKVGNGTEPGVVIGPMIEEKAITKVKAHIEDAVSKGAKLITGGKEL---GGLFFEPGILTGVTSDMLVAKEETFGPLAPLFAFDTEEEVIAQANDTIFGLAAYFYTENFSRAIRV--SEALEYGMVGHNTGLI-SNEVAPFGGVKQSGLGREGSKYGIEEYLETKYICSAYKR............ 498
18 -123.0003iwj_A mol:protein length:503 Putative aminoaldehyde dehydrogenase  ali model follow..  24  7...TRQLFINGDWKAPV--LNKRIPVINPATQNIIGDIPAATKEDVDVAVAAAKTALTRWATASGAVRARYLRAIAAKVTEKKPELAKLESIDCGKPLDEAAWDIDDVAGCFEYYADLAEKLDARQKAPVSDTFKSHVLREPIGVVGLITPWNYPMLMATWKVAPALAAGCAAILKPSELASLTCLELGEICKEV----------GLPPGVLNILTGGPEAGAPLATHPDVDKVAFTGSSATGSKIMTAAAQLVKPVSLELGGKSPLVVFEDVDLDKAAEWAIFGCFWTNGQICSATSRLILHESIATEFLNRIVKWIKNIKISDPLEEGCRLGPVVSEGQYEKILKFVSNAKSEGATILTGGSRPEHKKGFFIEPTIITDVTTNMQIWREEVFGPVLCVKTFSTEEEAIDLANDTVYGLGAAVISNDLERCERV--TKAFKAGIVWVNCSQP-CFTQAPWGGVKRSGFGRELGEWGLDNYLSVKQVTQYISEE........... 492
19 -123.0001wnb_A mol:protein length:495 Putative betaine aldehyde dehydrogenase  ali model follow..  27  16..MQHKLLINGELVSG---EGEKQPVYNPATGDVLLEIAEASAEQVDAAVRAADAAFAEWGQTTPKVRAECLLKLADVIEENGQVFAELESRNCGKPLHSAFNEIPAIVDVFRFFAGAARCLNGLAAGEYLEGHTSMIRRDPLGVVASIAPWNYPLMMAAWKLAPALAAGNCVVLKPSEITPLTALKLAELAKDI-----------FPAGVVNILFGGKTVGDPLTGHPKVRMVSLTGSIATGEHIISHTASSIKRTHMELGGKAPVIVFDDADIEAVVEGVRTFGYYNAGQDCTAACRIYAQKGIYDTLVEKLGAAVATLKSGAPDDESTELGPLSSLAHLERVGKAVEEAKATGHIKVITGGEKRKGNGYYYAPTLLAGALQDDAIVQKEVFGPVVSVTPFDNEEQVVNWANDSQYGLASSVWTKDVGRAHRV--SARLQYGCTWVNTHFM-LVSEMPHGGQKLSGYGKDMSLYGLEDYTVVRHVMVKH.............. 489
20 -123.0003pqa_A mol:protein length:486 Lactaldehyde dehydrogenase  ali model follow..  27  2......MFIDGKWI-----NREDMDVINPYSLEVIKKIPALSREEAKEAIDTAEKYKEVMKNLPITKRYNILMNIAKQIKEKKEELAKILAIDAGKPIKQARVEVERSIGTFKLAAFYVKEHRDEVIPSD--DRLIFTRREPVGIVGAITPFNFPLNLSAHKIAPAIATGNVIVHHPSSKAPLVCIELAKIIENALKKY------NVPLGVYNLLTGGEVVGDEIVVNEKVNMISFTGSSKVGELITKKAG--FKKIALELGGVNPNIVLKDADLNKAVNALIKGSFIYAGQVCISVGMILVDESIADKFIEMFVNKAKVLNVGNPLDEKTDVGPLISVEHAEWVEKVVEKAIDEGGKLLLGGKR-----DKALFYPTILEVDRDNILCKTETFAPVIPIIRTNE-EEMIDIANSTEYGLHSAIFTNDINKSLKF--AENLEFGGVVINDSSLFRQDNMPFGGVKKSGLGREGVKYAMEEMSNIKTIIISKAEN........... 467
21 -122.0004v37_A mol:protein length:497 BETAINE ALDEHYDE DEHYDROGENASE, CHLOROPLASTIC  ali model follow..  24  7...ARQLFIDGEWREPI--KKNRIPVINPSTEEIIGDIPAATAEDVEVAVVAARRAFRRWSATSGAHRATYLRAIAAKITEKKDHFVKLETIDSGKPFDEAVLDIDDVASCFEYFAGQAEALDGKQKAPVTERFKSHVLRQPLGVVGLISPWNYPLLMATWKIAPALAAGCTAVLKPSELASVTCLEFGEVCNEV----------GLPPGVLNILTGGPDAGAPLVSHPDVDKIAFTGSSATGSKVMASAAQLVKPVTLELGGKSPIVVFEDVDIDKVVEWTIFGCFWTNGQIASATSRLLVHESIAAEFVDKLVKWTKNIKISDPFEEGCRLGPVISKGQYDKIMKFISTAKSEGATILYGGSRPEHKKGYYIEPTIVTDISTSMQIWKEEVFGPVLCVKTFSSEDEAIALANDTEYGLAAAVFSNDLERCERI--TKALEVGAVWVNCSQP-CFVQAPWGGIKRSGFGRELGEWGIQNYLNIKQVTQDISDE........... 489
22 -122.0004kna_A mol:protein length:495 N-succinylglutamate 5-semialdehyde dehydrogenase  ali model follow..  25  2..AMTELFIDGAWVDG---AGPVFASRNPGTNERVWEGASASADDVERAVASARRAFAAWSALDLDARCTIVKRFAALLVERKEALATMIGRETGKPLWEARTEVASMAAKVDISITAYHERTGEKRAPM-ADGVAVLRHRPHGVVAVFGPYNFPGHLPNGHIVPALIAGNTVVFKPSELAPGVARATVEIWRDA----------GLPAGVLNLVQGEKDTGVALANHRQIDGLFFTGSSDTGTLLHKQFGGREIVLALEMGGNNPLVVAEVEDIDAAVHHAIQSAFLSAGQRCTCARRILVPRGAFDRFVARLADVASKITASFDADPQPFMGAVISARAASRLVAAQARLVGLGASPIIEMKQRD--PALGFVNAAILDVTNVRELPDEEHFGPLAQIVRYTDLDDAIARANDTAFGLSAGLLADDEQAWHTF--RRAIRAGIVNWNRPTNGASSAAPFGGAGRSGNHRPSAYYAADYCAYPMASVESAQLQMP......... 480
23 -122.0005kf0_A mol:protein length:485 Aldehyde dehydrogenase  ali model follow..  25  4LKDTYPYYLANEAVY----ANTDLEVTDKFSGKVATRVALADAQAIDAAIGAAVDAVKPMRELPAYRRQAVLDHCVARFRERFDELAEALCIEAGKPINDSRGEVTRLIDTFRVASEEAVRIDGEVLNLEAQGYTGYTRRVPIGPCSFISPFNFPLNLAAHKVAPALAAGCPFVLKPASRTPVGALIIAEVLAET----------NLPKGAFSVLPAHRDGADLFTTDERFRLLSFTGSPAVGWALKEKAG--KKKVVLELGGNAAAIVDADQQLDYVVDRLAFGAYYQSGQSCIGVQRILVHASLYDTLRDKLVAKTRSLKMGDPKDPSTFVGPMISESESRRLSGWMDAAVAAGAKIIAGGKV----DGAMFEATLLEDVGREQDLYRKEAFGPVAILEKFDRFDDALARVNDSDFGLQAGVFTDSLTHAQRA--WDELEVGGVVINDVPSFRVDNMPYGGVKDSGLGREGIRYAIEDMTEPRLMVVRRR............. 479
24 -122.0005j6b_A mol:protein length:485 Aldehyde dehydrogenase  ali model follow..  25  4LKETYPYYLANEAVY----ANAELEVTDKYTGKVATRVALADASAIDAAIAAAVGAQKPLRALPAFRRQAILEHCVARFRERFDELAQALCIEAGKPINDSKGEVTRLIDTFRVAAEESVRIEGGLVNLEAQGYSGYYKRVPIGPCSFISPFNFPLNLAAHKVAPALAAGCPFVLKPASRTPIGALIIGEVLAET----------DLPKGAFSILPAHRDGADLFTTDERFKLLSFTGSPTVGWELKKKAG--KKKVVLELGGNAAAIVDADQRLDYVVERLAFGAYYQSGQSCIGVQRIIAHADVYDALREKLIAKTRSLKMGDPKDPATFVGPMISESEARRLAGWMEAAVAAGAKIVAGGKV----DGAMFEATLLEGVGRDQDLYRKEAFGPVALLERFSDFDDALARVNDSDFGLQAGVFTDSLSHAQRA--WDELEVGGVVINDVPSFRVDNMPYGGVKDSGLGREGIRYAIEDMTELRLMVVRRR............. 479
