current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 5Z0B Entity 1(prereleased), from PDB1018

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .  540    .  550    .  560    .  570    .  580    .
# Score Template Links and tools%idFirst DAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQXPFEDHVKLVNEVTEFAKTCVADESAENCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERNECFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARRHPYFYAPELLFFAKRYKAAFTECCQAADKAACLLPKLDELRDEGKASSAKQRLKCASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKVHTECCHGDLLECADDRADLAKYICENQDSISSKLKECCEKPLLEKSHCIAEVENDEMPADLPSLAADFVESKDVCKNYAEAKDVFLGMFLYEYARRHPDYSVVLLLRLAKTYETTLEKCCAAADPHECYAKVFDEFKPLVEEPQNLIKQNCELFEQLGEYKFQNALLVRYTKKVPQVSTPTLVEVSRNLGKVGSKCCKHPEAKRMPCAEDYLSVVLNQLCVLHEKTPVSDRVTKCCTESLVNRRPCFSALEVDETYVPKEFNAETFTFHADICTLSEKERQIKKQTALVELVKHKPKATKEQLKAVMDDFAAFVEKCCKADDKETCFAEEGKKLVAASQAALGLLast
1 -58.200PF00273.20; L9L5M3_TUPCH/432-610; Serum albumin family  ali follow..  74  1.....................................................................................................................................................................................................................................................................................................................................................................................................QNCELFEQLGEYGFQNALLIRYTKKSPQVQTSTLVEIGRKLGSLGSRCCKHPESERMHCAEEYLSLVLNKMCLAHEKAPVSDRITKCCSESLVNRRPCFSALPPDDTFEPKKFEADSFTFHADICTIPDTEKQIKKQTALVELVKHKPHATNDQLKTVMGDFTAFVDKCCKAEDKEACF................. 179
2 -39.700PF05782.11; H0WRX2_OTOGA/1-562; Extracellular matrix protein 1 (ECM1)  ali follow..  12  215............................WNLPQSGYSHLTRQGETLNFLYSRCCRHTQRLDCAKLVWEDAMTRFCEAE--FSVKTRAHWCCKQQGEARFSCFQKEAPQPHYRLRACPNHQSGISSGLELP------------------------FPPGVPTLDNVKNICHLRR------------------------------------------FRSVPRNLPATDIQRQLQVLTWLEGEFQRCCRQDNHTCTWKWEDSLDRYCDQEHAVKTHPYSCCHYPSPARDECFARRAPYPNYDRDILT-----------------------------------------VDISRVTPNLMGYLCGKQR-----------------------------------------------------VLTKHKQIPGLIQNMTASCCELPFPEQACCAEEEKLAFISDLCGPRRNFWRDP--AFCCDNPGDEQVNCFNTNYLRNVALVAGDTENAKGQGEQ......................................................................... 545
3 -11.700PF07165.11; Q7PTC7_ANOGA/42-249; Protein of unknown function (DUF1397 topsan)  ali follow..  13  1..........................................................................................................................................................................................................................................................................................................................................................LPSMEEVERMLRDKCNTAGAPADAYDNAKDAAKTFFECGQSLIDIGQFQQEVEAAKPTGDLDTVFNKYCRK--RSTLIECVNTFANAVDPCLEAEEKVFKTSGLDIFKNLLNFVCHKDGDQ-IAEKGPECFQEQKNDLIACVNETFSGYVPETSLTTIPRLVIGPKQCEDFTKLQN------------------------------------CMVRELEQCDESTPANLVESLFRYV.. 202
4 -10.200PF09164.10; H0VTA4_CAVPO/405-466; Vitamin D binding protein, domain III  ali follow..  23  1...............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ELCADYSENTFTEYKKKLTELRTKLPGATPTELAGQVERHSDFASKCCSINSPPRC.................. 58
5 -9.210PF00335.20; Q9V3X2_DROME/10-260; Tetraspanin family  ali follow..  12  65.......................................................................................................................................................................................................................................................................................................................................................................CCGVCRESQCLLVSFFCVILIVMVAQIAAGAWAFHNKDKLDDIVRAAVKSSVQEEYGQSTMSSRTVTFDTLQKNLK-CCGADGPGDWATSRFNNVDRTNIVEIAVSSMNVFYNIESCCKDNLKDNECELSRRLKFGGPLNNAIYQQG-------C---VDKLIEIIYENWVTIFAVTAAVILLELLSLT-----ALSLCCA......................... 251
