current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 3hrk_A mol:protein length:456 Histidyl-tRNA synthetase, from PDB1018

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450
# Score Template Links and tools%idFirst MAMGTLEAQTQGPGSMQKNMVETEPVQGCRDFPPEAMRCRRHLFDVFHATAKTFGFEEYDAPVLESEELYIRKAGEEITEQMFNFITKGGHRVALRPEMTPSLARLLLGKGRSLLLPAKWYSIPQCWRYEAITRGRRREHYQWNMDIVGVKSVSAEVELVCAACWAMRSLGLSSKDVGIKVNSRKVLQTVVEQAGVTSDKFAPVCVIVDKMEKIPREEVEAQLAVLGLEPTVVDAITTTLSLKSIDEIAQRVGEEHEAVKELRQFFEQVEAYGYGDWVLFDASVVRGLAYYTGIVFEGFDREGKFRALCGGGRYDNLLTTYGSPTPIPCAGFGFGDCVIVELLQEKRLLPDIPHVVDDVVIPFDESMRPHALAVLRRLRDAGRSADIILDKKKVVQAFNYADRVGAVRAVLVAPEEWERGEVQVKMLREGTGKEEGGAERGFAVPLDRLVLast
1 -110.000[J] COG0124 Histidyl-tRNA synthetase  ali follow..  21  1....................MAIQIPRGTQDILPGDVETWQWIEQKAYDLCRRYNYQEIRVPMFEHTELFLRGVGDTVQKEMYTFEDRGGRSLTLRPEGTASVTRAYVSNKLQANQPTKLFYIGPMFRYERPQSGRMRQFVQFGVEALGSADPAIDAEVLALVMRFYEELGLK--NLKLVINSLGDTDSRLAHREALVNHFKPRIHEFCNDCQ-------DRLEKNPLRILDCKKDRDHELMGTAPSIHDYLST--ESKAYFEKVQSYLTALNIP--FVVDATLVRGLDYYNHTAFEVMVDGGAITTLCGGGRYNGLVEEIGGP-ETPGIGFALSIERAIMALEAQQAKPAHNQAIDCYVVTLGEAAKDKGVELVYQLRNAGISAEKDYLDRKMKGQLKAADRLHAKWTVILGEDELAVGKVNVKNMETGEQTDVALTDLVSHMKQ.... 420
2 -103.000[J] KOG1936 Histidyl-tRNA synthetase  ali follow..  23  37..VAEAVLTSQLKAHQEKPNFIIKTPKGTRDLSPQHMVVREKILDLVISCFKRHGAKGMDTPAFELKETLTEKYGED-SGLMYDLKDQGGELLSLRYDLTVPFARYLAMNK---VKKMKRYHVGKVWRRESPTQGRYREFCQCDFDIAGQFDPMPDAECLKIMCEILSGLQLG--DFLIKVNDRRIVDGMFAVCGVPESKFRAICSSIDKLDKMAWKDVRHEMVKKGLAPEVADRIGDYVQCHGGVSLVEQMFQDPEGLGDLKLLFEYLTLFGIADKISFDLSLARGLDYYTGVIYEAVLLQLNVGSVAAGGRYDGLVGMFDPKHKVPCVGLSIGVERIFYIVEQRMKTKGRTTETQVFVATPQKNFLQERLKLIAELWDSGIKAEMLYNNPKLLTQLHYCESTGIPLVVIIGEQELKEGVIKIRSVASREEVAIKRENFVAEIQK.... 501
3 -74.800[E] COG3705 ATP phosphoribosyltransferase involved in histidine biosynthesis  ali follow..  16  1...................MQTWQLPEHIADVLPTNARQLESAREQLLALFRVHGYELVQPPLMEYAHSLLTHIDAGLLKTILVTDRLSGRQLGIRADITPQVARIDAHLLSANQGINRLCYAGPVLHAQSDGLLNMREPLQAGAEMYGFADIRGDIELIDLMLKSMKIADMG--KVLLSLGHIGIFRALSDAAHLDAGQSATLLALMQDKDT---ETVEAQVKAWKLDGMWAKAFSLLPRLYGGREVLSDASAVGGALGELQAVCDAFPDCEI----HIDLSELRVDNYHTGLLYAAYAA-DFHDAVARGGRYDGLGGYFG--RARPATGFSFDLRSFIGRLPAIE------RQPAVLVDAEDAE---AAHEAVEALREQGQCVVIDYGGHNVSEELAGRLKKTDGVWQVVKR.................................... 383