25 -122.0004e4g_A mol:protein length:521 Methylmalonate-semialdehyde dehydrogenase  ali model follow..  23  17MMYELGHFIDGKRVAGT--SGRVSNIFNPATGEVQGTVALASDADLAAAVESAKAAQPKWAATNPQRRARVFMKFVQLLNDNMNELAEMLSREHGKTIDDAKGDIVRGLEVCEFVIGIPHLQKSEFTEGAGPGIDMYSIRQPVGIGAGITPFNFPGMIPMWMFAPAIACGNAFILKPSERDPSVPIRLAELMIEA----------GLPAGILNVVNGDKGAVDAILTHPDIAAVSFVGSTPIARYVYGTAAMNGKRAQCFGGAKNHMIIMPDADLDQAANALIGAGYGSAGERCMAISAVPVGEETANRLIDKLVPMVESLRIGPYTDEKADMGPVVTKEAEQRIRSLIDSGIEQGAKLVVDGRDFKLENGHFIGGCLFDDVTPDMDIYKTEIFGPVLSVVRARNYEEALSLPMKHEYGNGVAIYTRDGDAARDF--ASRINIGMVGVNVPIPVPLAYHSFGGWKSSSFGNQHGTDSIKFWTRTKTITSRWPSGIKDGAEFSI.. 511
26 -122.0005izd_A mol:protein length:508 D-glyceraldehyde dehydrogenase (NADP(+))  ali model follow..  24  1..MDTKLYIDGQWVNSS--SGKTVDKYSPVTGQVIGRFEAATRDDVDRAIDAAEDAFWAWNDLGSVERSKIIYRAKELIEKNRAELENIIMEENGKPVKEAKEEVDGVIDQIQYYAEWARKLNGEVVEGTSSHRKIFQYKVPYGIVVALTPWNFPAGMVARKLAPALLTGNTVVLKPSSDTPGSAEWIVRKFVEA----------GVPKGVLNFITGGSEIGDYIVEHKKVNLITMTGSTATGQRIMQKASANMAKLILELGGKAPFMVWKDADMDNALKTLLWAKYWNAGQSCIAAERLYVHEDIYDTFMSRFVELSRKLALGDPKN--ADMGPLINKGALQATSEIVEEAKESGAKILFGGSQPSLRNGYFFLPTIIGNADQKSKIFQEEIFAPVIGARKISSVEEMYDLANDSKYGLASYLFTKDPNIIFEA--SERIRFGELYVNMPGP-EASQGYHTGFRMTGQAGEGSKYGISEYLKLKNIYVDYSGKPLHINTVR... 488
27 -122.0003qan_A mol:protein length:538 1-pyrroline-5-carboxylate dehydrogenase 1  ali model follow..  24  34LGKEYPLIINGERVT----TEDKIQSWNPARDQLVGSVSKANQDLAEKAIQSADEAFQTWRNVNPEERANILVKAAAIIRRRKHEFSAWLVHEAGKPWKEADADTAEAIDFLEYYARQMIELNRGKEILSRPGEQNRYFYTPMGVTVTISPWNFALAIMVGTAVAPIVTGNTVVLKPASTTPVVAAKFVEVLEDA----------GLPKGVINYVPGGAEVGDYLVDHPKTSLITFTGSKDVGVRLYERAANHLKRVIVEMGGKDTVVVDRDADLDLAAESILVSAFGFSGQKCSAGSRAVIHKDVYDEVLEKTVALAKNLTVGDPTNRDNYMGPVIDEKAFEKIMSYIEIGKKEGRLMTGGEG--DSSTGFFIQPTIIADLDPEAVIMQEEIFGPVVAFSKANDFDHALEIANNTEYGLTGAVITRNRAHIEQA--KREFHVGNLYFNRNCTGAVGYHPFGGFKMSGTDSKAGPDYLALHMQAKTVSEMYAEN........... 519
28 -121.0005tjr_A mol:protein length:531 Methylmalonate-semialdehyde dehydrogenase  ali model follow..  24  29..TLIKHLIGGELIAD---TGRTADVFNPSTGEAVRKVPLADRETMQQAIDAAKAAFPAWRNTPPAKRAQVLFRFKQLLEANEERIVKLISEEHGKTIEDAAGELKRGIENVEYATAAPEILKGEYSRNVGPNIDAWSDFQPIGVVAGITPFNFPAMVPLWMYPLAIACGNTFILKPSERDPSSTLLIAELFHEA----------GLPKGVLNVVHGDKGAVDALIEAPEVKALSFVGSTPIAEYIYSEGTKRGKRVQALGGAKNHAVLMPDADLDNAVSALMGAAYGSCGERCMAISAVCVGDQIADALVQKLVPQIKGLKIGAGTSCGLDMGPLVTGAARDKVTGYIDTGVAQGAELVVDGRGYKVENGFFLGGTLFDRVTPEMTIYKEEIFGPVLCIVRVNSLEEAMQLINDHEYGNGTCIFTRDGEAARLF--CDEIEVGMVGVNVPLPVPVAYHSFGGWKRSLFGHAYGPDGVRFYTKRKAITQRWPQR........... 511
29 -121.0004dal_A mol:protein length:498 Putative aldehyde dehydrogenase  ali model follow..  26  18..MDTQLLIGSRFEAG---TEAEEHILNPRTGAGIIDLAEASHAQIDAAVDAAERAFVGWSQTTPAERSNALLKIADAIEKEADEFAALEALNCGKPINAVKNELPAIIDCWRFFAGAVRNLHAPAAGEYLPGHTSMIRRDPIGIVGSIAPWNYPLMMMAWKLAPAIGGGNTVVFKPSEQTPLTALKLARLIADI-----------LPEGVVNVITGGETVGNALINHPKVGMVSITGDIATGKKVLAAAAKTVKRTHLELGGKAPVIVYGDADLEAVVNGIRTFGYYNAGQDCTAACRIYAEAGIYEKLVADLTSAVSTIRYNLDDDTENEIGPLISRRQRDRVASFVERAADQKHIEITTGGRTGSDEGFFFQPTVVAGATQEDEIVRREVFGPVVSVTRFTGKDDAVAWANDSDYGLASSVWTKDISKAMRA--ASRLQYGCTWINTHFM-LTNEMPHGGIKQSGYGKDMSVYALEDYTAVRHIMINHG............. 492
30 -121.0005u0l_A mol:protein length:497 N-succinylglutamate 5-semialdehyde dehydrogenase  ali model follow..  26  3.NLTGNVYIDGLWLPG---HGAPFESVQPVTGETVWDGNAASLEDVDAAVREARKAFLAWRRKSLAERQAVIEAFGELLEANKEELAHQIGLETGKPLWESRTEVAAMMGKIPISVKAYNERTGHTESDV-AGGHAVLRHRPHGVVAVFGPYNFPGHLPNGHIVPALLAGNTVVFKPSELTPGVAELTVRLWEKA----------GLPDGVINLVQGGSDTGKCLARHSLIDGLFFTGSSTVGHLLHEQFGGQEKILALEMGGNNPLIVQNVSDLDGAVHHALQSAFLSAGQRCTCARRLLVPKGKKDEFLARLVEVAARITVAEDADPQPFMGSVISAEAANQLLKAQAAMLEKGATSLLEMKQLKP-DTGLLSPGIVDAT--GIELEDQEFFGPLLTVYRYKGFDEALELANNTRYGLSAGILSDDRKLYNRL--VEEVRAGIVNWNRPLTGASSAAPFGGVGASGNHRPSAYYAAD-YCAWPMASLEAGKS........... 478
31 -121.0004dng_A mol:protein length:485 Uncharacterized aldehyde dehydrogenase AldY  ali model follow..  24  3FETLNKSFINGKWTGGE--SGRTEDILNPYDQSVITTASLATGKQLEDAFDIAQKAQKEWAKSTTEDRKAVLQKARGYLHENRDDIIMMIARETGGTIIKSTIELEQTIAILDEAMTYTGELGGKEVPSDIEGKTNKIYRLPLGVISSISPFNFPMNLSMRSIAPAIALGNSVVHKPDIQTAISGTIIAKAFEHA----------GLPAGVLNVMLTVKEIGDGMLTNPIPRLISFTGSTAVGRHIGEIAGRAFKRMALELGGNNPFAVLSDADVDRAVDAAIFGKFIHQGQICMIINRIIVHQDVYDEFVEKFTARVKQLPYGDQTDPKTVVGPLINERQIEKALEIIEQAKTDGIELAVEGKR----VGNVLTPYVFVGADNNSKIAQTELFAPIATIIKAGSDQEAIDMANDTEYGLSSAVFTSDLEKGEKF--ALQIDSGMTHVNDQSVNDSPNIAFGGNKASGVGRFGNPWVVEEFTVTKWISIQKQYR........... 481
