current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 1qe0_A mol:protein length:420 Histidine--tRNA ligase, from PDB1018

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420
# Score Template Links and tools%idFirst MIKIPRGTQDILPEDSKKWRYIENQLDELMTFYNYKEIRTPIFESTDLFARGVGDSTDVVQKEMYTFKDKGDRSITLRPEGTAAVVRSYIEHKMQGNPNQPIKLYYNGPMFRYERKQKGRYRQFNQFGVEAIGAENPSVDAEVLAMVMHIYQSFGLKHLKLVINSVGDMASRKEYNEALVKHFEPVIHEFCSDCQSRLHTDPMRILDCKVDRDKEAIKTAPRITDFLNEESKAYYEQVKAYLDDLGIPYTEDPNLVRGLDYYTHTAFELMMDNPNYDGAITTLCGGGRYNGLLELLDGPSETGIGFALSIERLLLALEEEGIELDIEENLDLFIVTMGDQADRYAVKLLNHLRHNGIKADKDYLQRKIKGQMKQADRLGAKFTIVIGDQELENNKIDVKNMTTGESETIELDALVEYFKKLast
1 -133.000[J] COG0124 Histidyl-tRNA synthetase  ali follow..  59  3.IQIPRGTQDILPGDVETWQWIEQKAYDLCRRYNYQEIRVPMFEHTELFLRGVGDTTDIVQKEMYTFEDRGGRSLTLRPEGTASVTRAYVSNKLYGQANQPTKLFYIGPMFRYERPQSGRMRQFVQFGVEALGSADPAIDAEVLALVMRFYEELGLKNLKLVINSLGDTDSRLAHREALVNHFKPRIHEFCNDCQDRLEKNPLRILDCKKDRDHELMGTAPSIHDYLSTESKAYFEKVQSYLTALNIPFVVDATLVRGLDYYNHTAFEVMVDGEGF-GAITTLCGGGRYNGLVEEIGGPETPGIGFALSIERAIMALEAQQAKPAHNQAIDCYVVTLGEAAKDKGVELVYQLRNAGISAEKDYLDRKMKGQLKAADRLHAKWTVILGEDELAVGKVNVKNMETGEQTDVALTDLVSHMKQ 420
2 -96.900[J] KOG1936 Histidyl-tRNA synthetase  ali follow..  22  56IIKTPKGTRDLSPQHMVVREKILDLVISCFKRHGAKGMDTPAFELKETLTEKYGEDS----GLMYDLKDQGGELLSLRYDLTVPFARYLAMNK-----VKKMKRYHVGKVWRRESPTQGRYREFCQCDFDIAGQFDPMPDAECLKIMCEILSGLQLGDFLIKVNDRRIVDGMFAVCGVPESKFRAICSSIDKLDKMAWKDGDYVQCHGGVSLVEQMFQDPRLSQNKQALEGLGDLKLLFEYLTLFGIKISFDLSLARGLDYYTGVIYEAVLLQTPTQANVGSVAAGGRYDGLVGMFDPKKVPCVGLSIGVERIFYIVEQRMKTKGETTETQVFVATPQKNFLQERLKLIAELWDSGIKAEMLYNNPKLLTQLHYCESTGIPLVVIIGEQELKEGVIKIRSVASREEVAIKRENFVAEIQK 501
3 -69.800[E] COG3705 ATP phosphoribosyltransferase involved in histidine biosynthesis  ali follow..  13  4.WQLPEHIADVLPTNARQLESAREQLLALFRVHGYELVQPPLMEYAHSLLTHIDA--GLSLKTILVTDRLSGRQLGIRADITPQVARIDAHL--LSANQGINRLCYAGPVLHAQSDGLLNMREPLQAGAEMYGFADIRGDIELIDLMLKSMKIADMGKVLLSLGHIGIFRALSDAAHLDAGQSATLLALMQDKDEAQVKAWKLDGMWAKAFSLLPRLYGGREVLSDARGGALGELQAVCDAFPDCEI--HIDLSELRVDNYHTGLLYAAYAADFH-----DAVARGGRYDGLGGYFG-RARPATGFSFDLRSFIGRLPAIE------RQPAVLVDAEDAE---AAHEAVEALREQGQCVVIDYIGHNVSEELAGRLKKTDGVWQVVKR................................ 383