4 -30.800[J] KOG2324 Prolyl-tRNA synthetase  ali follow..  12  17.AIRKYNVPESANQLLIDMGFIQPSMPGIFQYLPLGLRVQNKICDLLHISMRSLGASAISLAHLSSKEIWEKS--QKTGSELFRLHDRNDREMCLAPTHEEDVTRTMATIIDSQKLPIRVYQIGRKFRDERPRGGRGREFMMKDLYTFDIDKASAMKTVLQAYHTFFKEVGLPFVMVKAATGNIG-------------GNLSHEFHYRHPVG----EDVIYTCPSCHYSTNSEMLDLSKTSSDISCPNCNDQLTSTTAIE-------------------------------VGHAFYL------------GKIYSSKFNATVEVKNKQEV-YGIGVSRLIAAVAHV-VWPSSIAPWKVLVVPTSDNHIQSAETVYDATANVDNVLLEDRQNRAFGYKMRDAELIGYPFVIVVGSRFQEEGICEIIVRSSGERYKLDKDSLHQVLLGNFL. 425
5 -28.400[J] COG0442 Prolyl-tRNA synthetase  ali follow..  15  11QKETPADAEVISHQLMLRAGMIRKLASGLYTWLPTGVRVLKKVENIVREEMNNAGAIEVSMPVVQPADLWQES--EQYGPELLRFVDRGERPFVLGPEVITDLIRGEINSYKQL--PLNFFQIQTKFRDERPRFGRAREFLMKDAYSFHTTQESLQEAMYTAYSKIFSRMDLNFRAVLADTGSIGVALLVRGDHDLNEIKAEKLPQVAKPLTFASEEEIRAAIGAGPGSLGPVNLSLPVIADHSVAVMSDFGAGANIDGKHYFGILRNVVEGDISPDGKGTLQIKRGIE--VGHIFQL------------GTKYSEVMKA-DGRNQVMTMGYGIGVSRVVAAAIEQNIWPDAIAPFQVAILPMNFRVKELAEELYTTLRSHGIDVILDDRKERPGVMFADMELIGVPHNIVIGDRNLDSEEVEYKNRRVGEKQMIKTSEIVEFLLS.... 568
6 -23.300[J] KOG4163 Prolyl-tRNA synthetase  ali follow..  13  204...............TKGEMLDYYDVSGCYILRPPSYAIWENIQKWFDDKIKAIGVQNAYFPMFVSSRVLEKEKDEGFAPEVAWVTRAGEEPIAIRPTSETVMYPYYAKWVQSYRLPLKLNQWNSVVRWEKHPQPRTREFLWQEGHTAHLTAKDAE-EEVLQILDFYAGV--------------------------------------------------------------YEELLAVPVVKGRKTEKEKFAGGDFTTTCEGYIPQTGRGIQGATSHHLGQNFSKNLSVENPLGSDHPKIFAYQNSWGLSTRV--MVMIHSDNK-----GLVI---------------PPRVSQFQSVVIPVGKHIHETARSVESRLKKVGIRAFGD-DNYTPGWKFSQYELKGIPIRIELGPKDIEKNQVVVVRRNDSKKYVVSFDELEARIPE.... 575
7 -20.400[J] COG0441 Threonyl-tRNA synthetase  ali follow..  14  261..........................PGMVFWHNDGWTIFRELEVFVRSKLKEYQYQEVKGPFMMDRVLWEKTGHWDNYKDAMFTTSSENREYCIKPMNCPGHVQIFNQGLKSYRLPLRMAEFGSCHRNEPSGS-RVRGFTQDDAHIFCTEEQIRDNGCIRLVYDMYSTFGFEKIVVKLSTRPEKRIGS-------------------DEMWDRAEADLAVALEENNIPFEYQLGEGAFYGPKIEFTLYDCLDRAWQC-----------------GTVQLDFSLPSRLSAYVGEDNERKVPVMIHRAILG------------------------SMERFIGILTEEGFFPTWLAPVQVVIMNITDSQSEYVNELTQKLSNAGIRVKADLRNEKIGFKIREHTLRRVPYMLVCGDKEVESGKIAVRTRRGKDLGSMDVNEVIEKLQQE... 631
8 -18.700[J] KOG1637 Threonyl-tRNA synthetase  ali follow..  16  306.......................ELSPGSCFFQPRGAHIYNTLMGFIKAEYRKRGFQEVISPNIYNAKLWMTSGHWQHYAENMFSFEAEKEKFALKPMNCPGHCLIFDNRNRSWELPLRMADFGVLHRNELSGA-RVRRFQQDDAHIFCAPEQIKSKGCLEFLKYVYTIFGF---SFQLVLSTR-------------PDNYLGELEQWNDAEK----ALAESLNEFGMPWKENPGDGAFYGPKIDITIMDALKRAHQC-----------------ATIQLDFQLPIRFNLYIADDGEKKRPVIIHRAILG------------------------SVERMIAILTENGKWPFWLSPRQVMVVPVGPAYDQYAQSVRDQLHDAGFMSEADCDGDTMNKKIRNAQLAQFNFILVVGDKERSSNTVNVRTRDNKVHGEVSVAELITKLQKI... 679