32 -121.0005mz5_A mol:protein length:515 ALDH21)  ali model follow..  25  30TPKKYNIFLASKPVDG---DRKWLDVTNKYTNDVAAKVPQATHKDIDDAIDAAVAAAPAMAAMGAYERKAVLEKVVAELKNRFEEIAQTLTMESGKPIKDARGEVTRTIDTFQVAAEESVRIYGEHIPLDNKGLQGIVKKFPIGPVSMVSPWNFPLNLVAHKVAPAIAVGCPFVLKPASRTPLSALILGEILHKI---------EELPLGAFSILPVSREDADMFTVDERFKLLTFTGSGPIGWDMKARAG--KKKVVMELGGNAPCIVDDYVDLDYTIQRLINGGFYQGGQSCIHMQRLYVHERLYDEVKEGFVAAVKKLKMGNPFEEDTYLGPMISESAAKGIEDWVKEAVAKGGKLLTGGNR----KGAFIEPTVIEDVPIEANARKEEIFGPVVLLYKYSDFKEAVKECNNTHYGLQSGIFTKDLNKAFYA--FEHMEVGGVILNDSPALRVDSQPYGGLKDSGIQREGVKYAMDDMLETKVLVMRNVGTL.......... 509
33 -121.0005jry_A mol:protein length:485 NAD-dependent aldehyde dehydrogenase  ali model follow..  25  4LKETYPYYLANAAVY----ANTDLEVTDKYSGKVATRVALADAKAIDAAIGAAVDATKPMRELPAYKRQAVLDHCVARFRERFDELAEALCIEAGKPINDAKGEVTRLIDTFRVASEEAVRIDGEVLNLEAQGYTGYTRRVPIGPCSFISPFNFPLNLAAHKVAPALAAGCPFVLKPASRTPVGALIIGEVLAET----------DLPKGAFSVLPAHRDGADLFTTDDRFRLLSFTGSPAVGWALKEKAG--KKKVVLELGGNAAAIVDADQRLDYVVDRLAFGAFYQSGQSCIGVQRILAHADIYDALRDKLIAKTRSLKMGDPKDPSTFVGPMISESESRRLSGWMDAAVAAGAKIVAGGKV----DGAMFEATLLENVGRDQDLYRKEAFGPIAILEKFDRFDDALARVNDSDFGLQAGVFTDSLAHTQQA--WDELEVGGVVINDVPSFRVDNMPYGGVKDSGLGREGIRYAIEDMTEPRLLVVRRR............. 479
34 -121.0003vz0_A mol:protein length:459 Putative NAD-dependent aldehyde dehydrogenase  ali model follow..  25  2..................SHMIVYQTLNPTTETVERSFDLHTPAQMKDITDRAEHVWKTWKLRSIAQRKEIVSRAADLLRRDRQHHASLIATEMGKALPDALEEIDVTADILSFYANGAEEFLAPTPLKV-KTGQAKIINQPLGIIYCIEPWNFPYYQLARVAGPNLMAGNVVIAKHAPNVPQCALAFEKLFHDA----------GAPVGAYANIFLDNDQSAELIKDERIRGVALTGSERAGQAVAAQAGAALKKDTMELGGSDAFIVLDDADLDLAVKWAVWGRFANNGQVCTAAKRMIVHEKVYDAFLDGLKTAITRFRIGNPLDRDTTHGPMSSLRAMELALDQTAEAVKGGATLVAGGKRMDR-KGFFMEPTILTDVSKDNPVFYQEIFGPVAVVHKVASEQAAIDLANDSPYGLGGAVFSRDIARAEKV--AEQVETGMVFINTATA-AAPELPFGGIKNSGFGRELSFLGIEEFINRKLVRIG............... 459
35 -120.0005kj5_A mol:protein length:520 2-aminomuconate 6-semialdehyde dehydrogenase  ali model follow..  22  30APSQLLNYIDGNFVT----SASSFANINPVNGKLISDVFEADAKQVNEAVVAAQNALKGWGKLSVQDRAALIHKIADGIQARFEEFVAAEVADTGRPVHQARTDIPRAIANFRTFADLAKTSHTDLFEMSTSGALNYTVRKPLGVIGVISPWDLPLLLFTWKVAPALACGNTVVAKPSEESPSSATLLAEVMHDA----------GVPPGVFNLIHGKDSAGEFLTQHPGISALTFTGESKTGSTIMKAVADGVKEVSFELGGKNAAVVFADADLDAAIEGVLRSSFTNSGQVCLCSERVYVHRSIFDEFVSGLKVEAERLVVGYPDQDGVNMGPLISHGHRDKVLSYYRLAVDEGATVVTGGGVPKRDQGAYVQPTIWTGLSDKARCVTEEIFGPVCHISPFDDEDEVINRVNDSNYGLACAIWTTNLSRAHRV--SRQIHVGLVWVNTWYL-RDLRTPFGGVKLSGLGREGGRFSMDFYSDIANICIKI.............. 514
36 -120.0003vz2_A mol:protein length:470 Succinate-semialdehyde dehydrogenase  ali model follow..  25  1.........SSGLVPRG--SHMAIATINPTTGEICQRFKALTPAEIDAKLAKAQEAFQAYRRTSFSQRRQWLENAAAILERDTSKFAEIMTTEMGKTHQSAIAEAEKSALVCRYYAEHGEQFLANEYTET-QATESYVCYQPLGILLAVMPWNFPFWQVFRFAAPALMAGNVAVLKHASNVPQCALAVEAILEAA----------GFPEGVFQTLLIGASQVEQVIKDPRVKAATLTGSEPAGASLASLAGQEIKPTLLELGGSDPFVVFPSADLDEAVEVGTVARTMNNGQSCIAAKRFILHEAIAAEFLEKLHLKFASLKIGDPMAPETDIGPLATEGILQDISRQVDQAVAAGAKILLGGRPLDR-AGYFYPPTILTEIPPGAKILQEELFAPVAMVFTVKDLDQAIALANDIPFGLGASAWTNDPAEQQRF--IQELDAGAVFINGMVK-ADPRLPFGGTKRSGYGRELGLAGIRTFVNAKTVWLK............... 464
37 -120.0003efv_A mol:protein length:462 Putative succinate-semialdehyde dehydrogenase  ali model follow..  25  2................TMMTATQALSVNPATGQTLAAMPWANAQEIEHALSLAASGFKKWKMTSVAQRAQTLRDIGQALRAHAEEMAQCITREMGKPIKQARAEVTKSAALCDWYAEHGPAMLNPEPTLV-ENQQAVIEYRPLGVILAIMPWNFPLWQVLRGAVPILLAGNSYLLKHAPNVTGCAQMIARILAEA----------GTPAGVYGWVNANNEGVSQMINDPRIAAVTVTGSVRAGAAIGAQAGAALKKCVLELGGSDPFIVLNDADLELAVKAAVAGRYQNTGQVCAAAKRFIVEEGIAQAFTDRFVAAAAALKMGDPLVEENDLGPMARFDLRDELHQQVQASVAEGARLLLGGEKIAG-EGNYYAATVLADVTPDMTAFRQELFGPVAAITVAKDAAHALALANDSEFGLSATIFTADDTLAAEM--AARLECGGVFINGYSA-SDARVAFGGVKKSGFGRELSHFGLHEFCNVQTVWKNR.............. 461
38 -120.0003iwk_A mol:protein length:503 Aminoaldehyde dehydrogenase  ali model follow..  24  7...SRQLFIDGEWRVPI--LNKRIPNINPSTENIIGDIPAATKEDVDLAVDAAKRAISRWSAASGSLRARYLRAIAAKIKEKKDELGKLESIDCGKPLEEALADLDDVVACFEYYAGLAEELDSKQKALPMDTFKSYILKEPIGVVALITPWNYPFLMATWKIAPALAAGCAAILKPSELASVTCLELGEICKEV----------GLPRGVLNIVTGGHEAGASLASHPDVDKISFTGSSATGSKIMTTAAQLVKPVSLELGGKSPIVVFEDVDLDKVAEWTVFGCFFTNGQICSATSRLIVHESIAVEFVDKLVKWAENIKISDPLEEGCRLGPIVSEAQYKKVLNCISSAKSEGATILTGGRRPEHKKGYFVEPTIITDVTTSMQIWREEVFGPVLAVKTFSTEEEAINLANDTHYGLGSAVMSNDLERCERL--SKALQAGIVWINCAQP-SFIQAPWGGIKRSGFGRELGEWGLENYLSVKQVTRYTSDE........... 492
39 -120.0002d4e_A mol:protein length:515 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase  ali model follow..  23  23KERPALHFIAGEFVPSE--SGETFPSLDPATNEVLGVAARGGEREVDRAAKAAHEAFQRWSRTKAKERKRYLLRIAELIEKHADELAVMECLDAGQVLRIVRAQVARAAENFAFYAEYAEHAMEDRTFPVDRDWLYYTVRVPAGPVGIITPWNAPLMLSTWRIAPALAFGNTVVLKPAEWSPFTATKLAEILKEA----------DLPPGVFNLVQGGEEAGAALVAHPLVPLLTLTGETETGKIVMRNAADHLKRLSPELGGKSPALVFADADLERALDAVVFQIFSFNGERCTASSRLLVEEKIFEDFVGKVVERARAIRVGHPLDPETEVGPLIHPEHLQRVLGYVEAGKREGARLLVGGERAKTSRGNYLLPTVFVGE-NHMKIAQEEIFGPVLVAIPFKDEEEALRKANDTKYGLAAYVFTRDLERAHRL--ALELEAGMVYLNSHNV-RHLPTPFGGVKGSGDRREGGTYALDFYTDLKTIALPLRPPHVPKFG..... 514
