current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 1b8a_A mol:protein length:438 PROTEIN (ASPARTYL-TRNA SYNTHETASE), from PDB1018

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .
# E-value Template Links and tools%idFirst MYRTHYSSEITEELNGQKVKVAGWVWEVKDLGGIKFLWIRDRDGIVQITAPKKKVDPELFKLIPKLRSEDVVAVEGVVNFTPKAKLGFEILPEKIVVLNRAETPLPLDPTGKVKAELDTRLNNRFMDLRRPEVMAIFKIRSSVFKAVRDFFHENGFIEIHTPKIIATATEGGTELFPMKYFEEDAFLAESPQLYKEIMMASGLDRVYEIAPIFRAEEHNTTRHLNEAWSIDSEMAFIEDEEEVMSFLERLVAHAINYVREHNAKELDILNFELEEPKLPFPRVSYDKALEILGDLGKEIPWGEDIDTEGERLLGKYMMENENAPLYFLYQYPSEAKPFYIMKYDNKPEICRAFDLEYRGVEISSGGQREHRHDILVEQIKEKGLNPESFEFYLKAFRYGMPPHGGFGLGAERLIKQMLDLPNIREVILFPRDRRRLTPLast
1 0.000e+00UniRef50_A0A0G4E9R7 Uncharacterized protein n=1 Tax=Vitrella brassicaformis (strain CCMP3155) TaxID=1169540 RepID=A0A0G4E9R7_VITBC  ali  30  57........DIDKVAAESSVYVRGRLHAFRSKGNSCFLVLRQGGSTVQACLFKDERSKELLKFLKSIPEESIIDIQGTVKPSSCTQKNVEIHILSAHLVSSCTQQLPFSVRDAARSGQDLRLDHRWLDLRTPANQAIMRVKAHMASAFRQQLIQAGFVEIFSPKLVPGQSEGGAEVFRTDYFGQQVCLAQSPQLYKQMAISSDLDRVFEIGPVFRAEKSRSRRHLCEFTGLDLEMSILHTYQEALLLVYNVLQRMFEDAEASLGDLLATVREQYPSEPLP-VILTYKDALQLLRSAGESMSDFDDLSDEQEQKLGRIVHDEYGTDLFAVDQYPRSLRPFYTMPSDTDADYSNSYDLFLRGQEIASGAQRINNPAQLKQAMDSGGLDSPSIQAYIKSFEHGCPPHAGAGLGLDRIATLFLGLDN................ 501
2 0.000e+00UniRef50_A0A0H1S5C4 Asparagine--tRNA ligase n=3 Tax=Mycoplasmatales TaxID=2085 RepID=A0A0H1S5C4_9MOLU  ali  31  19....ITIEEIYQQAEQEKIKVGGWVKSVRESKDIIFVVLNDGSTLLQIIISRKNFSQS--DLLEKINFGSSLLVSGKLLPTPQRKQSCELQATEIELVNSAANDYPLQ---KKNIPLETVRNFPHLRAKTNYFLTLFRLRHSISKAIHDFFHQEKFYYVPTSIITSNDTEGAGELFNISFFPKPAKLTVSGQLQAE-ALAQGLGKVYTFAPCFRAEKSHTARHLAEFWMVEPEMIF-TDLNGIINLAERLIKYVINYVLNNNGSELEFLENYNEKNEKEFKKIDYGEVIKILEKNKENFVFNDIKWGDLQSEHEKYLCHYFDNSPVFVLNYPTELKAFYMKNNPNEKTVAGFDLLFPEVGELIGGSMREDNYQVLVEKAQKIGLDINNLSWYFDLRKTGYAPSGGFGLGLERLIMFISGTENIRDTIAFPRYPKHLE. 469