9 -18.300[J] COG0423 Glycyl-tRNA synthetase (class II)  ali follow..  12  10FDRTQFEELMKKRFFFSPSFQIYGGISGLYDYGPPGSALQSNLVDIWRKHFIEESMLEVDCSMLTPHEVLKTSLGELMKKYDIRNPATNGELETPRQGQFLNFSRLLEFNNGKV--PFASAMVGKAFRNESPRSGRVREFLMAEVEHFVDPKNKEHDRFMARISLFLEKIGIDMNRVRFRQHMSNEMAHYACDCWDAEIQCSYGWIECVGCADRSAYDLSVHSKATKTPLVVQEALPEPVVVEQFEVEVNRKKFGPRFKRDAKAVEEAMISWPESEKVEKSAQLVAEGKIIVNVNGVEHTVESDLVT------IEKRKHTEHIRTYTPNVI-SFGLGRILYVLMEHAYWTRPEDKALIVPLSRNAEFAPFVKKLSAKLRNLGISNKIDDSNANIGRRYARNDELGTPFGLTVDFETLQNETITLRERDSTKQVRGSQDEVIAALVS.... 629
10 -15.100[J] KOG2298 Glycyl-tRNA synthetase and related class II tRNA synthetase  ali follow..  11  90.........................VSGLYDFGPVGCALKNNIIQTWRQHFQEEQILEIDCTMLTPEPVLKTS--SEMESVLAQLDNYGQQELALRPETAQGIFLNFKREFNQGKLPFAAAQIGNSFRNESPRSGRVREFTMAEIEHFVDPSEKDHPKFIGRIYLYLTKVGISPDKLRFRQHMENEMAHYACDCWDAESKTSYGWIEIVGCADRSCYDLSCHARATKVPLVAEKPLKEPKTVNVVQFEPSKGAIGKAYKKDAKLVMEYLAIC---------------DECYITEMEMLLNEKGEFTIETEG-NVKRFQKTLYVEEVVPNV--SFGLGRIMYTVFEHTFHVREGDEQRTFFLSQNQEFMPFVKELSEALTRHGVSHKVDDSSGSIGRRYARTDEIGVAFGVTIDFDTVNKTTATLRDRDSMRQIRAEISELPSIVQD.... 654
11 -13.600[J] COG2269 Truncated, possibly inactive, lysyl-tRNA synthetase (class II)  ali follow..  11  4LSLAFCSERVQFVISVSCDEPPMTNSDWMPTASISQLKQRATLLRQIREFFAERNVLEVETPAMSHAT--TDIHLHTFKTEFVGPGYAKGSALHLMTSPEFHMKRLLAAGSG------CIYQLGKAFRNEENGRYHNPEFTMLEWYRIGFDHHALMDEMDALLQLVLRCGSAERMTYQEAFLNVLGVCPLEEEMRELKQVAATLGLSDIAEPEEDRDTLLQLLFSIGIEPKIGQITPAFVY-ASQAALAKINPADPRVADRFEVYFKGIE-------------LANGFHELDNPAEQLARFKADNAKRLEMGL-YHLIAALEAGLP-ECAGVALGIDRLIMLALGEDHIDKV.................................................................................................. 341
12 -12.300[J] KOG2411 Aspartyl-tRNA synthetase, mitochondrial  ali follow..  12  1................................MQYNLRLRSQMVMKMREYLNLHGFVDIETPTL-------FKRTPGGAKEFLVPSREPGKFCSL-PQSPQQFKQLLMVGGLD-----RYFQVARCYRDEGSRPDRQPEFTQIDIEM----SFVDQTGIQSLIEGLLQYS-FRNTEIGFLQDALSKPHGTVKAICIPEGAKYLKRKDIESIRNFAADHFNQEILANFIMESQRLELIRLMETQEEDVVLLTAGEHNKACSLLGKLRLECADVVLRDPTLFSFLWVVDFPLFLSQHYDLVLNGNEI----GGGMLSHLLQALDYGAP-PHGGIALGLDRLICLVTGSPSIR------DVIAFPKSFRGHDLMSNTPEELKPYHIRVSKPTDSKAERAH..................................................... 463
13 -11.900[J] COG0173 Aspartyl-tRNA synthetase  ali follow..  15  111........QIDDENISENVRLTNRVIDLRRPVMQRNLRLRYQVAMGVRRYLDAQGFIDIETP------MLTRSTPEGARDYLVPSRVHPGEFFAL-PQSPQLFKQLLMVAGFD-----RYYQITKCFRDEDLRADRQPEFTQIDLET----SFLNEDEIMDITEGMAKQVFKDALNVDLGDFPRMPYSEAMFYYGSDKPDMRINLKFTELTDLMKTEEFKQSPIVKYLSENALKEIIARTGAQNGDIIFFGADKAKVVNEAIGALRIKVGLEHGKDNGYFTDEVLNGWEIGGGSVFAALKISPEEQQ----EKFGFLLDNLKFGAP-PHGGLAFGLDRLVTLMTGAESIR------DVIAFPKTQRAQCLLTNAPNSVDDKQLR.................................................................. 586