40 -120.0004i8p_A mol:protein length:520 Aminoaldehyde dehydrogenase 1  ali model follow..  23  15MVPLRQLFVDGEWRPPA--QGRRLPVVNPTTEAHIGEIPAGTAEDVDAAVAAARAALKRWARAPGAVRAKYLRAIAAKVIERKPELAKLEALDCGKPYDEAAWDMDDVAGCFEYFADQAEALDKRQNSLPMETFKCHLRREPIGVVGLITPWNYPLLMATWKIAPALAAGCTAVLKPSELASVTCLELADICKEV----------GLPSGVLNIVTGGPDAGAPLSAHPDVDKVAFTGSFETGKKIMASAAPMVKPVTLELGGKSPIVVFDDVDIDKAVEWTLFGCFWTNGQICSATSRLLIHTKIAKKFNERMVAWAKNIKVSDPLEEGCRLGPVVSEGQYEKIKKFISNAKSQGATILTGGVRPAHEKGFFIEPTIITDITTSMEIWREEVFGPVLCVKEFSTEDEAIELANDTQYGLAGAVISGDRERCQRL--SEEIDAGCIWVNCSQP-CFCQAPWGGNKRSGFGRELGEGGIDNYLSVKQVTEYISDEPWGWYQSPSKL 514
41 -120.0003ros_A mol:protein length:484 NAD-dependent aldehyde dehydrogenase  ali model follow..  24  2...................VMSKYQSVNPYTNEAFASYDNPTSKQIDEAINLAHALYKKWRHEEPASRAEILHDIANALKEHEDELAKMMTLEMGKLLSESKEEVELCVSICNYYADHGPEMLKPTKLNS-DLGNAYYLKQSTGVIMACEPWNFPLYQVIRVFAPNFIVGNPILLKHAHNVPGSAALTAKIIKRA----------GAPEGSLINLYPSYDQLADIIADPRIQGVALTGSERGGSAVAEAAGKNLKKSTMELGGNDAFIVLDDADPQVLRNVLNDARTYNDGQVCTSSKRIIVEKSRYDEVLHELKNVFSNLKAGDPLEADTTLPPMNSEKAKEKLEAQVKEAIDAGAKVFYQYPEIDS-KGAFFRPTILTDIAKDNPVFDKEVFGPIAEVFVVEDDNAAIQLANDSSYGLGSSVIGSDIDRAKKV--SAQIETGMTVINGRWI-TSGELPFGGIKKSGYGRELSGLGLMAFVNEHLVIDVTKNN........... 461
42 -119.0002w8n_A mol:protein length:487 SUCCINATE-SEMIALDEHYDE DEHYDROGENASE, MITOCHONDRIAL  ali model follow..  26  11..LRTDSFVGGRWLP----AAATFPVQDPASGAALGMVADCGVREARAAVRAAYEAFCRWREVSAKERSSLLRKWYNLMIQNKDDLARIITAESGKPLKEAHGEILYSAFFLEWFSEEARRVYGDIIHTPAKDRRALVLKQPIGVAAVITPWNFPSAMITRKVGAALAAGCTVVVKPAEDTPFSALALAELASQA----------GIPSGVYNVIPCAKEVGEAICTDPLVSKISFTGSTTTGKILLHHAANSVKRVSMELGGLAPFIVFDSANVDQAVAGAMASKFRNTGQTCVCSNQFLVQRGIHDAFVKAFAEAMKNLRVGNGFEEGTTQGPLINEKAVEKVEKQVNDAVSKGATVVTGGKRHQL-GKNFFEPTLLCNVTQDMLCTHEETFGPLAPVIKFDTEEEAIAIANAADVGLAGYFYSQDPAQIWRV--AEQLEVGMVGVNEGLI-SSVECPFGGVKQSGLGREGSKYGIDEYLELKYVCYG............... 485
43 -119.0004ogd_A mol:protein length:465 Succinate-semialdehyde dehydrogenase  ali model follow..  24  2......................AYQTIYPYTNEVLHTFDNMTDQGLADVLERAHLLYKKWRKEDHEERKAQLHQVANILRRDRDKYAEIMTKDMGKLFTEAQGEVDLCADIADYYADKADEFLMSTPLET-DSGQAYYLKQSTGVILAVEPWNFPYYQIMRVFAPNFIVGNPMVLKHASICPRSAQSFEELVLEA----------GAEAGSITNLFISYDQVSQVIADKRVVGVCLTGSERGGASIAEEAGKNLKKTTLELGGDDAFIILDDADWDQLEKVLYFSRLYNAGQVCTSSKRFIVLDKDYDRFKELLTKVFKTAKWGDPMDPETTLAPLSSAQAKADVLDQIKLALDHGAELVYGGEAIDH-PGHFVMPTIIAGLTKDNPIYYQEIFGPVGEIYKVSSEEEAIEVANDSNYGLGGTIFSSNQEHAKAV--AAKIETGMSFINSGWT-SLPELPFGGIKHSGYGRELSELGFTSFVNEHLIYIPNKTN........... 459
44 -119.0003prl_A mol:protein length:505 NADP-dependent glyceraldehyde-3-phosphate dehydrogenase  ali model follow..  25  10..FNANILRNGEWVESR--TGERISISAPASGVALGSIPALSQEEVNDAIQGAKDAQKIWKIRPIHERVDLLYAWADLLEERKEIIGELIMHEVAKPKKSAIGEVSRTADIIRHTADEALRLNGETLKGDQSKKIALVEREPLGVVLAISPFNYPVNLAAAKIAPALVTGNTVVFKPATQGSLSGIKMVEALADA----------GAPEGIIQVVTGGSVIGDHLVEHPGIDMITFTGGTTTGERISEKA--KMIPVVLELGGKDPAIVLDDADLKLTASQIVSGAFSYSGQRCTAIKRVFVQDSVADQLVANIKELVEQLTVGSPEDD-ADITPVIDEKSAAFIQGLIDDALENGATLLSGNKR----QGNLLSPTLLDDVTPAMRVAWEEPFGPVLPIIRVKDANEAISLSNQSDYGLQASIFTKDTDRAINI--GKHLEVGTVHINAKTERGPDHFPFLGVKKSGLGVQGIKPSLLSMTRERVTVLNLAENL.......... 487
45 -119.0001euh_A mol:protein length:475 NADP DEPENDENT NON PHOSPHORYLATING GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE  ali model follow..  22  1MTKQYKNYVNGEWKL----SENEIKIYEPASGAELGSVPAMSTEEVDYVYASAKKAQPAWRALSYIERAAYLHKVADILMRDKEKIGAILSKEVAKGYKSAVSEVVRTAEIINYAAEEGLRMEGEVLEGGSKKKIAVVRREPVGLVLAISPFNYPVNLAGSKIAPALIAGNVIAFKPPTQGSISGLLLAEAFAEA----------GLPAGVFNTITGGSEIGDYIVEHQAVNFINFTGSTGIGERIGKMAG--MRPIMLELGGKDSAIVLEDADLELTAKNIIAGAFGYSGQRCTAVKRVLVMESVADELVEKIREKVLALTIGNPEDD-ADITPLIDTKSADYVEGLINDANDKGATALTEIKR----EGNLICPILFDKVTTDMRLAWEEPFGPVLPIIRVTSVEEAIEISNKSEYGLQASIFTNDFPRAFGI--AEQLEVGTVHINNKTQRGTDNFPFLGAKKSGAGIQGVKYSIEAMTTVKSVVFDIK............. 475
46 -118.0004i9b_A mol:protein length:517 Putative betaine aldehyde dehyrogenase  ali model follow..  22  17...RRQLYIGGEWREPV--KKNRIPIINPATEEIIGDIPAATAEDVDIAVEAARKAIARWGSTTGAQRAKYLRAIAAKVLEKKSVLATLESLDSGKTLYESAADMDDVAGCFEYYAGLAEALDSRRMTPVNDSYKSYVLREPLGVVGLITPWNYPLLMAIWKVAPALAAGCAAILKPSELASITCLELGEICREI----------GLPSGALNILTGGPEAGGPLASHPHVDKISFTGSGPTGSKIMTAAAQLVKPVSLELGGKSPIVVFDDIDLDIAAEWTLFGIFANTGQVCSATSRLIVQENIASAFMDRLLKWTKNIKISDPLEEDCKLGPVVSAGQYEKVLKFISNAKSEGATILCGGERPQHKKGYYVQPTIITDVNTSMEIWKEEVFGPVLCVKTFKTEEQAIELANDTKYGLGAAVMSKDVKRCERF--TKAFQTGIIWINCSQP-TFNELPWGGKKRSGFGRDLGKWGLENFLNIKQVTEYTSAE........... 500