4 -30.600[J] KOG2324 Prolyl-tRNA synthetase  ali follow..  15  37IQPSMPGIFQYLPLGLRVQNKICDLLHISMRSLGASAISLAHLSSKEIWEKS--GRWQKTGSELFRLHDRNDREMCLAP-THEEDVTRTMATIIDSQKQLPIRVYQIGRKFRDERPRGGRGREFMMKDLYTFDIDKASAMKTVLQAYHTFFKEVGLPFVMVKAAT-GNIGGNLSHEFHYRHPVGEDVIYTCPSCHYSTNSEMLDLSKTSSDISCPNCNDQLTSTTAIE-----------------------------GHAFYLGKIYSSKFNATVEVKNKQEVLHMGCY-----------------GIGVSRLIAAVAHV-VWPSSIAPWKVLVVPTSDNHIQSAETVYDATANVDNVLLEDRQNRAFGYKMRDAELIGYPFVIVVGSRFQEEGICEIIVRSSGERYKLDKDSLHQVLLG 422
5 -27.200[J] COG0442 Prolyl-tRNA synthetase  ali follow..  17  32IRKLASGLYTWLPTGVRVLKKVENIVREEMNNAGAIEVSMPVVQPADLWQES--GRWEQYGPELLRFVDRGERPFVLGPTHEEVITD-LIRGEINSYKQLPLNFFQIQTKFRDERPRFGRAREFLMKDAYSFHTTQESLQEAMYTAYSKIFSRMDLNFRAVLADT-GSIGGSASHEFQVLAESGEDDIVFSTGSDYAANIEFAEALAPTEPRAPATAKTIAELVEQFKLPIEKTVKTLLVHAHELSLPVIADHSVAVMSDFGAGA-LRNVVEGDISPDGKGTL--GTKYSEVQGEDGRNQVMTMGYGIGVSRVVAAAIEQNIWPDAIAPFQVAILPMNFRVKELAEELYTTLRSHGIDVILDDRKERPGVMFADMELIGVPHNIVIGDRNLDSEEVEYKNRRVGEKQMIKTSEIVEFLLS 568
6 -22.700[J] KOG4163 Prolyl-tRNA synthetase  ali follow..  12  212..YDVSGCYILRPPSYAIWENIQKWFDDKIKAIGVQNAYFPMFVSSRVLEKEKDH--EGFAPEVAWVTRAGEEPIAIRP-TSETVMYPYYAKWVQSYRDLPLKLNQWNSVVRWEKHPQPRTREFLWQEGHTAHLTAKDAELQILDFYAGVYEELLAVPVVKGRKTEKEKFAGGDFTTTCEGYIPQTGRGIQGATSHHLGQN---------------------------------------FSKMFNLSVENPLGSDHPKIFAYQNSWGLSTRVIGV---------------MVMIHSDNK--GLVIPPRVSQFQSVVIPVGITKKTSEEQR-------KHIHETARSVESRLKKVGIRAFGD-DNYTPGWKFSQYELKGIPIRIELGPKDIEKNQVVVVRRNDSKKYVVSFDELEARIPE 575
7 -20.400[J] COG0441 Threonyl-tRNA synthetase  ali follow..  17  261.....PGMVFWHNDGWTIFRELEVFVRSKLKEYQYQEVKGPFMMDRVLWEKT--GHWDNYKDAMFTTSSE-NREYCIKPMNCPGHVQIF-NQGLKSYRDLPLRMAEFGSCHRNEPSGS-RVRGFTQDDAHIFCTEEQIRDNGCIRLVYDMYSTFGFEKIVVKLSTR----------------------------------------PEKRIGSDEMWDRAE--------------ADLAVALEENNIPFEYQLG------FYGPKIEFTLYDCLDRAWQCGTV----RLSSYVGEDNERKVPVMAILGSMERFIGILTEEGFFPTWLAPVQVVIMNITDSQSEYVNELTQKLSNAGIRVKADLRNEKIGFKIREHTLRRVPYMLVCGDKEVESGKIAVRTRRGKDLGSMDVNEVIEKLQQ 630
