current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 4q6g_A mol:protein length:267 Pyrrolysine--tRNA ligase, from PDB1018

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .
# Score Template Links and tools%idFirst PALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMVAPNIFNYARKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFFQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCSVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNLLast
1 -56.500[J] COG0016 Phenylalanyl-tRNA synthetase alpha subunit  ali follow..  15  55PVIGQLANDVREAIGKAIESKMEALEQAEIHRKLQEETIDVTLPGRPVLKGGAHPLTATITEVEDLFIGLGFSVAEGPQIETDYNFEALNLPKDHPARDMQDSFTDELLLRTQTSPVQARTMEKYKG--KGPIKIICPGKVFRRDDDDATHSHQFMQIEGLYVDHGVRMSDLKGVLQAFAKSFFGEERRLRPSFFPFTEPSVEVDGWIEILGAGMVHPRVLEMSGFNPNGFAFGMGVERLSMLKYGIDDIRHFYTNDRRF....... 337
2 -55.700[J] KOG2784 Phenylalanyl-tRNA synthetase, beta subunit  ali follow..  16  232....SKGTSFTTSLAKQEADLTPEMIASGSWKDMQFKKYNFDSLGVVPSSGHLHPLMKVRSEFRQIFFSMGFSEMTNRYVESSWNFDALFQPQQHPARDAHDTFAQKNVLRTHTTAVSARQLYQLAQEGFRPSKLFSIDRVFRNETLDATHLAEFHQVEGVIAEKNLSLAHLIGIFTEFFKKLGITNLRFKPTYNPYTEPSMEIFKWVEIGNSGMFRPEMLLPMGLPADVAGYGLSLERPTMIKYGINNIRDLFGSKIDL....... 539
3 -45.700[J] COG2024 Phenylalanyl-tRNA synthetase alpha subunit (archaeal type)  ali follow..  15  1..MKFDPQKYRELAEKDFEAAWKAGKEILAERSPNELYPRVG-----FSFGKEHPLFATIQRLREAYLSIGFSEVVNPLIVEDLIAEVLDVDDITAVKILDEVFSSTLTLRSHMTTGWFITLSHIADKLPLPIKLFSIDRCFRREQEDATRLYTYFSASCVLVDEELSVDDGKAVAEALLRQFGFENFRKDEKRSKYYIPDTQTEGWIEIATFGIYSPTALAEYDIPYPVMNLGLGVERLAMILYGYDDVRKMVYPQIHG....... 353
4 -37.600[J] KOG2783 Phenylalanyl-tRNA synthetase  ali follow..  11  7SHLSKLFSRRFPNWK---RKVQTDSWSNVPEHIHSKIGRNLF-------QKEGHPICSLRQLLEQQFQKFEMNNVQKPIVSVETNFDSLGFPKTHVSRSKSDTMNNKTCLRTHTSAHQPEEFSRLAKEGFKKNGFLITADVYRRDEVDSSHYPIFHQMEGALVWNRNDTAKMKNDLKKVALSPSLKSMVDDETTALETHNDMQDGKWLEILGCGVVQDRLLKGAGLNNIGWAFGIGLERLAMILYGIPDIRLFWSLDERF....... 323
5 -35.200[J] KOG1936 Histidyl-tRNA synthetase  ali follow..  13  25.....ASCTGAVRCQSQVAEAVLTSQLKAHQEKPNFIIKTPKGTRDLSPQHMV-VREKILDLVISCFKRHGAKGMDTPAFELKETLTEKYGEDSGLMYDLKDQGGELLSLRYDLTVPFARYLAMNK---VKKMKRYHVGKVWRRESPTQGRYREFCQCDFDIAGQFDPMAECLKIMCEILSGLQLDFLIKVNDRRIVDGMFAVCGVPESKFRAICSSIDKLDKMAWKD....................................... 249
6 -35.000[J] COG0124 Histidyl-tRNA synthetase  ali follow..  19  1...................................MAIQIPRGTQDILPGDVET-WQWIEQKAYDLCRRYNYQEIRVPMFEHTELFLRGVGDTTDIVQKEMYTFGRSLTLRPEGTASVTRAYVSNKGQANQPTKLFYIGPMFRYERPQSGRMRQFVQFGVEALGSADPAIDAEALVMRFYEELGLK................................................................................. 158