47 -118.0004go3_A mol:protein length:495 Putative gamma-hydroxymuconic semialdehyde dehydrogenase  ali model follow..  27  1..MQNQLYIDGRFVDAV--AGGTIDVVSPHDGSLITRIAAAEAADVDLAVAAAKRAFPAWSALGAAERGRLLLKLADRIEECSEELAQLESLNTGHPIRDSRGDVPRTAACFRYFGGMADKIEGSVIPVD-AGFLNYVQRKPIGVVAQIVPWNFPLMFTSWKMGPALAAGNTIVIKPSEITPLSTLRIVELMTEV----------GFPKGVVNVVPGGHTAGQALAEHLDVGKIAFTGSTATGRRIVEASKSNLKRIQLELGGKGANIVFEDANIEAAVNGAAWAIFHNQGQACIAGSRLILHKDIADQFLERFIALAKSIRLGDPMDPETEMGPLTSALRRDRVLSYIDIAIEQGGKVLAGGKAPDDKANGFYVEPTVVEAKPQDRVCQEEVFGPFVTVVRFSSDEEALAIANNTEYGLGSGLWTQNLARAHKM--ANAIHAGMCWINCYKR-VSPGSPFGGVGQSGYGREMGFEAIHDYTEARSVWVNVDAKIAPHFK..... 486
48 -118.0003ju8_A mol:protein length:490 Succinylglutamic semialdehyde dehydrogenase  ali model follow..  27  3.AMMSTHYIAGQWLAG---QGETLESLDPVGQGVVWSGRGADATQVDAAVCAAREAFPAWARRPLEQRIELLERFAATLKSRADELARVIGEETGKPLWESATEVTSMVNKVAISVQAFRERTGEKSGPL-ADATAVLRHKPHGVVAVFGPYNFPGHLPNGHIVPALLAGNCVVFKPSELTPKVAELTLKAWIQA----------GLPAGVLNLVQGGRETGVALAAHRGLDGLFFTGSSRTGNLLHSQFGGQQKILALEMGGNNPLVVEEVADLDAAVYTIIQSAFISAGQRCTCARRLLVPQGAWDALLARLVAVSATLRVGRFDQPAPFMGAVISLSAAEHLLKAQEHLIGKGAQPLLAMTQPI--DGAALLTPGILDVSAVAERPDEEFFGPLLQVIRYSDFAAAIREANATQYGLAAGLLSDSRERFEQF--LVESRAGIVNWNKQLTGAASSAPFGGIGASGNHRPSAYYAADYCAYPVASLESPSVSLP......... 482
49 -118.0004k57_A mol:protein length:518 Delta-1-pyrroline-5-carboxylate dehydrogenase  ali model follow..  23  36FGRHYPLYIGGEWVD----TKERMVSLNPSPSEVVGTTAKAGKAEAEAALEAAWKAFKTWKDWPQEDRSALLLKAAALMRRRKRELEATLVYEVGKNWVEASADVAEAIDFIEYYARAALRYRYPAVEVPYPGEDNESFYVPLGAGVVIAPWNFPVAIFTGMIMGPVAVGNTVIAKPAEDAVVVGAKVFEIFHEA----------GFPPGVVNFLPGGEEVGAYLVEHPRTRFINFTGSLEVGLKIYEAAGRWFKRAYVETGGKDAIIVDETADFDLAAEGVVVSAYGFQGQKCSAASRLILTQGAYEPVLERVLKRAERLSVG-PAEENPDLGPVVSAEQERKVLSYIEIGKNEGQLVLGGKRL--EGEGYFIAPTVFTEVPPKARIAQEEIFGPVLSVIRVKDFAEALEVANDTPYGLTGGVYSRKREHLEWA--RREFHVGNLYFNRKITGALVGQPFGGFKLSGTNAKTGLDYLRLFLEMKAVAERF.............. 518
50 -118.0003u4j_A mol:protein length:528 NAD-dependent aldehyde dehydrogenase  ali model follow..  25  19IKSRYQMLVDGKSVDAA--SGSTIDRVSPGAGEVVGTWPEASADDVRKAVAAARKAFDAWPRMSGAERSRLMFKVADLILARQEELALIESLEVGKPIAQARGEIGFCADLWSYAAGQARALEGQTHNNIGDDRLGLVLREPVGVVGIITPWNFPFIIASERVPWAIGSGCTVVLKPSEFTSGTSIRLAELAREA----------GIPDGVFNVVTGGDPAGQVLAEDPNVDMVAFTGSVRVGTKLGEIAARTVKRVGLELGGKGPQIVFADADLDAAADGIAYGVYHNAGQCCISGSRLLVQEGIRDALMERLLDISRKVAFGDPLNERTKIGAMISEAHAEKVHSYVTAGITSGAELLLGGERIGREAGLYYAPTVFAGVTPDMSIAREEIFGPVLSTLTFKTADEAVALANATEFGLSASVWSTNLETALQT--IRRIRAGRCWINSVID-GTPELPIGGYKKSGLGRELGRYGFDEYSQFKGVHVTLGRPAP......... 503
51 -118.0006c43_A mol:protein length:477 Gamma-aminobutyraldehyde dehydrogenase  ali model follow..  28  3.AMQYQLLINGVLVDG---EGERQSVYNPATGEVILEIAEASPAQVDAAVQAADNAFAEWGQTTPKARAECLLKLADSIEQNALEFARLESQNCGKPLHCVIDEIPAIVDVFRFFAGAARCLSGLAAGEYLEGHTSMIRRDPIGVVASIAPWNYPLMMAAWKLAPALAAGNCVVIKPSEITPLTALKLAVLAK-----------DIFPPGVLNVLFGGQTVGDVLTGHEKVRMVSLTGSIATGEHILRHTAPAIKRTHMELGGKAPVIVFDDADLDAVAQGVRTFGFYNAGQDCTAACRIYAQRGIYDALVEKLGNAVSSLKMGAPEDESTELGPLSSLAHLKRVTAAVEEAKALHIRVITGGSQTEG-KGYYFAPTLLADAKQEDAIVQREVFGPVVSITVFDDEDQVLRWANDSRYGLASSVWTQDVGRAHRL--SARLQYGCTWINTHFM-LVSEMPHGGQKQSGYGKDMSLYGLEDYTLVRHIMVKH.............. 477
52 -118.0004u3w_A mol:protein length:505 2-aminomuconate 6-semialdehyde dehydrogenase  ali model follow..  23  14DRQLLRHYINGEFVA----SGTTFPNLSPVDGRKLADVCEADAALVDSAVQAAHAAQKAWRDTTPAQRAAWLHKIADGIEARFDEFVAAEVADTGRPVAQARTDIARGIANFRTFADLVRTASGEYFETHAAELINYVTRKPLGVIGIISPWNLPLLLFTWKVAPALAMGNCVVAKPSEETPSSATLLAEVMHDV----------GLPPGVFNLIHGHGQAGEFLTRHPDISAITFTGESRTGSTIMKAVADGVKEVSFELGGKNAAVVFADADFDAAVAGVLRSSFTNAGQVCLCSERVYVERPIFERFVAALKEQAQALRVGAPEDPATTMGPLISRGHRDKVLSYFRLAVEEGATVVTGGGAPSFDDGAFVMPTIWTGLPDSARCVREEIFGPVCHIAPFDDEAEVVKRVNDSAYGLAASIWTTQLARGHRV--AKQIETGIVWVNAWFV-RDLRTPFGGTKLSGLGREGGRHSLDFYSELTNVCVRIA............. 499
53 -117.0001ky8_A mol:protein length:501 glyceraldehyde-3-phosphate dehydrogenase  ali model follow..  26  18...VYPSYLAGEWGG----SGQEIEVKSPIDLATIAKVISPSREEVERTLDVLFKRGRSARDMPGTERLAVLRKAADIIERNLDVFAEVLVMNAGKPKSAAVGEVKAAVDRLRLAELDLKKIGGDYIPGDTLETEGLVRREPLGVVAAITPFNYPLFDAVNKITYSFIYGNAVVVKPSISDPLPAAMAVKALLDA----------GFPPDAIALLNLPGKEAEKIVADDRVAAVSFTGSTEVGERVVKVGG--VKQYVMELGGGDPAIVLEDADLDLAADKIARGIYSYAGQRCDAIKLVLAERPVYGKLVEEVAKRLSSLRVGDPRDPTVDVGPLISPSAVDEMMAAIEDAVEKGGRVLAGGRRL---GPTYVQPTLVADRVKDMVLYKREVFAPVASAVEVKDLDQAIELANGRPYGLDAAVFGRDVVKIRRA--VRLLEVGAIYINDMPRHGIGYYPFGGRKKSGVFREGIGYAVEAVTAYKTIVFNYKGK........... 495