8 -19.600[J] COG0423 Glycyl-tRNA synthetase (class II)  ali follow..  13  31IYGGISGLYDYGPPGSALQSNLVDIWRKHFIEESMLEVDCSMLTPHEVLKTSVDKFADWMCKDMFETQPSGGLKGYLRPETAQGQFLNFSRLLEFNNGKVPFASAMVGKAFRNESPRSGRVREFLMAEVEHFVDPKNKEHDRFMARISLFLEKIGIDMNRVRFRQHMSNEMAHYACDCWDAEIQCSYGWIECVGCADRSAYDLSVHSKATKTPLVVQEA-------LPEPVVVEQFEVEVNRKKFGPRFKRDAKAVEEAMISWPESEKVEKSAQLVAEGKIIVNVNGVEHTVESDLIRTYTPNVI-SFGLGRILYVLMEHAYWTRPEDKALIVPLSRNAEFAPFVKKLSAKLRNLGISNKIDDSNANIGRRYARNDELGTPFGLTVDFETLQNETITLRERDSTKQVRGSQDEVIAALVS 629
9 -19.000[J] KOG1637 Threonyl-tRNA synthetase  ali follow..  16  306..ELSPGSCFFQPRGAHIYNTLMGFIKAEYRKRGFQEVISPNIYNAKLWMTS-----QHYAENMFSF-EAEKEKFALKP-MNCPGHCLIFDNRNRSWRELPLRMADFGVLHRNELSGA-RVRRFQQDDAHIFCAPEQIKSKGCLEFLKYVYTIFGFS-------------------------------------QLVLSTRPDNYLGELEQWNDA--------------------KALAESLNEFGMPWKENPG------FYGPKIDITIMDALKRAHQCATI----RFNSYIADDGEKKRPVIAILGSVERMIAILTENGKWPFWLSPRQVMVVPVGPAYDQYAQSVRDQLHDAGFMSEADCDGDTMNKKIRNAQLAQFNFILVVGDKERSSNTVNVRTRDNKVHGEVSVAELITKLQK 678
10 -15.300[J] KOG2298 Glycyl-tRNA synthetase and related class II tRNA synthetase  ali follow..  11  86IYGGVSGLYDFGPVGCALKNNIIQTWRQFIQEEQILEIDCTMLTPEPVLKTSVDKFADFMESVLAQLDNYGQQELALRPETAQGIFLNFKRLLEFNQGKLPFAAAQIGNSFRNESPRSGRVREFTMAEIEHFVDPSEKDHPKFQNVADLHLYLYSIGRIYLYLTKVGISPDKLRFRQHMENEMAHYACD-CWDAESKTSYGWIEIVGCADRSCYDLSCHARATKVPLVAEKPLKEPKTVNVVQFEPSKGAIGKAYKKDDECYITEMEMLLNEKGEFTIETEGKTFQLTKDFQKTLYVEEVVPNV--SFGLGRIMYTVFEHTFHVREGDKCSVLPLSQNQEFMPFVKELSEALTRHGVSHKVDDSSGSIGRRYARTDEIGVAFGVTIDFDTVNKTTATLRDRDSMRQIRAEISELPSIVQD 654
11 -12.600[J] COG2269 Truncated, possibly inactive, lysyl-tRNA synthetase (class II)  ali follow..  13  38.............SQLKQRATLLRQIREFFAERNVLEVETPAMSHAT----VTDIHLHTFKTEFVGPGYAKGSALHLMTSPEFHMKRLLAAG----------CIYQLGKAFRNEENGRYHNPEFTMLEWYRIGFDHHALMDEMDALLQLVLRCGSAERMTYQFLNVLGVCPLEEEMRELKQVAATLGLSDIAEPEEDRDTLLQLLFSIGIEPKIGFVYDFPASQAALAKINPADPRVADRF-------YFKGIELANGFHELDNPAEQLARFKADNAKRLEMGLTEQPIDHLIAALEAGLPECAGVALGIDRLIMLALGED................................................................................................... 336