6 -7.940PF07948.11; GP_CCHFI/241-884; Nairovirus M polyprotein-like  ali follow..  2...........TNRSKRNLKMEIILTLSQGLKKYYGKILRLLQLTLEEDTEG-CKRNLGLDCDDTFFQKRIEEFFITGEGHFNEVLQFRTPGTLSTTESTCYSGTSNSGLQLINITRHSTRIVDTPGPKITNLKTINCINLKASIFKEHREVEINVLLPQVAVNLSNCHVVIKSHVCDYSLDIDTYKIVIDKKNKLNDRCTFTDCVIKGREVRKGQSVLRQYKTEIRIGKASTGSRRLLSEEPSCISRTQLLRTETA-----EIHGDNYGGPGDKITICNGS-GSELGCYTINRVRSFKLCENSATGKN------CEIDSVPVKCRQGYCL------RITQEGRGHVKLSRGSEVVLDACCTGDILVDCSGGQQHFLKDNLCPKIPLLGKMAIYICRMSNHPKTTMAFLFWF-VITCILCKAIFYLLIIVGTLGKRLKQYRELKPQTC----------TICETTPVNAIDAEMHDC------SYNIC--------PYCASRLTSDGLARHVIQCPKRKEKVEETELYLNLERIPWVVRKLLQVSESTGVALKRSS.............................. 581
7 -7.320PF14875.6; V8NFM5_OPHHA/9-166; N-term cysteine-rich ER, FAM69  ali follow..  13  33...............................................................................................................................................................................................................................................................................................................................................................................................................................................................SELCRGHVCQAIICDQYNKGIISGSM--CCEDHTLVFEHCLSPSPTQQVYSG------LWKEKEVVIKCGLEEALKADSNPDADPRRDVVLFNKPTRGTSMDEFREMLLNFLKAG-------GDQASLTNLVNQIIA. 158
8 -6.850PF03039.14; L8YEA2_TUPCH/1-213; Interleukin-12 alpha subunit  ali follow..  13  29..................................................................................................................................................................................................................................................................................................................................................................................................................................................FGCLSHSQNAISNTLQKARKNLEFYSCTSEETKDKTSTVKACLPLELITNESCLASRETSFKTNGSCLAPEKTSHMMTLCLSSIYEDLKMYQVEFKAINAMDPERQILLDQNMLTAIDELMQALNFNSDTVPC-----ILLHAFRVRAVTI 203
9 -6.590PF00423.19; HN_SENDO/44-571; Haemagglutinin-neuraminidase  ali follow..  24......................................................................................................ERYSMTVEALNTSNKEVKESLTSLIRQEVITRAANIQSSVQTGIPV----LLNKNSRDVIRLIEKSCNRQELTQLCDSTIAVHHAEGIAPLEPHSFWRCPAGEPYLSSDPEVSLLPGPSLLSGSTTI-------------SGCVRLPSLSIGEASSNLITQGCADIGKSYQVLQ----DINDNRKSCSVVATGTRGYQ-------SMPIVDERTDYSSDGIEDLVLDILDLKGRTKSHRYSNSEIDLDHPFSALYTKCCQQVSQDTCNEALKITW-----LGGKQVVSVLIQVNDYLSERPRIRVTTIPITQNYLGAEGRLLKLGDQV--IYTRSSGWHSQLQIGVLDVSHPLTISWT---PHEALSRPGNEDCCPKE------CISGVYTDA-----------LSPDAANVATVTLYANTSRVNPTIMYSNTTNIINMLRIKDVQLEAAYTTTSCITHFGKGYCFH--IIEINQKSLNTLQP 517
10 -6.560PF02451.15; NO26B_SOYBN/30-217; Nodulin  ali follow..  10  2.......................................................................................................................................................................................................................................................................................................................................................................................................................................................IPENPKFKKFVTDGTSHVAERCSSGSEALHGEGGLALCLFDSMEN--CLVEHGAAKVNQRSLFVLPKGSTPDSLISCVCTWTSMVPSTRLLNNQQLGQGFYYFQYEPLLQ-FRTVLRTCLSHSIHESCVYPSGA---ESGTGSLPI 188

FFAS is supported by the NIH grant R01-GM087218-01
1 3 2 7 5 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Doctor KS, Reed JC, Godzik A., Bourne PE. The apoptosis database. Cell Death Differ. 2003 Jun;10(6):621-33. Review.