54 -117.0004ywe_A mol:protein length:487 Putative aldehyde dehydrogenase  ali model follow..  25  4..EEAKHFIAGEWTLPA--QLETIPVVDPSDGQPFATIARGTAPDIERAVAAARDAFAGWGAASAAERGRVLMRLSARVTDSIEELAAIEARDTGKPLKQARADAAALARYFEFYAGAADKLHGETLPYQ-AGYTVLTVREPHGVTGHIVPWNYPMQIFGRSVGAALAAGNACVVKPAEDACLSVLRVAELAAEA----------GLPAGALNIVTGGHEAGAALARHPGIDHISFTGSPATGKLVTQMAAENHVPVTLELGGKSPQIVFADADLDAALPVLVSAIVQNGGQTCSAGSRVLIERAVYEPLVERLATAFNGLRVG-PSRADLDCGPLINAKQQQRVWDFLSDAQHDGIPMAAHGQVVADESGFYQAPALLRDVPPSHRLAQEEVFGPVLAAMRFVDEDEAVALANGTPYGLVAGIWTRDGARQMRL--ARRLRAGQVFINNYGAGGGVELPFGGVGHSGHGREKGFEALYGFTALKTIAIRHG............. 481
55 -117.0004q92_A mol:protein length:517 Betaine aldehyde dehydrogenase  ali model follow..  26  21.HLSQRQYIDGEWVESA--NKNTRDIINPYNQEVIFTVSEGTKEDAERAILAARRAFESWSQETAETRGKKVRAIADKIKEHREALARLETLDTGKTLEESYADMDDIHNVFMYFAGLADKDGGEMIDSPIPDTESKIVKEPVGVVTQITPWNYPLLQASWKIAPALATGCSLVMKPSEITPLTTIRVFELMEEV----------GFPKGTINLILGGSEVGDVMSGHKEVDLVSFTGSIETGKHIMKNAANNVTNIALELGGKNPNIIFDDADFELAVDQALNGGYFHAGQVCSAGSRILVQNSIKDKFEQALIDRVKKIKLGNGFDADTEMGPVISTEHRNKIESYMDVAKAEGATIAVGGKRPDRKDGLFFEPTVITNCDTSMRIVQEEVFGPVVTVEGFETEQEAIQLANDSIYGLAGAVFSKDIGKAQRV--ANKLKLGTVWINDFHP-YFAQAPWGGYKQSGIGRELGKEGLEEYLVSKHILTNTNPQLVNWFS..... 510
56 -117.0004mpb_A mol:protein length:520 Betaine aldehyde dehydrogenase  ali model follow..  26  23KHLSQRQYIDGEWVESA--NKNTRDIINPYNQEVIFTVSEGTKEDAERAILAARRAFESWSQETAETRGKKVRAIADKIKEHREALARLETLDTGKTLEESYADMDDIHNVFMYFAGLADKDGGEMIDSPIPDTESKIVKEPVGVVTQITPWNYPLLQASWKIAPALATGCSLVMKPSEITPLTTIRVFELMEEV----------GFPKGTINLILGGSEVGDVMSGHKEVDLVSFTGGIETGKHIMKNAANNVTNIALELGGKNPNIIFDDADFELAVDQALNGGYFHAGQVCSAGSRILVQNSIKDKFEQALIDRVKKIKLGNGFDADTEMGPVISTEHRNKIESYMDVAKAEGATIAVGGKRPDRKDGLFFEPTVITNCDTSMRIVQEEVFGPVVTVEGFETEQEAIQLANDSIYGLAGAVFSKDIGKAQRV--ANKLKLGTVWINDFHP-YFAQAPWGGYKQSGIGRELGKEGLEEYLVSKHILTNTNPQ........... 507
57 -116.0004h73_A mol:protein length:491 Aldehyde dehydrogenase  ali model follow..  27  7..MKVANYINGEFKEPS--TGAFQVKTSPVDGSKIAEVPRSGREDAREAIDSAFEALKAWANIPAIRRAEYLYKMLEVFRQMKEDFMKILTVEGGGTYRKVWGEVVFTERLIQNAAELARHYQGRVLQSDSESTISVVFKRSKGVVGVITPWNYPLSISMKKIAHTLAVGNTVVYKPASDTPVTGWLIAQMVAKA----------GLPKGVFNLVIGGPVVGEEIVTHKRVAHVTFTGESSTGREIAAKAAGTLKTVTLELGGSDPLIILDDVDVDYAARLAVFASLFHQGQICTSAKRIIVHKAVADKFIERYVHYVKMLRIDDPRDEKVDLGPLINERQVALMKEFVDDAVSRGGRLLIGGRS----WGNFFEPAIFVDVDRNFRIMREEVFGPVRPIVVVENDDQAVEVANDTDYGLSGAVLTNNVNRAFRI--AEAVESGMFHINDVTFLEESHVPFGGIKASGVGREGGEWSFHETTYDRWVTVTLRTR........... 482
58 -116.0001bi9_A mol:protein length:499 RETINAL DEHYDROGENASE TYPE II  ali model follow..  24  17..KYTKIFINNEWQNSE--SGRVFPVCNPATGEQVCEVQEADKVDIDKAVQAARLAFSLWRRMDASERGRLLDKLADLVERDRATLATMESLNGGKPFLQAFYDLQGVIKTLRYYAGWADKIHGMTIPVD-GDYFTFTRHEPIGVCGQIIPWNFPLLMFTWKIAPALCCGNTVVIKPAEQTPLSALYMGALIKEA----------GFPPGVVNILPGGPTAGAAIASHIGIDKIAFTGSTEVGKLIQEAAGSNLKRVTLELGGKSPNIIFADADLDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVKRSVERAKRRIVGSPFDPTTEQGPQIDKKQYNKILELIQSGVAEGAKLECGGKGL-GRKGFFIEPTVFSNVTDDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALMV--SSAMQAGTVWINCYNA-LNAQSPFGGFKMSGNGREMGEFGLREYSEVKTVTVKIPQK........... 497
59 -115.0004o6r_A mol:protein length:496 Aldehyde Dehydrogenase  ali model follow..  28  1MAMQTQLFIDGRFVDAV--DRGTIDVLNPHDGSVITKIAAATAADVDLAVDAATRAFPAWSAMPAAERGRLLLRLADAIEANTEALAQLESLDTGHPIRDSRADVPRTAACFRYFGGMADKLQGSVIPVD-TGFLNYVQRAPIGVVGQIVPWNFPLMFTSWKMGPALAAGNTVVLKPSEITPLSTLRIVELMAEV----------GFPAGVVNIVPGGHTAGQRLAEHPGVGKIAFTGSTATGRRIVEASQGNLKRVQLELGGKGANIVFDDANLDAAINGAAWAIFHNQGQACIAGSRLVLHERIADAFLERFVALASSIRIGNPLDPNTEMGPLTSKQHLDRVLSYVDVAREQGGRVLTGGSAPQDANGYYVRPTIVEAKHATDRVAQEEVFGPFVTVLRFGSDDEALAIANATEYGLGSGLWTNDLSRAHRM--AARIDAGMCWINCYKR-VNPGSPFGGVGKSGYGREMGFEAMHDYTEARSVWVNVDGNVPPHFK..... 489
60 -115.0001a4s_A mol:protein length:503 BETAINE ALDEHYDE DEHYDROGENASE  ali model follow..  25  16VVTDDLNYWGGRRIKSKD-GATTEPVFEPATGRVLCQMVPCGAEEVDQAVQSAQAAYLKWSKMAGIERSRVMLEAARIIRERRDNIAKLEVINNGKTITEAEYDIDAAWQCIEYYAGLAPTLSGQHIQLP-GGAFAYTRREPLGVCAGILAWNYPFMIAAWKCAPALACGNAVVFKPSPMTPVTGVILAEIFHEA----------GVPVGLVNVVQGGAETGSLLCHHPNVAKVSFTGSVPTGKKVMEMSAKTVKHVTLELGGKSPLLIFKDCELENAVRGALMANFLTQGQVCTNGTRVFVQREIMPQFLEEVVKRTKAIVVGDPLLTETRMGGLISKPQLDKVLGFVAQAKKEGARVLCGGEPLTPKNGYFMSPCVLDNCRDDMTCVKEEIFGPVMSVLPFDTEEEVLQRANNTTFGLASGVFTRDISRAHRV--AANLEAGTCYINTYSI-SPVEVPFGGYKMSGFGRENGQATVDYYSQLKTVIVEMGDV........... 499
61 -115.0003ty7_A mol:protein length:478 Putative aldehyde dehydrogenase SAV2122  ali model follow..  24  4MRDYTKQYINGEWVESN--SNETIEVINPATEEVIGKVAKGNKADVDKAVEAADDVYLEFRHTSVKERQALLDKIVKEYENRKDDIVQAITDELGAPLSLSER--VHYQMGLNHFVAARDALDNYEFEE--RRGDDLVVKEAIGVSGLITPWNFPTNQTSLKLAAAFAAGSPVVLKPSEETPFAAVILAEIFDKV----------GVPKGVFNLVNGGAGVGNPLSEHPKVRMMSFTGSGPTGSKIMEKAAKDFKKVSLELGGKSPYIVLDDVDIKEAAKATTGKVVNNTGQVCTAGTRVLVPNKIKDAFLAELKEQFSQVRVGNPREDGTQVGPIISKKQFDQVQNYINKGIEEGAELFYGGPGKPEEKGYFARPTIFINVDNQMTIAQEEIFGPVMSVITYNDLDEAIQIANDTKYGLAGYVIGKDKETLHKV--ARSIEAGTVEINEAGR--KPDLPFGGYKQSGLGREWGDYGIEEFLEVKSIAGYFK............. 478
