current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 6aqh_A mol:protein length:508 Lysine--tRNA ligase, from PDB1018

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500
# Score Template Links and tools%idFirst MAMTPPESVDPDLPEQFRIRQAKRADLLAQGRQPYPVDVPRTHTLLEIRQAYPDLPVDARTGEIVGVTGRVVFARNSGKLCFATLQEGDGTQLQAMISLAEVGQEALDNWKTYVDIGDIVFVHGEVITSKRGELSVLADSWQMAAKALRPLPVAHKEMSEESRVRQRYVDLIVRDQARKVARQRIAVMRAIRSALERRGFLEVETPMLQTLAGGAAARPFVTHSNALDTELYLRIAPELFLKRCLVGGFERVFELNRVFRNEGADSTHSPEFVMLETYQAYGTYDDSAVVTRELIQEVADEAIGTRQVPLPDGTVYDLDGEWESIQMYPSLSEALGEEITPDTPAETLWAIADRLGLDIPRDRGYGHGKLVEELWEHTVGAKLWAPTFVKDFPVETTPLTRSHRSIPGVTEKWDLYVRRIELATGYSELTDPIIQRERFEAQARAAAAGDDEAMALDEDFLAALEYGMPPSTGTGMGIDRLMMTLTGLSIRETVLFPIVKPRLast
1 -152.000[J] COG1190 Lysyl-tRNA synthetase (class II)  ali follow..  37  4.QKPQVAEQAQELNSELQARREKLAVLRGKG-IAFPNDFRRENLSDQLHAEFDSKENEEALNIDVTVAGRMMTRRIMGKASFVTLQDVGG-RIQLYVSRDDLPEGVYNEEFKKWDLGDILGARGKLFKTKTGELSIHCSELRLLTKALRPLPDKFHGLDQETRYRQRYLDLIANDESRHTFKVRSQVMSGIRSFMVEKGFMEVETPMMQVIPGGASARPFVTHHNALDIDMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGVSPRHNPEFTMMELYMAYADYKDLIVLTEELFRTLTETILGSSVVQ-YGEQTFDFGKPFAKLTMKEAICKYRPETNVADDDMDKAVAIAESLGIKVE--KSWGLGRIQCEIFEETAESHLIQPTFITEYPAEVSPLARRNDDNPFITDRFEFFIGGREIGNGFSELNDAEDQAQRFADQVSAKEAGDDEAMFYDEDYITALEHGLPPTAGLGIGIDRMVMLFTNSTIRDVILFPAMRPV 504
2 -147.000[J] KOG1885 Lysyl-tRNA synthetase (class II)  ali follow..  37  62.NGVGPEEESVDPNQYYKIRSQAIHQLKVNGEDPYPHKFHVDISLTDFIQKYSHLQPGDHTDITLKVAGRIHAKRASGKLIFYDLRGEGV-KLQVMANSRNYSEEEFIHINNKLRRGDIIGVQGNPGKTKKGELSIIPYEITLLSPCLHMLPHLHFGLDKETRYRQRYLDLILNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHNELDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKMVSGMVKHITGSYKVTYGQAYDVDFTPPFRRINMVEELEKALGMKLPETNLFETEETRKILDDIAVECPPPRTTARLLDKLVGEFLEVTCINPTFICDHPQIMSPLAKWHRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKAKAAGDDEAMFIDENFCTALEYGLPPTAGWGMGIDRVAMFLTDSNIKEVLLFPAMKPE 576
3 -105.000[J] COG2269 Truncated, possibly inactive, lysyl-tRNA synthetase (class II)  ali follow..  27  2...................................................................................................................................SQLSLAFCSERV--QFVISVSCDEPPMTNSD---------WMPTASISQLKQRATLLRQIREFFAERNVLEVETPAMSHATVTTFKTEFVGPGYAKGSALHLMTSPEFHMKRLLAAGSGCIYQLGKAFRNEENGRYHNPEFTMLEWYRIGFDHHALMDEMDALLQLVLRCG------------------SAERMTYQEAFLNVLGVC-PLEEEMRELKQVAATLGLSDIAEPEEDRDTLLQLLFSIGIEPKIITPAFVYDFPASQAALAKINPADPRVADRFEVYFKGIELANGFHELDNPAEQLARFKADNAKRLEMGLTEQPIDYHLIAALEAGLPECAGVALGIDRLIMLALGEHIDKVTAFPFPR.. 348