3 0.000e+00UniRef50_G8YD66 Lysine--tRNA ligase n=26 Tax=Eukaryota TaxID=2759 RepID=G8YD66_PICSO  ali  24  121...........ETLTDVEVRVTGRIMGKRESGKLKFYVLKGDGVQVQIMAQAQDAPEAYEKMHEYLRRGDVIGIVGYPGRTKGGDGEVSVFAKTVQLLTPCLHMLPTEHYGFK--DQEARYRKRYLDLMNDSTRDRFRVRSKIISFIRKFLDSRDFLEVETPILNVIAGGATAKPFITHHNDMDMFMRIAPELFLKELVVGGLDRVYEIGRQFRNESIDMT-HNPEFTTCEFYQAY-ADVYDLMDMTELLFSEMVKEITGDYKVTYRPDGPDTLDFSRPWKRVNMIEELEKIYNVKFPAGDKLHTDETNERMLDKLVIEDASINPTFIFGHPQIMSPLAK-KDRKTPGLCERFEVFVATKEICNAYTELNDPFDQRQRFEEQGDDEAQMETFCNALEYGLPPTAGWGCGIDRLAMFLTDSNTIREVLLFPTLKP.... 581
4 0.000e+00UniRef50_A0A1Y1R9B4 Multifunctional fusion protein n=1 Tax=Campylobacteraceae bacterium 4484_4 TaxID=1970775 RepID=A0A1Y1R9B4_9PROT  ali  24  41.EKFSYVEDLEEKRDSTEATVAGRVKFLRLMGKAAFAKIEDDTGVLQIYYSRDGIGTEWFNQLKKLEVGDIVVVRGFPFVTKTGELS--LHATSLEIATKAIKPLPEKFHGLQ--DKELRYRHRYLDMMNPDVKEVFRIRSKIVSLVRHFFESRSFLEVETPMMHPIAGGAAARPFITHHNDVERYLRIAPELYLKRLIVGGFESVFEINRNFRNEGMDQT-HNPEFTMIEFYWAWH-NYEDLMKLTEELFDYLFDELALPRKL---VYGEYEIDFSTPFEKIKWADSLIRYAEVPADIVNDKESVAKLQTELFDEFVEPRLIDPTFVTHYPIEISPLA-RRNDKDPDIADRFEFFIAGKEIANGFNELNDPTDQYERFLKQGDDEEMDEEYIHALAYGMPPTAGEGIGIDRL......................... 472
5 0.000e+00UniRef50_UPI00094CF308 asparagine--tRNA ligase n=3 Tax=Buchnera aphidicola TaxID=9 RepID=UPI00094CF308  ali  30  11.........LTDSYINKNITINGWVRSRRDSKKISFLSVYDGSCIIQIIVKNSL--DNYYTEILKLTIGCSVKVQGVLQYSRGKLQKYEIFAKKIIALGWIENP-ALYPMSAKKHTMEYMRNFCHLRSRTNLFGAITRIRNVAFHAAHNFLYKKQYFWISTPIITSINTEGAGSMFKVSFFNKKVFLTVSGQLTLE-AYACALSKVYSFGPTFRAENSNTKRHLAEFWMLEVETAF-ANIDDISKFSEKLLKYIISTVLKNSLVDLLFLQNNLDSINIPFININYSDAIKILLKNSYKIKEEILWGNDLSILQEKYLVEKYFKRPIIIRNYPKSLKAFYMRINSDNRTVSAIDVLIPLVGEIIGGSEREERLPLLKKRINEMGLNKNDYIWYQELRKYGTVPHAGFGLGFERLVMYITGIKNIREAIPFPRTAK.... 462
6 0.000e+00UniRef50_A0A1G1V790 Lysine--tRNA ligase n=1 Tax=Candidatus Blackburnbacteria bacterium RIFCSPHIGHO2_02_FULL_44_20 TaxID=1797516 RepID=A0A1G1V790_9BAC  ali  25  31.ERTHTTKE-SQESLNKSVKTAGRLWALREHGASVFANLKDETGQIQIWFQKEKLGED-FELISLLDVGDFLGVEGEVVETKTGETT--IDTNKFTLLTKSLRPIPPSWHGLK--DTEERYRKRYLDLLDPEVKNRFDKRAKLIKETRKYLDDKGFIELETPTLQPLYGGANAKPFKTRVNDQEFYLRIADELYLKRLVIGGYEKVFEICKDFRNEGLDLT-HQPEFTMMEFYEAF-ADYNTIMERTEGLFKHLAQEVLGKTTLE---VGDHKIDIGNKWRRIEMSEIIKETLRLDIEEETEESLKGQLIFTIFEHKITDNLIEPTWVIDYPKEVSPLSKD-HRSKPGWVERFEGYIGGKEICDGWSELTNPIEQXXXXXXXXXXXXXDEDFLEAMEYGMPPLGGIGIGIDRLSMFFTNTWSIKEVVLFPLMRR.... 478