12 -11.900[J] KOG0556 Aspartyl-tRNA synthetase  ali follow..  11  254...............FDIQAGICQAFREFLLSNSFNEIHTPKMSGASSEGGSNVFKIQYFKTDGF---------LSQSPQL---YKQMLIAADRE-------RVFEIGPVFRAEDSNTYRH-EFTGLDLEMAFNEH-----EVMEFIEKLFLYI-VAVVRQQYPSEDFILPDADRIRFHFKDAVKLLKEAGYRKQLVPGQKVPEDEEFHYCEDPEFDDFSTPEERALGQIVREKYHTDFYVIDKYPSSVR-DPRYSNSYDFFMK---EIMSELLVERMKALGVSPDVGLQQYIDAFAIGCPPHAGGGIGLERVVMFY....................................................................................................... 559
13 -11.400[J] KOG0554 Asparaginyl-tRNA synthetase (mitochondrial)  ali follow..  13  228...............ARVRNTLAYATHKFFQESGFVWVASPIITASEQFCGLIDWSQDFFGKPAF---------LTVSGQLNGETYATALS-----------DVYTFGPTFRAENSNTSRHAEFWMIEPELAFAD------DDMACATAYLQYV-LDNCKEDMEFFDTWIEKGIIRRLSDVAEKEFLQLGYTDAIEILLKANKKFDFPVKWGLDLQSEHERYITEEAFGGRPVIIRDYPKEIKAFYMRENDDGKTVAAMDMLVPRIGE--------------LIGGSRLEVLEARLDELKLPHAGFGLGFERLVQFV....................................................................................................... 546
14 -11.200[J] COG0017 Aspartyl/asparaginyl-tRNA synthetases  ali follow..  12  130...............MKIRNEVIRATYEFFNKDGFTKVDPPILTASAPEGTSELFHTKYFDQDAF---------LSQSGQLYLEAAAMAHG-----------KVFSFGPTFRAEKSKTRRHIEFWMIEGEMAFTN------ESLEIQEQYVTHV-----------VKSVLENCKLELKILERDTSKLEKVATPFPRISYDDAIEFLKAEGFDDIEWGEDFGAPHETAIANHYDLPVFITNYPTKIKPFYMQNEETVLCADLI-------------APEGYGEIIGGSEYSYYLDLRRYGSVPHCGFGLGLERTVAWI....................................................................................................... 409
15 -10.600[J] KOG2411 Aspartyl-tRNA synthetase, mitochondrial  ali follow..  11  1...........MQYNLRLRSQMVMKMREYLNLHGFVDIETPTLF----------KRTPGGAKEFLVPSREPGKFCSL-PQSPQQFKQLLMVGGLD-------RYFQVARCYRDEGSRPDRQPEFTQIDIEMYGTDKPDTRFGMIIDISDVFRNTEIGFLQDALSKPHGTVKAICIPEGAKYLKRKDIESIRNFAADHFNQEILPVFLNANRNWNSPVANFIMESQR-HNKACSLLGKLRLECADLLETRGVVLRDPTLFSFLWVVDFPLFLPKEESPRELESAIGGGMLSHLLQALDYGAPPHGGIALGLDRLICLV------TGSPSIRDVIAFPKSFRGHDLMSNT-EELKPYHIRVSKPTDSKAERAH................................................. 463