7 -32.900[E] COG3705 ATP phosphoribosyltransferase involved in histidine biosynthesis  ali follow..  10  5......................................QLPEHIADVLPTNARQ-LESAREQLLALFRVHGYELVQPPLMEYAHSLLTHIDAGLKTILVTDRLSGRQLGIRADITPQVARIDAHLLSANQGINRLCYAGPVLHAQSDGLLNMREPLQAGAEMYGFADIRGDIEDLMLKSMKIADMKVLLSLGHIGIFRALSDAAHLDAGQSATLLALMQDKDTETVEAQVKAWKLDFSLLPRLYGGREVLSDARGRLPDLSAVGGAL 243
8 -28.200[J] COG2269 Truncated, possibly inactive, lysyl-tRNA synthetase (class II)  ali follow..  16  14..........................QFVISVSCDEPPMTNSDWMPTASISQLKQRATLLRQIREFFAERNVLEVETPAMSHATVTDIHLHTFKTEFVGPGYAKGSALHLMTSPEFHMKRLLAAGSG------CIYQLGKAFRNEENGRYHNPEFTMLEWYRIGFDHHMDEMDALLQLVLAKINPADPRVADRFEVYFKGIELANGFHELDNPAEQLARFKADNAKRPECAGVALGIDRLIMLALGEDHIDKV.............. 341
9 -25.800[J] COG1190 Lysyl-tRNA synthetase (class II)  ali follow..  15  144............RLLTKALRPLPDKFHGLADQETRYRQRYLDLIANDESRHTFKVRSQVMSGIRSFMVEKGFMEVETPMMQVI-----PGGASARPFVTHHNALDIDMYLRIAPELYLKRLVVGGFE------RVFEINRNFRNEGVSPRHNPEFTMMELYMAYADYKIVLTEELFRTLTETILGSSVVQYGEQTFITDRFEFFIGGREIGNG-FADQVSAKEAGDDPPTAGLGIGIDRMVMLFTNSHTIRDV.............. 495
10 -24.600[J] KOG1885 Lysyl-tRNA synthetase (class II)  ali follow..  17  204............TLLSPCLHMLPHLHFGLKDKETRYRQRYLDLILNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNII-----PGGAVAKPFITYHNELDMNLYMRIAPELYHKMLVVGGID------RVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYAD--YHDLMEITEKMVSGMV-SKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKAKPPTAGWGMGIDRVAMFLTDSNNIKEV.............. 567
11 -24.200[J] KOG0554 Asparaginyl-tRNA synthetase (mitochondrial)  ali follow..  15  176QGTKQKVELKVEKIIVVGECDSSYPIQKKRVSREFLRTKAHLRPRTNTFGAVARVRNTLAYATHKFFQESGFVWVASPIITASD--DAIPKTKGGLIDWSQDFFGKPAFLT--VSGQLNGETYATALS-----DVYTFGPTFRAENSNTSHLAEFWMIEPELADLDDDMACATAYLQYVVKYVLDNCKEDMEFFDTYTDAIEILLK--ELIGGSQREERLEVRYGSVPHA-GFGLGFERLVQFVTGIDNIRDV.............. 555
12 -23.400[J] KOG0556 Aspartyl-tRNA synthetase  ali follow..  16  202PLVEDAGRSEEQIRESEENAAEGDSKFVRVNLDTRLDNRVLD-LRTPTNQAIFDIQAGICQAFREFLLSNSFNEIHTPKMSGAS-----SEGGSNVFK--IQYFKTDGFLS--QSPQLYKQMLIAAD------RVFEIGPVFRAEDSNTYHMTEFTGLDLEMAFNE-HYHEVMEFIEKLFLYI---YTMPDPEDPRYSNSYDFFMKGQEIMSGAQLLVERMKALGVSPPHAGGGIGLERVVMFYLNLPNIRLA.............. 568
13 -22.400[J] COG0173 Aspartyl-tRNA synthetase  ali follow..  14  100............EVLNAAATPPFQIDDENISENVRLTNRVID-LRRPVMQRNLRLRYQVAMGVRRYLDAQGFIDIETPML-----TRSTPEGARDYLVPSRVHPGEFFALP--QSPQLFKQLLMVAG------RYYQITKCFRDEDLRADRQPEFTQIDLETS---LNEDEIMDITEGMAKQV-----------------FKDALNVDLGDFPRMPYSEAMFYYGSDKPDMRINLKFTELTDLMKTEE................... 304