7 0.000e+00UniRef50_B7PTH8 Aspartyl-tRNA synthetase, putative n=2 Tax=Ecdysozoa TaxID=1206794 RepID=B7PTH8_IXOSC  ali  32  79......VKDLSSSIAGSYIWIRGRLHTSRSKGKQCFFVLRQQQYTVQCVAVSEKVSKAMVKFCALVTKESLLDVYGIVQSSPQKQQDIELHIEQLFVVSAAEPRLPLQVEDAARPENEDR-----------------RACSNLA-----FFPS-----------CAAASEGGANVFEVSYFKGSAYLAQSPQLYKQMAIASDFDKVFTVGAVFRAEDSNTHRHLCEFVGLDLEMAFNYHYHEVLDIIGQMFVDIFKGLRDRYADEIAAVNRQFPAPPFKFLRLEFPEAVAMLRAAGVEMDDEEDLSTPNEKLLGRLVKAKYDTDFYILDKYPLKVRPFYTMPDPHNAKVSNSYDMFMRGEEILSGAQRIHDPTFLTERAKEHGVDVSKIKAYIDSFRYGVAPHAGGGIGLERVTMLYLGLDNIRKTSMFPRDPKRLTP 487
8 0.000e+00UniRef50_A0A2R7WW59 Uncharacterized protein n=2 Tax=Hemiptera TaxID=7524 RepID=A0A2R7WW59_ONCFA  ali  26  42..........KESSEVEDVTVKGWVKAVRKFKDNIFVDVDDGSCLLQVVVPKSSLEKP-------ISYGSSVVASGNLVKNPHNQL--ELVAKNLEVIGECLEGYPFRP--KKNFSNDYVRQYLHLRFRTSGFSALLRIRNEAVIGLNDFFRKEGFLNIHTPILTSNDCEGAGEVFTVSFFDHKTYLTVSGQLHLEAA-ARAIGNVYTFGPTFRAENSKSRLHLSEFYMAEAEMAFISSVEDITSLSERLIKHMIETIMNKCAEDVDICRKTWGDPSSNFTLMSYKEASEILSKNKDKINVPHSLGNSFSKEHELFLVKHNSNKPVFVIDWPTSLKPFYMKQDTNDQNTVFSFDLLCNVGELCGGSLRENDYNKLQQALALHGLTEK-LKWYLELRKYGNIMTGGFGMGFERFLQAFLNIGNIKDTLPFPRWPHNCD. 491
9 0.000e+00UniRef50_Q492P3 Asparagine--tRNA ligase n=328 Tax=cellular organisms TaxID=131567 RepID=SYN_BLOPB  ali  29  8........DILSGHVNTEITIQGWIRTRRDSKKISFLDLYDGSCILQIIAYDKLHNYK--NEILRLTSGCSVIIVGIIVKSIGIKQHVEVIAKNIKILGWIEDPS-TYPITAKKHTMEYLREVSHLRPRTNTIGAVARIRDTLSQAIHNFLHKQGFIWIPTPIITACDTEGSSKMFCVDFFSKKAFLTVSGQLNAE-AYACALSKVYTFGPTFRAEYSNTNRHLAEFWMIEPEAAFMT-LDDIIILAESLLKNIIRILLEKRSDDIKYLNKNIITIEIKFNHIEYTEAIKLLEICNRKFNNPIHWGTDLFSEHEKYLSEEYFKSPVIIKNFPKNIKAFYMRLNDDNKTVASMDILVPGIGEIIGGSQREERLSKLDQRLQENCLTQENYWWYRDLRRYGTVPHSGFGLGFERLMIYVTGIKNIRDVIPFPRTSKNIN. 469