62 -115.0003i44_A mol:protein length:497 Aldehyde dehydrogenase  ali model follow..  22  16MLNKRKFYINGLWDDPS--TPHDLYVIDPSTEEACAVISLGSTRDADKAINAAKKAFQTWKTTSPHERLGFVEKILEIYEKRSSDMAKTISMEMGAPIDMALAQTATGSSHIRNFIKAYKEFSFQEALIE-GNEQAILHYDAIGVVGLITPWNWPMNQVTLKVIPALLAGCTMVLKPSEIAPLSAMLFAEILDEA----------ALPSGVFNLINGGANVGSYLSAHPDLEMISFTGSTRAGKDISKNASNTLKRVCLELGGKGANIIFADADID-ALQRGVRHCFYNSGQSCNAPTRMLVEQAIYDKAIKTAKDIAEKTQVGPGHQTGNHIGPVVSKEQYDKIQDLIQSGIDEGATLVTGGTGLPMERGYYVRPTVFADVKPHMRIFREEIFGPVLSLLPFNTEDEAVTLANDTEYGLTNYIQSQDRSKCRRI--AAQVRSGMVEVNGHEL--PGGSYFGGVKFSGRAREGGLWGIKEFLDTKAIS................. 489
63 -115.0004x2q_A mol:protein length:504 Retinal dehydrogenase 2  ali model follow..  25  16..KYTKIFINNEWQNSE--SGRVFPVYNPATGEQVCEVQEADKADIDKAVQAARLAFSLWRRMDASERGRLLDKLADLVERDRAVLATMESLNGGKPFLQAFVDLQGVIKTFRYYAGWADKIHGMTIPVD-GDYFTFTRHEPIGVCGQIIPWNFPLLMFAWKIAPALCCGNTVVIKPAEQTPLSALYMGALIKEA----------GFPPGVINILPGGPTAGAAIASHIGIDKIAFTGSTEVGKLIQEAAGSNLKRVTLELGGKSPNIIFADADLDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVRRSVERAKRRVVGSPFDPTTEQGPQIDKKQYNKILELIQSGVAEGAKLECGGKGL-GRKGFFIEPTVFSNVTDDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALTV--SSAMQAGTVWINCYNA-LNAQSPFGGFKMSGNGREMGEFGLREYSEVKTVTVKIPQK........... 496
64 -115.0005fhz_A mol:protein length:529 Aldehyde dehydrogenase family 1 member A3  ali model follow..  25  41..KFTKIFINNEWHESK--SGKKFATCNPSTREQICEVEEGDKPDVDKAVEAAQVAFQRWRRLDALSRGRLLHQLADLVERDRATLAALETMDTGKPFLHAFFDLEGCIRTLRYFAGWADKIQGKTIPTD-DNVVCFTRHEPIGVCGAITPWNFPLLMLVWKLAPALCCGNTMVLKPAEQTPLTALYLGSLIKEA----------GFPPGVVNIVPGGPTVGAAISSHPQINKIAFTGSTEVGKLVKEAASSNLKRVTLELGGKNPCIVCADADLDLAVECAHQGVFFNQGQCCTAASRVFVEEQVYSEFVRRSVEYAKKRPVGDPFDVKTEQGPQIDQKQFDKILELIESGKKEGAKLECGGSAMED-KGLFIKPTVFSEVTDNMRIAKEEIFGPVQPILKFKSIEEVIKRANSTDYGLTAAVFTKNLDKALKL--ASALESGTVWINCYNA-LYAQAPFGGFKMSGNGRELGEYALAEYTEVKTVTIKLGDKNP......... 523
65 -115.0003rjl_A mol:protein length:538 1-pyrroline-5-carboxylate dehydrogenase  ali model follow..  24  34LGQSYPLVIDGERYE----TENKIVSINPANKEVVGTVSKATQDHAEKAIQAAAKAFETWRYTDPEERAAVLFRAVAKVRRKKHEFSALLVKEAGKPWNEADADTAEAIDFMEYYARQMIELAKGKPVNSREGERNQYVYTPTGVTVVIPPWNFLFAIMAGTTVAPIVTGNTVVLKPASAAPVIAAKFVEVLEES----------GLPKGVVNFVPGGAEVGDYLVDHPKTSIITFTGSREVGTRIFERAAKHLKQVIAEMGGKDTVVVDEDCDIELAAQSIFTSAFGFAGQKCSAGSRAVVHEKVYDEVLKRVIEITESKKVGEPDSADVYMGPVIDQASFNKIMDYIEIGKEEGRLVSGGKG--DDSKGYFIEPTIFADLDPKARLMQEEIFGPVVAFSKVSSFDEALEVANNTEYGLTGAVITKNRDHINRA--KQEFHVGNLYFNRNCTGAVGYHPFGGFKMSGTDSKAGPDYLALHMQAKTISEMFAEN........... 519
66 -115.0003b4w_A mol:protein length:495 Aldehyde dehydrogenase  ali model follow..  21  5ATEYDKLFIGGKWTKPS--TSDVIEVRCPATGEYVGKVPMAAAADVDAAVAAARAAFDNWPSTPPHERAAVIAAAVKMLAERKDLFTKLLAAETGQPPTIIETHWMGSMGAMNYFAGAADKVTWTETRTG-SYGQSIVSREPVGVVGAIVAWNVPLFLAVNKIAPALLAGCTIVLKPAAETPLTANALAEVFAEV----------GLPEGVLSVVPGGIETGQALTSNPDIDMFTFTGSSAVGREVGRRAAEMLKPCTLELGGKSAAIILEDVDLAAAIPMMVFSGVMNAGQGCVNQTRILAPRSRYDEIVAAVTNFVTALPVGPPSDPAAQIGPLISEKQRTRVEGYIAKGIEEGARLVCGGGRPEGDNGFFIQPTVFADVDNKMTIAQEEIFGPVLAIIPYDTEEDAIAIANDSVYGLAGSVWTTDVPKGIKI--SQQIRTGTYGINWYAF--DPGSPFGGYKNSGIGRENGPEGVEHFTQQKSVLLPMGYTV.......... 486
67 -114.0001o9j_A mol:protein length:501 ALDEHYDE DEHYDROGENASE, CYTOSOLIC 1  ali model follow..  24  19..QHTKLFINNEWHESV--SGKTFPVFNPATEEKICEVEEADKEDVDKAVKAAREAFQMWRTMDASERGQLIYKLADLIERDRLLLATLESINAGKVFASAYMDLDYCIKALRYCAGWADKIQGRTIPVD-GEFFSYTRHEPIGVCGLIFPWNAPMILLACKIGPALCCGNTVIVKPAEQTPLTALHVASLIKEA----------GFPPGVVNIVPGGPTAGAAISSHMDVDKVAFTGSTEVGKMIQEAAAKNLKRVTLELGAKNPCIVFADADLDSAVEFAHQGVFTNQGQSCIAASKLFVEEAIYDEFVQRSVERAKKYVFGNPLTPGVNHGPQINKAQHNKIMELIESGKKEGAKLECGGGPW-GNKGYFIQPTVFSNVTDDMRIAKEEIFGPVQQIMKFKSLDEVIKRANNTYYGLVAGVFTKDLDKAVTV--SSALQAGTVWVNCYLA-ASAQSPAGGFKMSGHGREMGEYGIHEYTEVKTVTMKISEK........... 499
68 -114.0004i3t_A mol:protein length:488 Aldehyde dehydrogenase (NAD+)  ali model follow..  25  14..RHEPMRIAGRLVD----TDDRVEVRYPWNDTVVGTVPAGRAEHAREAFAIAAAY---QPKLTRYERQKILLATAEALAARKEEISDVITLELGISKADSLYEVGRAFDVFTLAGQMCIRDDGEIFSCDGKARKIFTMREPLTAISAITPFNHPLNMVAHKVAPAIATNNCVVVKPTELTPMTALLLADILYEA----------GLPPEMLSVVTGPADIGMEMITNPHVDLVTFTGSVPVGKLIAANAH--YKRQVLELGGNDPLIILNDLDLARAADLAVAGATKNSGQRCTAVKRILCQESVADRFVPLVLERAKRLRFGDPMDRSTDLGTVIHEKAAALFEERVMRAAEEGADILYHPGR----SGALLPPIVVDRVPHQSDLVLEETFGPIIPIVRVPDDDDAITLSNSTAFGLSSGVCTNDYRRMQKY--IAGLKVGTVNIWEVPGYRIEMSPFGGIKDSGNGYKEGIEAMKSFTNVKTFSLPW.............. 487