14 -11.700[J] COG0017 Aspartyl/asparaginyl-tRNA synthetases  ali follow..  14  130....................................MKIRNEVIRATYEFFNKDGFTKVDPPILTASAP-------EGTSELFHT-KYFDQDAFLSQSGQLYLEAAAMAHG-------KVFSFGPTFRAEKSKTRRHIEFWMIEGEMAFTN------ESLEIQEQYVTHV-------------KSVLENCKLELKILERDTSKLEKVATPFPRISYDDAIEFLKAEGFDDIEWGEDFGAPHETAIANHYDLPVFITNYPTKIKPFYMQPNPENEETVLCADLIAPEGYGEIIGGSERVDDLELLEQRVKEHGLDEEAYSYYLDLRRVPHCGFGLGLERTVAWISGVEHVRET.................................................................................................. 418
15 -11.000[J] KOG0556 Aspartyl-tRNA synthetase  ali follow..  10  254....................................FDIQAGICQAFREFLLSNSFNEIHTPKMSGAS---SEGGSNVFKIQY------KTDGFLSQSPQLYKQMLIAAD--------RVFEIGPVFRAEDSNTYRH-EFTGLDLEMAFNEHYH---EVMEFIEKLFLYI-------------KTIREKYAKQVAVVRQQYPSEDFILPDADRFHFKDAVKLLKEAGYRKQLVPGQKVPEDEEFHYCEDPEFDDFSTPEE--RALGQIVREKYHTDFYVIDKYPSSVRPFYTMP-YDFFMKGQE---IMSGAQPELLVERMKALG-PPHAGGGIGLERVVMFYLNLPNIRLA.................................................................................................. 568
16 -10.800[J] KOG0554 Asparaginyl-tRNA synthetase (mitochondrial)  ali follow..  12  192VGECDSSYPIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNTLAYATHKFFQESGFVWVASPIITASEQFCDAIPKTKGGLIDWSQDFFGKPAFLT--VSGQLNGETYATALS-----DVYTFGPTFRAENSNTSRHAEFWMIEPELAFAD------DDMACATAYLQYV------VKYVLDNCKEDMEFFDTWIEKGIIRRLSDVAEKEFLQLGYTDAIEILLKANKKFDFPVKWGLDLQSEHERYITEEAFGGRPVIKEIKAFYMREND---------DGKTVAAMDMLV----------PRIGELIGGSRLEVLEARLDELKLVPHAGFGLGFERLVQFVTGIDNIRDV.................................................................................................. 555
17 -10.300[J] KOG0555 Asparaginyl-tRNA synthetase  ali follow..  13  242....................................LRIRAAATRAMRDHFFAAGYTEVAPPTLVQTQV-------EGGSTLFGLDYYGEPALTQSSQLYLETCNAALG---------DVYCISQSYRAEKSRTRRH-EYQHVEAECAFIT------QLMDRIEALVCDT-------------VDRLLADPVTKSLIEFVNPGYKAPARPFKRMPYKEAIEWLQKNDVRNEMGEKFVYGEDIAEAERRMTDTIGVPILLNRFPHGIKAFYMPRCAD----DNELTESVDLLMPGVGE----------IVGGSKEDQLLAAFEKGG-VPHGGYGLGLERFICWLTDTNHIRDV.................................................................................................. 533
18 -10.200[J] COG1190 Lysyl-tRNA synthetase (class II)  ali follow..  12  182..................................HTFKVRSQVMSGIRSFMVEKGFMEVETPMMQVI------PGGASARPFVTHHNALDIDMYLRIAPELYLKRLVVGG--------RVFEINRNFRNEGVSPRHNPEFTMMELDLIVLTEELFRTLTETILGSSVVQYGEQTFDFGKPFAKLTMKEAICKYRPETNVADLDDMDKAVAIAEVEKSWGLGRIQCEIFEETAESHLIQPTFITEYPAEVSPLARRNDDNPFITDRFEF---------FIGGREIGNGFSELNDAEDQAQRFADQVSAKEAGDD-EDYITALEHGLP-PTAGLGIGIDRMVMLFTNSHTIRD................................................................................................... 494