10 0.000e+00UniRef50_A0A0V1HTS1 Asparagine--tRNA ligase, cytoplasmic n=19 Tax=Trichinella TaxID=6333 RepID=A0A0V1HTS1_9BILA  ali  29  440............ENMGCRVKLFGWVHRLRRQGKMIFIVLRDGTGFLQCILSGAMC--QIYDAL-ILATESSISVTGILNAGKEAPGGCELQADFWTLIGRS-PPGGVEAVLNEESHPDVQLEQRHIALRGEHMTKLMRLRGALMKAFRDHYYDRNYCEVTPPTLVQTQVEGGSTLFSFNYYGQTAFLTQSSQLYLETCIPS-LGDVYCIAMSYRAEKSRTRRHLSEYTHVEAECPFIT-FENLLERIEDIVCDVVDRVMKSFGYLVKELNPNFKLPQKPFRRMTYLEAIKWLNDNGVKKEDGEFVVGDDIPEAPERYMTDTLNVPILLNRFPKVLKSFYMNPCADDPTLTESVDLLLPGGEIVGGSMRIWDEKELLDAFKRNNINVEPYYWYTEQRKYGTCPHGGYGLGLERFLTWLAGLHHIRETVLYPRFVDRCTP 866
11 0.000e+00UniRef50_E2AI73 Asparaginyl-tRNA synthetase, cytoplasmic n=8 Tax=Formicidae TaxID=36668 RepID=E2AI73_CAMFO  ali  28 1278..KQIKIKEAL-NHRDQRVKLFGWVHRLRRQGKLMFIMLRDGTGFLQCVLTDKLC--QTYDAL-TLATEAAVQLFGTLKIVPEGKNGHELHVDYWKLIGSS-PPGGADSILNEEALPDVQLDNRHIMIRGENTSKVLIMRSILVQAFRDHYRDRGYYEVTPPTLVQTQVEGGSTLFKLDYFGENAFLTQSSQLYLETCMPA-MGDVYCVAQSYRAEQSRTRRHLAEYTHIEAECPFIRLEDLICDVVERVLQSPFGHL-------VQELNPGFQIPKRPFKRMNYTDAIEYLRENNITKEDGFYEFGEDIPEMPERKMTDAINEPILLCRFPVEIKSFYMQRCAENERLTESVDLLPNVGEIVGGSMRIWNYEELLEGYKRENIDPTPYYWYTDQRKYGSCPHGGYGLGLERFLCWLLNRYHIREVCLYPRFMERCRP 1713
12 0.000e+00UniRef50_A0A249DZZ7 Lysine--tRNA ligase n=5 Tax=Candidatus Portiera aleyrodidarum TaxID=91844 RepID=A0A249DZZ7_9GAMM  ali  24  36..RTSLAKSLKKIFGEKTTAVAGRIMRKRGP----FIVVQDVSSNIQLYIDKKTISNEIHKYIKDWDIGDIIGAIGDIDKSKIGEL--YLLVKKAYILTKSIRPLPSKFHGIK--DQEIRYRHRYLDIMNKEVRKSFKIRTRIISALRNFFYELYFLEAETPILHSMPGGAIAKPFET-YNNIKLYLRIAPELYLKRLVVGGFERVFEINKNFRNEGLST-WHNPEFTMLEFYWAFAT-YKDLMEITEHMIRFVANEALGTTI--INIGKILNIDLSEPFDCLSMRDSLIKYGKTFSINNSDFYDLENLLFKLFEVIVERKLIKPTFVTDYPVEVSPLA-RSKDSNLNITERFELFIGGREIANGFSELNDYIEQSNRFYLQLRNKYTYDDYIRALEYGMPPTAGEGVGIDRLVMILTNKDSIRDVLLFPLLRSR... 494
13 0.000e+00UniRef50_A0A182QE81 Uncharacterized protein n=2 Tax=Bilateria TaxID=33213 RepID=A0A182QE81_9DIPT  ali  28  127............DNRGVRVRVYGWVHRLRRQGKLMFMTLRDGTGFLQCVLTDTLC--QTYNALV-LSTESSVQLYGTLKAVPDGPGGHELHVDYWELIGLAPAGGADAILNEEAH-PDVQLDNRHIMIRGENTSKILKMRDVVMQAFRSHYFDRGYTEVTPPTLVQTQVEGGSTLFKLDYFGEEAYLTQSSQLYLETCVPA-LGDVFCVAQSYRAEQSRTRRHLAEYSHIEGECPFIT-FDGLLDRLEDLIVDVVDRVLKSPGYMVQELNPGFVPPKRPFRRMNYADAIVWLKENNVTKDDGFYEFGEDIPEAPERKMTDTINEPIMLCRFPAEIKSFYMAKCEDDPSLTESVDLLPNVGEIVGGSMRSWKYDELLDGYKREGIDPKPYYWYVDQRVYGTQPHGGYGLGLERFLCWLLNRYHIREA............ 541