4 -99.000[J] KOG0556 Aspartyl-tRNA synthetase  ali follow..  17  39.KLEKEREKEQKRKEREAREAEEKKKREANEIDYSAGKYGDNRSTARPGRTYTQISDAKNDGQTVLLRARVYTSRLQGKMCFFSLRQKYD-TIQALAVVNKDTSKQMVKWCGSISLESIVLVEGIVKKSPEIDAEIHISSIYVISPIKKNLPSKFVRVNLDTRLDNRVLDL-RTPTNQAIFDIQAGICQAFREFLLSNSFNEIHTPKMSGASSEGGSNVFKIQY--FKTDGFLSQSPQLYKQMLIAADRERVFEIGPVFRAEDSNTRHMTEFTGLDLEMAFNEYHEVMEFIEKLFLYIFKTIREKYAKQVASEDFILPDADRIRFHFKDAVKLLKEAGYRKQLVPGQKVPEDEEFHYCEDPEFDDFSTPEERALGQIVREKYHTDFYVIDKYPSSVRPFTMPDPEDPRYSNSYDFFMKGQEIMSGAQRIHDPELLVERMKALGVSPDVG-------LQQYIDAFAIGCPPHAGGGIGLERVVMFYLNPNIRLASSFPRDPKR 577
5 -91.000[J] KOG0554 Asparaginyl-tRNA synthetase (mitochondrial)  ali follow..  15  51.ANSRRRCFCTAVSESLGSGDGNKVESYEKRFGSKVGEFRKKLRIAEVKGGADEGL--SRVGQSLNIMGWVRTLRSQSSVTFIEINDGSCSNLQCVMTSDAEGYD--QVESGSILTGASVSVQGTIVASQGTKQKVELKVEKIIVVGECDSSYPIQKKVSREFLRTKAHLRPRTNTFGAVARVRNTLAYATHKFFQESGFVWVASPIITASDCEGAGEQFCVSQDFFGKPAFLTVSGQLN-GETYATALSDVYTFGPTFRAENSNTSHLAEFWMIEPELAFADLDDDMACATAYLQYVVKYVLDNCKED-MEFFDTWIEKGIIRRLSDVAEKEFLQLGY------TDAIEILLKANKKFDFPVKWGLDLQSEHERYITEEAFGGRPVIIRDYPKEIKAFYMRENDDGKTVAAMDMLVPRIGELIGGSQREERLEVLEA-------RLDELKLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFVTGDNIRDVIPFPRTPAS 564
6 -83.200[J] COG0017 Aspartyl/asparaginyl-tRNA synthetases  ali follow..  19  7.......................................................QAKDHLNQDVTIGAWLTNKRSSGKIAFLQLRDGTG-FMQGVVVKSEVDEEVFKLAKE-IAQESSLYVTGTITEDNRSDYEMQVKSIEVISEAHDYPITPKN-HGTEFLMDHRHLWL-RSKKQHAVMKIRNEVIRATYEFFNKDGFTKVDPPILTASAPEGTSELFHTKY--FDQDAFLSQSGQLYLEAA-AMAHGKVFSFGPTFRAEKSKTRHLIEFWMIEGEMAFTNHAESLEIQEQYVTHVVKSVLENCKLERDTSKLEKVATPFPRISYDDAIE------------------------LKAEGFDDIEWGEDFGAPHETAIANHYDLPVFITNYPTKIKPFMQPNPENEETVLCADLIAGYGEIIGGSERVDDLELLEQRVKEHGLDEEA---------SYYLDLRRYGSVPHCGFGLGLERTVAWISGEHVRETAPFPRLLNR 427
7 -82.700[J] COG0173 Aspartyl-tRNA synthetase  ali follow..  19  2........................................RTNYCGLISE--------QYLDQTVTVKGWVHRRRDHGGVIFIDLRDREG-IVQVVIDPD---TPEAFAAADSSRNEYVLSITGRVRNRISGKIEILAKEIEVLNAAATPPFQIDDENSENVRLTNRVIDL-RRPVMQRNLRLRYQVAMGVRRYLDAQGFIDIETPMLTRSTPEGARDYLVPSRVHPGEFFALPQSPQLFKQLLMVAGFDRYYQITKCFRDEDLRADRQPEFTQIDLETSFLNEDEIMDITEGMAKQVFKDALNSEAMFYYGSDKPDMRINLKFTELTDLMKTEEFKVFRGAADMKKVGLEHGKDNGYFTDEWKPLWVVDFPMFEYDEEADRYVAVHHPFTAPKEGHEDLMVSDPANCLARAYDMVLNGWEIGGGSIRIHRADVQEKVFAALKI----SPEEQQEKFGFLLDNLKFGAPPHGGLAFGLDRLVTLMTGASIRDVIAFPKTQR. 568