16 -10.400[J] KOG0555 Asparaginyl-tRNA synthetase  ali follow..  10  242...............LRIRAAATRAMRDHFFAAGYTEVAPPTLVQTQVEGGSTLFGLDYYGEPAY---------LTQSSQLYLETCNAALG-----------DVYCISQSYRAEKSRTRRHSEYQHVEAECAFIT------QLMDRIEALVCDT-------RLLADPVTKSLIEFVNPGYKAPARPFKRMP---KEAIEWLQKNDVRNEMGEKFVYGEDIAEAAERRMTDTIGVPILLNRFPHGIKAFYMPDNELTESVDLLMPGVGEIVGGSMKEDQLLAAFEKGGNYYWYMDQRKYGSVPHGGYGLGLERFICWL....................................................................................................... 524
17 -9.850[J] KOG2783 Phenylalanyl-tRNA synthetase  ali follow..  10  42........RNLFQKEGHPICSLRQLLEQQFQKFEMNNVQKSPIVSVETNFDSLGFPKTHVSRSKSD-----NNKTCLRTHTSAHQPEEFSRL--AKEGFKKNGFLITADVYRRDEVDSSHYPIFHQ--MEGALVWNRNDTAKMKNDLKKVALSPSLKSMVDDETT--------------------------------------ALETHNDMQDIYSLEETKFVSQHLKDTLTTVIHDLVSLAPS--ISSGAEQVRYRWTYDSFPFTKPSFQLEIDWKGKWLEILGCGVQDRLLKGAGLNNYIGWAFGIGLERLAMILYGIPDIRLFWSLDERFSKQFLPNKISTFKPFSK--KDIAFWINNDFNPNDFYEIIRDVCQDMVESVNLIDQYTAKSGKVNYRSMERNEEIDKLQEKLRNRVAN 422
18 -9.090[J] COG0173 Aspartyl-tRNA synthetase  ali follow..  132........RPVMQRNLRLRYQVAMGVRRYLDAQGFIDIETPMLTRS---------TPEGARDYLVPSRVHPGEFFAL-PQSPQLFKQLLMVAGFD-------RYYQITKCFRDEDLRADRQPEFTQIDLET----SFLNEDEIMDITEGMAKQV----FKDALNVDLGDFPRMPYSEAMFYYGSDKPDPIVKYLSENALKEIIARTGAQNGDIIFFGADKAKVVNEAIGALRIKVGLEHGKDNGYAVHHPFTAPKEGHEDLMVSDPANCLARAYDMVLNGWEIGGGSKFGFLLDNLKFGAPPHGGLAFGLDRLVTLM------TGAESIRDVIAFPKTQRAQCLLTNAPNSVDDKQLR.............................................................. 586
19 -9.070[J] KOG2784 Phenylalanyl-tRNA synthetase, beta subunit  ali follow..  15  286.....................VRSEFRQIFFSMGFSEMATPARDAHDTFFVSDPAISTKFPEDYYDWKIEEAQKNVLRTHTTAVSARQL--YQLAQEGFRPSKLFSIDRVFRNETLDATHLAEFHQ--VEGVIAEKNLSLAHLIGIFTEFFKKLGITNLRFK-------------------------------------------------------------------------------------------------TYYTEPSMEIFAYHQGLTKWVEIGNSGMFRPEMLLPMGPADVNVAGYGLSLERPTMIK....................................................................................................... 523

FFAS is supported by the NIH grant R01-GM087218-01
1 2 9 7 3 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Plewczynski D, Tkacz A, Wyrwicz LS, Godzik A, Kloczkowski A, Rychlewski L. Support-vector-machine classification of linear functional motifs in proteins. J Mol Model 2006 Aug;12(4):453-61. Epub 2005 Dec 10.