14 0.000e+00UniRef50_A0A0H3XKH7 Asparagine--tRNA ligase n=4 Tax=Entomoplasmatales TaxID=186328 RepID=A0A0H3XKH7_9MOLU  ali  30  13.............KDQTKIEVLGWVRSNRNNGKLGFLVINDGTCFLQVVYKKETIS--NFDEIASVRLSSAIKISGIFTLTPTAKQPFELQATAIEVLDLADENYPLQ---KKEHTHEYLREIAHLRAKTKTFNAVFRIRSSAAFAIHEYFNRQNFVYVNTPIITGNDAEGAGESFIVDFFGKKASLTVSGQLHAEGF-AQAFRSVYTFGPTFRAENSNTTRHAAEFWMIEPEVAF-SDLNDIMKLAQGMVKHVIKYLFDHNHSELSFLTANVDAEESEFAQTSYTTAIDLLLKNGQQFINNDIFWGDLQTEHERYLCEVINKKPTFLIDYPKDIKAFYMKINDDNKTVAACDLLVPGIGELVGGSQRENDYQKIVNRCLEMKIPTPDLQWYLDLRKYGYYKSSGFGLGFERLVMYVTGMTNIRDVIAFPRTPKNL.. 453
15 0.000e+00UniRef50_Q8EUS8 Lysine--tRNA ligase n=5 Tax=Bacteria TaxID=2 RepID=SYK_MYCPE  ali  23  34..RTMTIGDFNSKFANNNIKLAGRVVALRQ----TFGVIRDFYGDTQFYLNKKKVSKSMLEYFNKLDLGDIVEIFGSPFRTQKGELT--LDVKKIKIVSKALKPLPEKWHGLE--DEELRARHRYVDLINKDSMKVFVDRIRILKIIRQFMDSQNYLEVETPVLHPILGGANARPFITFHNERNFYLRIATELPLKKLIVGGFDKVYEIGRIFRNEGMDST-HNPEFTSMEVYAAY-ENMEYMMRLTENLFKYVAKSL----KKPVVKMGENEIYLTQKFRRIHMQEAQELAKKHNVKFEKHQSTLGHIINLFFEEFCEAKCIQPTFVYGHPIDVSPLSK-KDYKNPGFTKRFELFINTKEYANAFAELNDPIDQYERFEAQGNDEEMDMDFIEALEYGLPPTAGLGVGIDRMIMLFTEKSSIRDVLLFPHMKDK... 488
16 0.000e+00UniRef50_U5H8P9 Asparaginyl-tRNA synthetase n=3 Tax=Microbotryum TaxID=34416 RepID=U5H8P9_USTV1  ali  27  153............AKRGERVRIFGWVHRLRQQGAMIFLVLRDGTGYLQCVLTGKL--PLTYDAL-TLTLESTIEITGTINELPAGKTNHELTADWFSVVGKAPGDEAFLNKVSEDRDPSLLADARHLVLRGETASTVLKVRAALLQSFRDSYANLGLLEVTPPCMVQTQVEGGSTLFSFDYYGAPAYLTQSSQLYLETCLPS-LGDVFCVAESFRAEKSHTRRHLSEYTHVEAELAFLT-FNELLDHLEEVICQTVDRVLAEPKDSLWPAGESFQAPQRPFMRMDYRDAIKYLNDHGPDGVDGPHQVGDDIAEAAERKMTDQIGKPIFLVGFPKEIKSFYMQRIKGDEGYTESVDLLPNVGEIVGGSMRMDNLEELMSALKHEGIDPAPYYWYTDQRKYGTSPHGGYGLGLERLLAWMCNRYTVRDCSLYPR....... 581