69 -114.0001a4z_A mol:protein length:499 ALDEHYDE DEHYDROGENASE  ali model follow..  25  15EVLYNQIFINNEWHDAV--SKKTFPTVNPSTGDVICHVAEGDKADVDRAVKAARAAFQPWRRMDASERGRLLNRLADLIERDRTYLAALETLDNGKPYIISYVDLDMVLKCLRYYAGWADKYHGKTIPID-GDYFSYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEA----------GFPPGVVNVIPGGPTAGAAIASHEDVDKVAFTGSTEVGHLIQVAAGKNLKRVTLEIGGKSPNIIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYAEFVERSVARAKSRVVGNPFDSRTEQGPQVDETQFKKVLGYIKSGKEEGLKLLCGGGAA-ADRGYFIQPTVFGDLQDGMTIAKEEIFGPVMQILKFKSMEEVVGRANNSKYGLAAAVFTKDLDKANYL--SQALQAGTVWVNCYDV-FGAQSPFGGYKLSGSGRELGEYGLQAYTEVKTVTVRVPQK........... 497
70 -114.0005gt6_A mol:protein length:508 Betaine-aldehyde dehydrogenase  ali model follow..  23  24LNEEIKMFINGEFVSAI--GGKTFETYNPATEDVLAVVCEAQEEDIDAAVKAARSAFESWAEMTTAERAHLIYKLADLIEEHREELAQLEALDNGKPYQVALDDISATVENYRYYAGWTTKIIGQTIPIS-KDYLNYTRHEPVGVVGQIIPWNFPLVMSSWKMGAALATGCTIVLKPAEQTPLSLLYAAKLFKEA----------GFPNGVVNFVPGGPEAGAAIVNHHDIDKVAFTGSTVTGKYIMRQSAEMIKHVTLELGGKSPNIILEDADLEEAINGAFQGIMYNHGQNCSAGSRVFVHRKHYETVVDALVKMANNVKLGAGMEKETEMGPLVSKKQQERVLNYIEQGKKEGATVAAGGERALE-KGYFVKPTVFTDVTDDMTIVKEEIFGPVVVVLPFDSTEEVIERANNSSYGLAAGVWTQNIKTGHQV--ANKLKAGTVWINDYNL-ENAAAPFGGYKQSGIGRELGSYALDNYTEVKSVWVNIK............. 502
71 -114.0004qyj_A mol:protein length:516 Aldehyde dehydrogenase  ali model follow..  26  25LRLPHQMLIGGQWVSAQ--SGKTLNVYNPATGDILTEVPDGDVEDVNAAVESAAATLRSWRRMPPSARERILLRLADLLEVHGDELARLETLNNGKLLIYSKMEVGASAQWLRYMAGWATKLTGSTLDLSLPRSRASTQRVPVGVVAAIIPWNFPLLMAVWKIAPALACGNTVVLKPAEETPLTALRLAELAMEA----------GLPAGALNVVTGGETAGDALVRHPKVAKVAFTGSTEVGRIIGSACGRSLKAVSLELGGKSPVIVLADCDPQEAAEGAAAAIFFNHGQVCTAGSRLYVHESIYEDVIQRLAVIGESIVVGSGLEQGVHMGPMVSKKHHENVLRHIRNGIEDGADLICGGTEAPCAQGFFVKPTIFANRKKDIRLLSQEVFGPVLVATPFSDIAEVVNEANRSVYGLGASIWTNDLSAALRI--NDELEAGTVWVNTHNM-VDPNLPFGGFKDSGVGREHGAAAIEHYTTTRSLVIAY.............. 510
72 -114.0004wb9_A mol:protein length:501 Retinal dehydrogenase 1  ali model follow..  25  19..QYTKIFINNEWHDSV--SGKKFPVFNPATEEELCQVEEGDKEDVDKAVKAARQAFQIWRTMDASERGRLLYKLADLIERDRLLLATMESMNGGKLYSNAYNDLAGCIKTLRYCAGWADKIQGRTIPID-GNFFTYTRHEPIGVCGQIIPWNFPLVMLIWKIGPALSCGNTVVVKPAEQTPLTALHVASLIKEA----------GFPPGVVNIVPGGPTAGAAISSHMDIDKVAFTGSTEVGKLIKEAAGKNLKRVTLELGGKSPCIVLADADLDNAVEFAHHGVFYHQGQCCIAASRIFVEESIYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQYDKILDLIESGKKEGAKLECGGGPW-GNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLSAGVFTKDIDKAITI--SSALQAGTVWVNCYGV-VSAQCPFGGFKMSGNGRELGEYGFHEYTEVKTVTVKISQK........... 499
73 -114.0001bxs_A mol:protein length:501 ALDEHYDE DEHYDROGENASE  ali model follow..  26  19..KYTKIFINNEWHSSV--SGKKFPVFNPATEEKLCEVEEGDKEDVDKAVKAARQAFQIWRTMDASERGRLLNKLADLIERDRLLLATMEAMNGGKLFSNAYMDLGGCIKTLRYCAGWADKIQGRTIPMD-GNFFTYTRSEPVGVCGQIIPWNFPLLMFLWKIGPALSCGNTVVVKPAEQTPLTALHMGSLIKEA----------GFPPGVVNIVPGGPTAGAAISSHMDVDKVAFTGSTEVGKLIKEAAGKNLKRVSLELGGKSPCIVFADADLDNAVEFAHQGVFYHQGQCCIAASRLFVEESIYDEFVRRSVERAKKYVLGNPLTPGVSQGPQIDKEQYEKILDLIESGKKEGAKLECGGGPW-GNKGYFIQPTVFSDVTDDMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLSAGIFTNDIDKAITV--SSALQSGTVWVNCYSV-VSAQCPFGGFKMSGNGRELGEYGFHEYTEVKTVTIKISQK........... 499
74 -113.0004o5h_A mol:protein length:511 Phenylacetaldehyde dehydrogenase  ali model follow..  27  21LAKPKQMLIGAEWSDAA--SGRQLDVVNPADGTVIARVPEADERDVQQAVAAARRAFDAWRTAKTTDRERLMLVLADLIEANARELAEIESLDNGKPVMVAQGDVAMAAQCFRYMAGWATKIEGSVIDAGMPEIFAYTRKEPVGVVGAIIPWNFPLLMAAWKIAPALATGCTVVLKPAEDTPLSALRLGELIQAA----------GFPDGVVNIVTGGHTAGAALSRDPRIDKIAFTGSTQTGKTIGHAALDNMTRMSLELGGKSPVIVLPDVDLDKAAQGVANAIFFNQGQVCTAGSRAYIHSKVFDGVIERVAKIAASLKIGPGMDPATQIGPLVSAKQRERVCGYIDSGFGEGARAAAGGRAIDG-PGFFVEPTVLVDTTQAMRVVREEIFGPVLVAMPFDDVDTAVQLANDTPYGLGASIWSNDLSAIHKL--VPRIAAGTVWVNCHSL-LDNALPFGGMKQSGFGRELGRAVIDQYTESKSVMMNYA............. 505
75 -113.0003r31_A mol:protein length:517 Betaine aldehyde dehydrogenase  ali model follow..  27  11AQPKASHFIDGDYVEDN--TGTPFESIFPATGEMIAKLHAATPAIVERAIASAKRAQKEWAAMSPMARGRILKRAADIMRERNDALSTLETLDTGKPIQETIADPTSGADAFEFFGGIASALNGDYIPL--GGDFAYTKRVPLGVCVGIGAWNYPQQIACWKAAPALVAGNAMVFKPSENTPLGALKIAEILIEA----------GLPKGLFNVIQGDRDTGPLLVNHPDVAKVSLTGSVPTGRKVAAAAAGHLKHVTMELGGKSPMIVFDDADIESAVGGAMLGNFYSSGQVCSNGTRVFVQKKAKARFLENLKRRTEAMILGDPLDYATHLGPLVSKAQQEKVLSYIEKGKAEGATLITGGGIPNNGEGAYVQPTVFADVTDDMTIAREEIFGPVMCVLDFDDEDEVLARANATEFGLAGGVFTADLARAHRV--VDGLEAGTLWINTYNL-CPVEIPFGGSKQSGFGRENSAAALEHYSELKTVYVSTGKV........... 491

FFAS is supported by the NIH grant R01-GM087218-01
1 3 0 6 1 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ma H, Xiong H, Liu T, Zhang L, Godzik A., Zhang Z. Aggregate formation and synaptic abnormality induced by DSCR1. J Neurochem. 2004 Mar;88(6):1485-96.