8 -79.500[J] KOG0555 Asparaginyl-tRNA synthetase  ali follow..  16  69.EVKKLEKAGCREKEAEEAQHAALEEAKKITFSLDKSLPEAKVIKIG--------ESVQHRDQRVSIKAWVHRLRRQGKLMFLVLRDGYG-FLQCVLNDKLCQSYDAVT----LSTETSVQVYGIIKALPDGKSALTVDYWEVIGKAPAGGIDLNESAGVDVMLDNRHLVI-RGENASRILRIRAAATRAMRDHFFAAGYTEVAPPTLVQTQVEGGSTLFGLDY--YGEPAYLTQSSQLY-LETCNAALGDVYCISQSYRAEKSRTRHLSEYQHVEAECAFITFDQLMDRIEALVCDTVDRLLADPVTKSVNPGYKAPARPFKRMPYKEAIE------------------WLQKNDVRNEMGEKFVYGEDIAEAAERRMTDTIGVPILLNRFPHGIKAFMPRCADDNELTESVDLLMPGVEIVGGSMRIWKEDQLLAAFEKGGLDSKN--------YYWYMDQRKYGSVPHGGYGLGLERFICWLTDNHIRDVCLYPRFVGR 542
9 -64.600[J] KOG2411 Aspartyl-tRNA synthetase, mitochondrial  ali follow..  20  1................................................................................................................................................................................MQYNLRLRSQMVMKMREYLNLHGFVDIETPTLFKRTPGG-AKEFLVPSREPGKFCSLPQSPQQFKQLLMVGGLDRYFQVARCYRDEGSRPDRQPEFTQIDIEMSFVDQTGIQSLIEGLLQYSWPNDKDPVVLATYGTDKPDTRFGMKIIDISDVFRNTEGAKYLKRKDIESIRNFAADHFNQ-HNKACSLLGKLRLECADLLEPRELESAHHPFTAPHPSDIHLLYTEPKKARSQHYDLVLNGNEIGGGSIRIHNAELQRYILATL-------LKEDVKMLSHLLQALDYGAPPHGGIALGLDRLICLVTGSSIRDVIAFPKSFR. 427
10 -29.000[E] COG2502 Asparagine synthetase A  ali follow..  14  1........................................................................................................................................................................MKKTFILQQQEISFVKNTFTQNLIEQL---GIIEVQGPILSQVGKAVQVNVKCIPNAVFEVVHSLAKWKRHTLARFNFKEDEGLFVHMKALRPD-LDPTHSVYVDQWDWEKVIPEGRRNFAYLKETVNSIYRAIRLTELAVEAR-----------------DIPSILPKQITFVHSEDLVKRYPDLSSKERENAICKEYGAVFLIGIGGKLSDGKPHDGRAPDYDDWTTESENGYKGNGDILVWNDQLGKAFELSSMGIRVDE-----SALRLQVGLTGDEDHLKMDW---HQDLLNGKLPLTIGGGIGQSRLAMLLLRKHIGEVQVWP..... 319
11 -12.400[J] COG0016 Phenylalanyl-tRNA synthetase alpha subunit  ali follow..  15  5.................................................................................LEALRDDAIKKIEQAQEKKVVQEIRVKYLGKKGPVTEVLRGMGKLSPEERPVIGQLANDVREIGKAIESKMEALEQAEIHRKLQEETIDVTLPGRPVLKGGAHTATITEVEDLFIGLGFSVAEGPQIETDYYNFEALNLPKDHPARDMQDSFYFTDELLLRT-------KIICPGKVFRRDDDDATHSHQFMQIEGLYVDHGVR--MSDLKGVLQAFAKSFFGEERSIRLRPSFFPFTEPSVEVDVSCGICHGDGCRVCKQTG------------------------------WIEILGAGMVHPRVL--------------------------------------------------------------EMSGFNPNEYSGF--------AFGMGVERLSMLKYG--IDDIRHF...... 330