17 0.000e+00UniRef50_A0A2A3SYR1 Asparagine--tRNA ligase n=1 Tax=Euryarchaeota archaeon TaxID=2026739 RepID=A0A2A3SYR1_9EURY  ali  33  14.....SIRDVLSGKTVMSVKIRGWIYRTRSSGNLAFVVVRDSTGVIQCTISKDKVDKSDFDGASKALIESSVILEGEPVEDDRAPGGWEIRATKFEVFHFADT-----FPITKDQSDEHLLNNRHLWLRSRSMVSALKIRSTVFKAFRDYWTNLDFTEIQSPSFTTSACEGGSTLFNVSYDDENAYLSQSWQLYAEATMF-GLENIFTIAPSFRAEKSRTRRHLTEFWHAEVESAWLHN-HQMMELEEGMIVYILKEVLSSNRAELEFLGRDLENIKAPFDKMKYEDVLDKLNSMGFDLGWGDDFGYKEEKALTQELE-----SPLYITNFPRE-KGFYHRPDPNDPKSLVCHDLLAPEGYGEIIGGRVWSPDELIERIKEEDLEPESYGWYLDIRKFGSVPHSGFGLGIDRTVSWICGSDHIKHVIPFPRTMRRTTP 446
18 0.000e+00UniRef50_A0A2D5W1Q1 Asparagine--tRNA ligase n=126 Tax=cellular organisms TaxID=131567 RepID=A0A2D5W1Q1_9BACT  ali  34  2..KTHWIGDISGNHXQSEVHLKGWIHRSRGSKRLRFIVLRDSTGTVQCVXKRDVVGXDTFEAVESALIESSVEXSGTAIPTDR-EHGHEIQVSDIRIVGPVDPSRPFPITESAMXETEFLLDNRHLYLRTGRMTTMLKIRSSVFGAIHSYFRERDFIEYQAPXFVAGAVEGGSTLFEVPYFGRKAXLTQSWQLYAEAAMPA-LERLYTIAPSXRAEKSRTRRHLTEFWHAEMEIAWSGN-EXVMDHGERLVRHIARTLLNERSDXXESLGRDXELIERDYPRIRYDEAIERLKAKGVQVEWGQDLDYSKEXILTEDFEV-----PHFLTXXPKVAKPFYHRPDPEDSRYVLCHDLLAPYGEIIGGGERTWSESEILERIAEEGTPSEPYEFYIDVRXYGGVPHGGFGLGVDXVCAWLAGADHIRETIPFPRDSRRVTP 441
19 0.000e+00UniRef50_G4TGB2 Related to SLM5-Asparaginyl-tRNA synthetase, mitochondrial n=2 Tax=Serendipita TaxID=358905 RepID=G4TGB2_SERID  ali  29  31.....TIRQILDAAPETEITVNGWIKSVRRQKAVAFAQLSDGTDLLQIVFGKP-------EMAEGLDLGTSVSLVGAIVKSPSKGQSYEFAATSVKILGTCIPE--EYPIQKKAHTTEYLREHANFRPRTDEIARMLRLRHAAKRAFEDYYEVNGFTSIQAPVITNNDCEGGGEVFRVHFFGNPAYLTVSSQLHLE-AFASAFSRVYTLQPAFRAERSHTNRHLSEFWMLEAEMAFVNDLSVIMDVVEASIKHVIRDTQETLASDSQRAQLD-SMASVPWKRITYTEAVEALQGLGVDFEWGQNISVEQERWLADNV---GGGQPLFVTNYPTNQKPFYMRVNTDESDTTACFDLVPRVGELVGGSLREERVDYLEAALNKHGLPADQYEWYTELRRFGTTPHGGFGLGFERFISWVGGWENVRECIPAPRWKGRC.. 480
