current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 4gla_C mol:protein length:109 OBody NL8, from PDB1018

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .
# Score Template Links and tools%idFirst GSVYPKKTHWTAEITPNLHGTEVVVAGWVASLGDYGRVKIVKVSDREGGAAVPVYLEAGKTPDHLFKVFAELSREDVVVIKGIVEASKGVGRGVEIFPSEIWILNKAKALast
1 -37.900[J] COG0173 Aspartyl-tRNA synthetase  ali follow..  27  2......RTNYCGLISEQYLDQTVTVKGWVHRRRDHGGVIFIDLRDREGIVQVVIDPDT----PEAFAAADSSRNEYVLSITGRVRNRPMISGKIEILAKEIEVLNAAAT 107
2 -35.600[J] COG0017 Aspartyl/asparaginyl-tRNA synthetases  ali follow..  16  9...............KDHLNQDVTIGAWLTNKRSSGKIAFLQLRDGTGFMQGVV--VKSEVDEEVFKLAKEIAQESSLYVTGTITEDNRSDLGYEMQVKSIEVISEAHD 100
3 -34.300[J] KOG0556 Aspartyl-tRNA synthetase  ali follow..  18  94.........QISDISAKNDGQTVLLRARVYTSRLQGKMCFFSLRQKYDTIQALAVVNKDTISKQMVKWCGSISLESIVLVEGIVKKSPEIIQDAEIHISSIYVISPIKK 199
4 -30.100[J] KOG0554 Asparaginyl-tRNA synthetase (mitochondrial)  ali follow..  17  89.....RKKLRIAEVKLSRVGQSLNIMGWVRTLRSQSSVTFIEINDGSCLSNLQCVMTSDAEGYDQ-VESGSILTGASVSVQGTIVASQGTKQKVELKVEKIIVVGECDS 197
5 -30.000[J] KOG0555 Asparaginyl-tRNA synthetase  ali follow..  20  117...............VQHRDQRVSIKAWVHRLRRQGKLMFLVLRDGYGFLQCVLNDKLCQS-----YDAVTLSTETSVQVYGIIKALPSAPDGHELTVDYWEVIGKAPA 209
6 -21.700[J] COG1190 Lysyl-tRNA synthetase (class II)  ali follow..  19  33GIAFPRRENLSDQLHAEFLNIDVTVAGRMMTRRIMGKASFVTLQDVGGRIQLYVSRDDLP-EGVYNEEFKKWDLGDILGARGKLFKTK--TGELSIHCSELRLLTKA.. 149
7 -20.200[J] KOG1885 Lysyl-tRNA synthetase (class II)  ali follow..  17  93.DPYPHKDISLTDFIQKYTDITLKVAGRIHAKRASGKLIFYDLRGEGVKLQVMANSRNYKSEEEFIHINNKLRRGDIIGVQGNPGKTK--KGELSIIPYEITLLSPC.. 209
8 -15.300[S] COG3111 Uncharacterized conserved protein  ali follow..  19  48.........TVESAKSLRDDTWVTLRGNIVERISDDLYVF---KDASGTINVDIDHKR-----------VTVTPKDTVEIQGEV---DKDWNSVEIDVKQIRKVNP... 130
9 -13.800[L] COG5235 Single-stranded DNA-binding replication protein A (RPA), medium (30 kD) subunit  ali follow..  15  67....................HHVCFVGVVRNITDHTANIFLTIEDGTGQIEVRKWSEDANDLAAG-QVAQQFEIGGYVKVFGALKE----GGKKNIQYAVIKPIDSFN. 161
10 -12.300[L] KOG3108 Single-stranded DNA-binding replication protein A (RPA), medium (30 kD) subunit  ali follow..  12  63....................RTIHTVGVILEKSYEDGKTTYTLHDPEDTAKIFAVQFGNYNDGGSKFVSPGLEEDTRVRLMGKLKN----AGNKMILIYYLQKLADNK. 148
11 -12.100[S] COG3390 Uncharacterized protein conserved in archaea  ali follow..  15  45....................NRIFIVGTLIEKEDIGTYWRGRVSDPTGSFLVYAGQYQ----PEAAQFLEECELPAFVAVIGKTSTTDDGNVLTSIRPESIQQVDELT. 133
12 -10.200[S] COG3689 Predicted membrane protein  ali follow..  159.ENYMEVMEAIYDYPDEFEGKTIQFTGFVYNDPSHANSQFL-----FRFGIIHCIADSGVYGLLTKGNTRQYENNTWITAKGKLVNHYHKELKQNLPTLEIDSFTKVDK 261
13 -9.000[S] COG3495 Uncharacterized protein conserved in bacteria  ali follow..  11  78...........AKTVASLDGKAIRLGGYPVPLENDAKTEFFLVPYPGACIHVPPPPPNQIVLVRYPQGLKLTDIYTPLWVSGTLKIEQVSND-YAIDKARVKVVEEAD. 181

FFAS is supported by the NIH grant R01-GM087218-01
1 2 9 7 3 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Plewczynski D, Tkacz A, Wyrwicz LS, Godzik A, Kloczkowski A, Rychlewski L. Support-vector-machine classification of linear functional motifs in proteins. J Mol Model 2006 Aug;12(4):453-61. Epub 2005 Dec 10.