current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 4gn3_B mol:protein length:113 OBody AM1L10, from PDB1018

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110
# Score Template Links and tools%idFirst AMGSVYPKKTHWTAEITPNLHGTEVVVAGWVASLGDYGRVKIVKVSDREGGAAVSVYLEYGKTPDHLFKVFAELSREDVVVIKGIVEASKAAADMHNGVEIFPSEIWILNKAKLast
1 -57.100d1l0wa1 b.40.4.1 (A:1-104) Aspartyl-tRNA synthetase (AspRS) {Thermus thermophilus, AspRS-1 [TaxId: 274]}  ali model 3D-neighbors follow..  27  2.......RRTHYAGSLRETHVGEEVVLEGWVNRRRDLGGLIFLDLRDREGLVQLVAHPA-----SPAYATAERVRPEWVVRAKGLVRLRPENPRLATGVEVELSALEVLAEAK 104
2 -56.300d3nema1 b.40.4.0 (A:1-102) automated matches {Thermococcus kodakarensis [TaxId: 311400]}  ali model 3D-neighbors follow..  38  2.......YRTHYSSEITEELNGQKVKVAGWVWEVKDLGGIKFLWIRDRDGIVQITAPKK--KVDPELFKLIPKLRSEDVVAVEGVVNFTPKA---KLGFEILPEKIVVLNRAE 102
3 -54.200d1x54a1 b.40.4.0 (A:1-104) automated matches {Pyrococcus horikoshii [TaxId: 53953]}  ali model 3D-neighbors follow..  24  2.......IEKVYCQEVKPELDGKKVRLAGWVYTNMRVGKKIFLWIRDSTGIVQAVVAKN--VVGEETFEKAKKLGRESSVIVEGIVKADERA---PGGAEVHVEKLEVIQAVS 102
4 -47.800d1eova1 b.40.4.1 (A:71-204) Aspartyl-tRNA synthetase (AspRS) {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  16  22.......KRVKFVDLDEAKDSDKEVLFRARVHNTRQQGALAFLTLRQQASLIQGLVKANKGTISKNMVKWAGSLNLESIVLVRGIVKKVDEPIKTVQNLEIHITKIYTISETP 131
5 -42.200d1n9wa1 b.40.4.1 (A:1-93) Aspartyl-tRNA synthetase (AspRS) {Thermus thermophilus, AspRS-2 [TaxId: 274]}  ali model 3D-neighbors follow..  23  4...........LVRDLK-AHVGQEVELLGFLHWRRDLGRIQFLLLRDRSGVVQVVTGGL------------KLPLPESALRVRGLVVENAKA---PGGLEVQAKEVEVLSPAL 89
6 -25.100d3a74a1 b.40.4.1 (A:4-145) Lysyl-tRNA synthetase (LysRS) {Geobacillus stearothermophilus [TaxId: 1422]}  ali model 3D-neighbors follow..  20  29.......ERTHKAEELFELEQQIEVAVAGRIMTKRGMGKAGFAHIQDVTGQIQIYV--RQDDVGEQQYELFKISDLGDIVGVRGTMFKTKVGE-----LSIKVSSYEFLTKA. 136
7 -24.700d4ycub1 b.40.4.0 (B:72-216) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  15  29.......HVDISLTDFIQKYTDITLKVAGRIHAKRASGGLIFYDLRGEGVKLQVMANSRNYKSEEEFIHINNKLRRGDIIGVQGNPGKTKKGE-----LSIIPYEITLLSPC. 138
8 -21.600d6aqga1 b.40.4.0 (A:9-153) automated matches {Mycobacterium ulcerans [TaxId: 362242]}  ali model 3D-neighbors follow..  21  27.......ERTHTLAEIRASATEDIVGVAGRVVFARNTGKLCFATLQDGDGTQLQAMISLDEVGRESLDRWKADVDIGDVVYVHGTVISSRRGE-----LSVLADSWRMAAKA. 134
9 -21.200d5elna1 b.40.4.0 (A:46-193) automated matches {Cryptosporidium parvum [TaxId: 353152]}  ali model 3D-neighbors follow..  17  26.......KISMSLPAYALKYKDTTLSLSGRVTSIRSSSSLIFYDIFCEEQKVQIIANIMEHDISTGEFSVSSEIRRGDVVGFTGFPGKSKRGE-----LSLFSKSVVLLSPC. 136
10 -13.500d1nnxa_ b.40.10.1 (A:) Hypothetical protein YgiW {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  19  26...........TVESAKSLRDDTWVTLRGNIVERISDDLYVF---KDASGTINVDIDHKRWN---------VTVTPKDTVEIQGEV------DKDWNSVEIDVKQIRKV.... 106
11 -12.200d2pi2e_ b.40.4.3 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  1.VDMMDLPRSRINAGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDGEG-KNGTIELMEPLDEEISGIVEVVGRVTAKATILCTSYVQFKEDSHPF--DLGLYNEAVKIIHDFP 109
12 -12.000d2pi2a_ b.40.4.3 (A:) Replication protein A 32 KDa subunit (RPA32) fragment {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  10  32......................SQVTIVGIIRHAEKAPTNIVYKIDDMTAAPMDVRQWVDTDDTS---SENTVVPPETYVKVAGHLRSFQNKK------SLVAFKIMPLEDMN 113

FFAS is supported by the NIH grant R01-GM087218-01
1 2 8 4 9 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Bossy-Wetzel E, Barsoum MJ, Godzik A., Schwarzenbacher R, Lipton SA. Mitochondrial fission in apoptosis, neurodegeneration and aging. Curr Opin Cell Biol. 2003 Dec;15(6):706-16. Review.