20 0.000e+00UniRef50_A0A2N2EUD0 Lysine--tRNA ligase n=3 Tax=unclassified Elusimicrobia TaxID=1797919 RepID=A0A2N2EUD0_9BACT  ali  23  25..KSENIAQIKEEKDGESFSVSGRVTAVRLMGKAAFAEIFSGGNKIQMYIKRDEIPDD-FNVFKKTDIGDFANVSGFVFKTKMGETT--LHTKKFTFLCKSARPLPEKWHGLK--DEEQILRKRYLDILTERSRNNFKARSRVISGIRKFLDEREFMEVETPILHGIAGGAEAEPFKTHHNDLDLSLRIAPELYLKRLLVAGYDRVYELGRNFRNEGIST-RHNPEFTMLELYQAY-SNCQGMMDLCEELIKDAALRAF--------PGEEPAIDINKPFRRIAVFEA--LLEKTGINFEEKDASAPKIFENLSEGILLEGVTEPVFMHDFPEEFSPLAKPK--PGTKIADRFELYMNGMEIANAYSELNDPAKQRENFEAQVSDASADEDFLEALEYGMPPAGGLGIGIDRLVMVLIKSASVKDVIIFPQLKKK... 467
21 0.000e+00UniRef50_Q8SS56 Probable lysine--tRNA ligase, cytoplasmic n=26 Tax=Eukaryota TaxID=2759 RepID=SYKC_ENCCU  ali  24  55..........STQFVGEDVRSAGRIMSMRLHARFCFFVVTSNGESLQVVVDTKEAGREQM--AKFLRRGDVVGFTGNPGRTRTLEAS--VFATDIIVLTPCLRTIPTEHFGLK--DPETIYRKRYMDLINRESRNRFQKRAQIIGYIRSFLDSRGFLEVETPMMNLIPGGAAAKPFITHHNELDLYMRVSPELYLKKLVVGGLERVYEIGKQFRNEGIDLT-HNPEFTSCEFYMAY-ADYNDLMEMTEELISGMVENMFGTDTIVYSPKKREELSFKRPFRVISIEETLEKLLSACDKEVEKPRTLSRVLDKLIGHVIEPQCVNPTFVKDHPIAMSPLAKN-HRSKAGLTERFELFINCKEICNAYTELNNPFEQRERFLQQGDDEAMMEDFCTALEYGLPPTGGWGIGIDRLVMYLTDAANIRDVIFFPTMKP.... 509
22 0.000e+00UniRef50_J4DPQ2 Aspartyl-tRNA synthetase n=3 Tax=Theileria orientalis TaxID=68886 RepID=J4DPQ2_THEOR  ali  35  119......IKDL-DDHVSEYVWLRGRVHELRGKGALCFLVLRQQRELLQCVIDSKENTKDMVKWASSLSFESVVDVYGKVVVPNSPILSTELHVSKVFCLSKSSPNLPFENPSVIRVNQDTRLDNRALDLRCFLNGVIFKIQSQVCQLYREFLLSKDFIEIHTPKLLGGSSEGGSSVFKFKYFDQDACLAQSPQLYKQMAICGDLKRVFEIGPVFRAENSNTHRHLCEYVGLDLEMEFKNDYMEVVDLIDEMLKHVFEGLSKKSGSELDYFYKCNPSITRKFPKLSFQEAADMLRSSEVAEEIPEDLNTEHEKLLGKLVRERYGTDYYIVYDYPLNARPFYTMPKYEDDKLSRSYDFFMRGEEILSGAQRIHDSAELERRARECGLDVNTIRDYVDVFKYGAFPHAGSGIGLERVVMLFLGLGNVRRTSMFPRDPKRLTP 605
23 0.000e+00UniRef50_A0A1Y4DAN0 Lysine--tRNA ligase n=1 Tax=Elusimicrobium sp. An273 TaxID=1965617 RepID=A0A1Y4DAN0_9BACT  ali  23  41.EKQISCLDAKNAAEGTEAVTAGRLMQLRLMGKAAFAHLRDFSGRVQLYISKDNLGEESYAFFKKIAVGDFVSVTGHVFVTKTGEKT--IKVTKLTLLSKAIRPMPEKYHGLQ--DTEVRFRKRHLDLINEDVKDIFIKRAKIITSIRKTLDDKGFLEVETPILNPDAGGAVARPFETYHNKMPLYMRIALELYHKRLIIGGMDKIYEIGHMFRNEGIDTT-HNPEFTMMELYQAY-GDVNTMADLFDEILGNAAKAI----GIEKIHFRGHEVDLRPPYTRVHIPEWKEMFGRDIHEVLDGDDSDSDIFDELFEGKLLAEYHNPVIAMDYPTAVSPFSK-TKPGDPEIVERFEVFVNGQELGNAYTELNDPADQLQRLKDQGEDAKNDADYIEAMESGMPPTGGMGIGIDRIVMMLTGQDSIREIILFPTLKK.... 500