12 -9.580[J] KOG1936 Histidyl-tRNA synthetase  ali follow..  12  69..................................................................................................................................................................................QHMVVREKILDLVISCFKRHGAKGMDTPAFELKE-GEDSGLMYDLKDQGGELLSLRYDLTVPFARYLAMN--KRYHVGKVWRRE------SPTIVQ-EFCQCDFDI-ECLKIMCEILSGLQLG---------------DFLIKVNDRRIVDGMFAVCGVPESKFRAICSSIDKLDKMA------------------WKDVRHEMVVKKGLAPEVADRIGDYVQCHGGVSLVEQMFQ-LSQNKQALEGLGDLKLLFEYLTLF---------GIADKISFDLSLARGLDY---PCVGLSIGVERIFYIVEQRMK............ 399
13 -9.580[E] COG3705 ATP phosphoribosyltransferase involved in histidine biosynthesis  ali follow..  11  10............................................................................................................................................................................IADVLPTNARQLESAREQLLALFRVHGYELVQPPLMEHIDAGLSLKTILVTDRLSGRQLGIRADITPQVARIDAHLLSRLCYAGPVLHAQSDGLLNMREPLQAEMYGFADIRGDLIDLMLKSMKIADMG---------------KVLLSLGHIGIFRALSDAAHLDAGQSATLLALMQDKDTETVE---------AQVKAWKLDGMWAKAFSLLPRLYGGREVLSDARGRLPDLSAVGGALGELQAVCDAFPDCEIHIDLDNYHTGLLYAAYAADFHDAVARGGRYDGLGGYFGRARPATGFSFDLRSFIGRLPAIERQPAVLVDAEDAE 337
14 -9.110[J] COG0124 Histidyl-tRNA synthetase  ali follow..  12  9............................................................................................................................................................................TQDILPGDVETWQWIEQKAYDLCRRYNYQEIRVPMFEHTTTDIVQKEMYTFEDRGGRSLTLRPEGTASVTRAYVSN--KLFYIGPMFRYERPQSGRMRQFVQFGV------LGSADPAIDAEVLALVMRFYEELGLKNLKLVINSLGDTDSRLAHREALVNHFKPRIHEFCNDCQDRLEKNPLRIDCKKDRDHELMGTAPSIHDYLSTESKAYFEKVQSY---LTALNIPFVVDATLVRGLDYYN---------HTAFEVMVDGEGFGAITTLCGGG--------NGLVEEIGGPETPGIGFALSIERAIMALEAQQA............ 322
15 -9.100[J] KOG2783 Phenylalanyl-tRNA synthetase  ali follow..  11  1.........................................................................................................................MFPHRVSHLSKLFS---RRFPNWKRKVQ--------TDSWSNVPEHIHSKIGRNLFQKEGHPICSLRQLLEQQFQKFEMNNVQKSPIVSVETNFDSLGFPKTHVSMNNKTCLRTHTSAHQPEEFSRLAKGFLITADVYRRDEVDSSHYPIFHQMEGALVWNRND--TAKMKNDLKKVALSPSLKSMVDDETTALETHNDMQDIYSLEETKFVSQHLKDTLTTVIHDLVSLAPSISSGAEQVR-DWKGKWLEILGCGVVQDRLLKGA-FSKYPACFKDIAFWINNDFNPNDFYEIIVESVNLIDQYTAKSGKTSLCYRVNYRSMERSLRNEEIDKLQEKLRNRVANSL.................................. 424

FFAS is supported by the NIH grant R01-GM087218-01
1 3 3 8 4 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Godzik A. cd-hit: a fast program for clustering and comparing large sets of protein or nucleotide sequences. Bioinformatics. 2006 May 26;