19 -9.660[J] COG2024 Phenylalanyl-tRNA synthetase alpha subunit (archaeal type)  ali follow..  14  122........................................EVDSKPLQEIFHRYKKGEIDGDDLSYLIAEVLDVDDITAVKEFKELKPISSTLTLRSHMTTGWFITLSHIADKLPLPIKLFSIDRCFRREQGDATRLYTYFSASCVLVDEELSVDD--GKAVAEALLRQFGFENFRFRIEIATFGIYSPTA-NLGLGVERLAMILYGYDDVRKMVYPQIHGEIKLSDLDIAREIKVKEVPQTAVGLKIAQSIVETAEKHASEPSPCSFLAFEGEMMGRNVRVYVV---------------EEEENTKLCGPAYANEVVVYKGDIYGIPK-GVPTGIRYIDGFAYYAARKVEE-------AAMREQEEVKVKARIVENLSDINLYIH-ENVRRYILWKKGKIDVRGPLFVTVKAEIE.................................. 534
20 -9.590[J] KOG2784 Phenylalanyl-tRNA synthetase, beta subunit  ali follow..  16  286..........................................VRSEFRQIFFSMGFSEMATPARDAHDTFSTKFPEDYLERVKTVHSKGAQKNVLRTHTTAVSARQLYQLAQEGFRPSKLFSIDRVFRNETLDATHLAEFHQ--VEGVIAEKNLSLAHLIGIFTEFFKKLGITNLRFK--------------------------------------------------------------------------------------------------------------TYYTEPSMEIFAYHQGLTKIGNSGMFREMLLPMGLPADVNVAGYGLSLERPTMIK........................................................................................................... 523
21 -9.470[J] KOG2783 Phenylalanyl-tRNA synthetase  ali follow..  42.............................RNLFQKEGHPICSLRQLLEQQFQKFEMNNVQKSVETNFDSLGFPKTHVSRSKSDTY----NNKTCLRTHTSAHQPEEFSRLAKEGFKKNGFLITADVYRRDEVDSSHYPIFHQ--MEGALVWNRNDTAKMKNDLKKVALSPSLKSMVDDETTA----------LETHNDMQDIYSLEETKFVSQHLKDTLTTVIHDLVSLAPSISSGAEQVRYRWTYDSFPFTKPSFQL----------------------------------------IDWKGKWLEILGCGVVQDRLLKGAGLNNYIGWAFGIGLERLAMILYGIPDIRLFWSLDERFSKQFLPNKISTFKPFSK--KDIAFWINNDFNPNDFYEIIRDVCQDMVESVNLIDQYTAKSGKTSLRSL-RNEEIDKLQEKLRNRVANS... 423
22 -9.100[J] KOG1885 Lysyl-tRNA synthetase (class II)  ali follow..  12  242..................................QKFIIRSKIITYIRSFLDELGFLEIETPMMNII------PGGAVAKPFITYHNELDMNLYMRIAPELYHKMLVVGG--------RVYEIGRQFRNEGIDLTHNPEFTTCEFHITGSYDFTPPFRRINMVEELEKALGMKLPETN-TEETRKILDDICVAKAVECPPPRTTARLLDKLVGEFLEIMSPLAKWHRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAK-AKAAGDDEAMFIDENFCTALEY-------------------------------------PTAGWGMGIDRVAMFLTDSNNIKE................................................................................................... 566

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 7 0 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Osterman A, Overbeek R, Godzik A. Automatic detection of subsystem/pathway variants in genome analysis. Bioinformatics. 2005 Jun 1;21 Suppl 1:i478-i486.