14 -21.900[J] KOG0555 Asparaginyl-tRNA synthetase  ali follow..  15  191PDGHELTVDYWEVIGKAPAGGIDNVLNESAGVDVMLDNRHLV-IRGENASRILRIRAAATRAMRDHFFAAGYTEVAPPTLVQTQVEGGSTL--------GLDYYGEPAYLT--QSSQLYLETCNAALG-----DVYCISQSYRAEKSRTRHLSEYQHVEAECITFDQLMDRIEALVCDTVDRLLADPVTKSLKRMPYKEAIEWLQK--EIVGGSMRIWKEDEKGGLDSKNYGYGLGLERFICWLTDTNHIRDV.............. 533
15 -21.700[J] KOG2472 Phenylalanyl-tRNA synthetase beta subunit  ali follow..  11  341...QAKSSDNQCAIKVHVPPSRSDVLHPCDVMEDVAIAYGFNNIPTRKPAIKPLTLNELTDLLRIEIAMCVYTEVVTLLCSHKENFAMLNREDVNSAVIVGNPRSADFAMRRALMPGLLKTVGHNNKY-PKPIKIFEISDVVMLDESKDVGASNRRHLAALYCGATSGFELIHGLVDRIMEVMAIPFLTIHENNVPIGRQASIIVRGKHIGNFGIVHPEVLNNFDIPDPCSYLELDIEAIL.......................... 598
16 -21.300[J] KOG2411 Aspartyl-tRNA synthetase, mitochondrial  ali follow..  16  2.................................................QYNLRLRSQMVMKMREYLCNHGFVDIETPTL------FKRTPGGAKEFLVPSREPGKFCSLP--QSPQQFKQLLMVGG------RYFQVARCYRDEGSRPDRQPEFTQIDIEMSFVD--QTGIQSLIEGLLQYS-----------------WPNDKDPVVVPFPTMTFAEVLATYGTDKPDTRFGMKIIDISDV........................ 165
17 -20.100[J] KOG2324 Prolyl-tRNA synthetase  ali follow..  17  2..LQHLRNRASIEVLGKAIRKYNVPESANQLLDMGFIQPSMPGIFQYLPLGLR-VQNKICDLLHISMRSLGASAISLAHLSSKEIWEKSGQKTGSELFRLHDRNDREMCLAPTHEEDVTRTMATIIDSQKQPIRVYQIGRKFRDELRPRGRGREFMMKDLYTFSAMKTYEDVLQAYHTFFKEVGLPFVMVKAA.......................................................................... 203
18 -19.400[J] COG0017 Aspartyl/asparaginyl-tRNA synthetases  ali follow..  16  79NRSDLGYEMQVKSIEVISEAHDYPITPKNHGTEFLMDHRHLW-LRSKKQHAVMKIRNEVIRATYEFFNKDGFTKVDPPILTASAPEGTSEL--------HTKYFDQDAFLS--QSGQLYLEAAAMAHG-----KVFSFGPTFRAEKSKTRHLIEFWMIEGEMTNHAESLEIQEQYVTHVVKSVLENCKLELKPRISYDDAIEFLKGYGEIIGGSERVDDLEKEHGLDEEAYGFGLGLERTVAWISGVEHVRET.............. 418
19 -18.200[J] COG0442 Prolyl-tRNA synthetase  ali follow..  16  7..LLSTQKETPADAEVISHQLM---------LRAGMIRKLASGLYTWLPTGVR-VLKKVENIVREEMNNAGAIEVSMPVVQPADLWQESGEQYGPELLRFVDRGERPFVLGPTHEEVITDLIRGEINSYKQPLNFFQIQTKFRDEVRPRFRAREFLMKDAYSFHTTQTYDAMYTAYSKIFSRMDLNFRAVLADTGSIG..................................................................... 203
20 -16.600[J] KOG4163 Prolyl-tRNA synthetase  ali follow..  177...AALEDAKLIGITVDKALDFPGWYQQILTKGEMLDYYDVSGCYILRPPSYA-IWENIQKWFDDKIKAIGVQNAYFPMFVSSRVLEKEKDHVEGVTRAGSSELEEPIAIRPTSETVMYPYYAKWVQSYRDPLKLNQWNSVVRWEFKHPQRTREFLWQEGHTAHLTAKDAEILDFYAGVYEELLA.................................................................................. 373
21 -15.700[E] COG2502 Asparagine synthetase A  ali follow..  13  7..................................................LQQQEISFVKNTFTQNLIELGIIEVQGPILVGNGMQDNLSGIEKAVQVNVKCIPNAVFEVVH--SLAKWKRHTLARFNFKEDEGLFVHMKALRPDEDDPTHSVYVDQWDWEKVEGRRNFAYLKETVNSIYRAIGKPHDGRAPDYDDWTTESDQLGKAFELSSMGVDESALRLQVGLTPLTIGGGIGQSRLAMLLLRKKHIGEVQSSVWPKEMLEE.. 325
22 -14.800[J] COG0072 Phenylalanyl-tRNA synthetase beta subunit  ali follow..  310PSWRFDMEIEEDLVE------EVARVYGYNNIPDEPVQASLI-------MGTHREADLSLKRVKTLLNDKGYQEVITYSFVDPKVQQMIHPGV-EALLLPSPISVEMSAMRLSLWTGLLATVVYNQNRQQNRVRIFESGLRFVPDTQAPLGIRQDLMLAGVICGNRYEEHDLKGDLESVLDLTGKLNEVEFRAEA--GQSAAIYLKGERIGFVGVVHPELERKLDLNGRTLVFELEWNKLA------DRVVPQAREISRFPANRRDI 571
23 -14.200[J] COG0752 Glycyl-tRNA synthetase, alpha subunit  ali follow..  13  7.......................................................FQEIILTLQQFWNDQDCMLMQAYDNE--------------------------------KGAGTMSPYTFLRAIGPEPWNAAYVEPSRRADGRYGENPNRLYQHHQFQVVMKPSPSNIQELYLESLEKLGIEDNWENPSTGSAGLGWEVWLDGMEITQFTYF--QQVGGLATGPVTAEVTYGLERLASYIQEVDSVYDI.............. 181
24 -13.600[J] COG0441 Threonyl-tRNA synthetase  ali follow..  15  225......DKKALNAYLQRLEEAAKRDHRKIGKQLDLYHMQEEAPGMVFWHNDGWTIFRELEVFVRSKLKEYQYQEVKGPFMMDRVLWEKTG-DNYKDAMFTTSSENREYCIKPMNCPGHVQIFNQGLKSYRDPLRMAEFGSCHRNEPSGSMRVRGFTQDDAHIFCTEEQIRDCIRLVYDMYSTFGFEK................................................................................ 415
25 -13.300[J] KOG1637 Threonyl-tRNA synthetase  ali follow..  14  274.......PKQLKEWEKLQEEAAKRDHRKIGREQELFFFHELSPGSCFFQPRGAHIYNTLMGFIKAEYRKRGFQEVISPNIYNAKLWMTSG-QHYAENMFSFEAEKEKFALKPMNCPGHCLIFDNRNRSWREPLRMADFGVLHRNELSGATRVRRFQQDDAHIFCAPEQIKSCLEFLKYVYTIFGFSFQLVLST.......................................................................... 469
26 -12.500[J] COG0172 Seryl-tRNA synthetase  ali follow..  13  178..........................................................INFMMDLHHDKHGYEEVLPPYLVNRTSMTGTGQLPKFEEDAFKIREEDYFLIPTAEVPVTNLHRDEILSADQLPIAYTAYSMNFRSEAGSAGRQHQFNKVELVRFDSYDELEKLTGHAEKVLQLLKLPYRV------------------MSMCTADLGFTAAKK------------YDLEVWIPSANTYREISSC-SNFEDFQARRANI 366
27 -11.800[J] KOG2509 Seryl-tRNA synthetase  ali follow..  15  207..........................................................LIQYALRTLGSRGYIPIYTPFFMRKEVMQEVAQ-IGKGSEKSDDNSYDEKYLIATSEQPIAALHREWLRPEDLPIKYAGLSTCFRQEVGSHGRVHQFEKIEQFVYKSWEMFEEMITTAEEFYQSLGIPYHI------------------VNIVSGSLNHAASKK------------LDLEAWFPGSGAFRELVSC-SNCTDYQARRLRI 408

FFAS is supported by the NIH grant R01-GM087218-01
1 3 3 8 4 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Godzik A. cd-hit: a fast program for clustering and comparing large sets of protein or nucleotide sequences. Bioinformatics. 2006 May 26;