24 0.000e+00UniRef50_A0A2N1Q2G6 Aspartate--tRNA ligase n=1 Tax=Tenericutes bacterium HGW-Tenericutes-5 TaxID=2013848 RepID=A0A2N1Q2G6_9BACT  ali  35  14.......KDL-EKYYNQEIEIQGFVDKIRDLQYVQFVILRDSSSKVQMTVEKNEENKELNEIISSLTKESTILAKGVIQQEKVKLRGMEFIPNHIEITSKSEEELPIDILDYTNSNQELRLDNRFLDLRLDKNYLIFKGQTLAEMAMREYWIKNNFIEIHSPKILGTASESGAEVFSMDYFGRKVFLAQSPQFYKQMAMAAGFNNVFEIGPVFRAENSHTAYHATEFTSVDIEMSWIKSYHEVMDAEEAKLKEVMKRLHKDLNEEYEMFKKDIEIPTYDFPRIPFYEAKKIIQENYKYIGEKEHDFDRKEEELIGLYAKKKLNDFVFIIDYPFAARPFYHMLDPLTK-LTYSFDLLYRGIEITTGAQREHRIDILKQQAIEKDMSLEPIDFYLNFFRYGMPPHGGYGFGLTRFLMRLFEVESIRDVTFLYRGPNRVNP 446
25 0.000e+00UniRef50_D6GV50 Lysine--tRNA ligase n=3 Tax=Candidatus Parvarchaeum TaxID=662758 RepID=D6GV50_PARA5  ali  23  34...TLKIKSDFDKLEGKDEKIAGRIIAKRDHGTIKFIDIQDETGTIQIYFSNKHVNKESIKIAELLDVGDIIGVYGSVVKTKTDEIS--IDAKEVVILSKSLLPLPPRWYGLE--DTEKRFRKRYLDLINRESMEKIKKGSIMVSKIREILGKKGYTEVVVPILQPIPGGANAKPFITHYNDRDFYLKIASELYLKRLLVGGFEKVFDISKNFRNEGIDT-RHNPEFMMLEAYQAY-GDLSSMLELTEEIIKEAIYAANGTYSIKFGEKNIDF----SKFEIKTMEEMVKEIIKRGKVLDSKVESYGEAINAIFEAEISDNIINPVFVTKFPIEVSPLAKNM-EDDPRFVYRFELYIAGMEIANAFSELNNPIEQIKRFEEKGIDEEFDKDVIEALGYGMPPTGGVGIGIDRIQMLGTNSKSIKEVIPFPQLR..... 472
26 0.000e+00UniRef50_A0A166BAS5 Asparaginyl-tRNA synthetase n=1 Tax=Exidia glandulosa HHB12029 TaxID=1314781 RepID=A0A166BAS5_EXIGL  ali  27  23.....TIRQLFAAPVPTEITVNGWIKSVRRQKRMSFAVLADGTTDLQAVFSDPTLD------LDSLTTGASVRLEGALVGSPGARQDRELQVRSFSVVGQCDPE--SYPIQRKELSTEFLRTLPHLRTRTQAHAHIIRERDRLMRGFHSYFETNGFYHIHTPALTQNDCEGGGEAFALDMFGHPAYLTVSAQLHLE-AMAAALPRVYTLSPAFRAESSATSRHLSEFWMLEAELAFADSLEDIMALTEGCVRAVLPKASDT--------------DPSPWPRITYAQAVDALAAAHPKFEYEPRHGDPLRSDHERWLAEVWANDPVFVTSYPAAHKPFYMLPNDDGTDTVACFDLLIPVGELAGGSLREHRLDRLQDAMKRHGVNEGELEWYLDLRRWGSTPHGGFGLGFERLVAFVTGTESVKECVPFPRWAGR... 444
27 0.000e+00UniRef50_A0A1E5W348 Aspartate--tRNA ligase 2, cytoplasmic n=1 Tax=Dichanthelium oligosanthes TaxID=888268 RepID=A0A1E5W348_9POAL  ali  35  116.HRSWTVSELSPDAAGSTVLLRGWAQTIRSVGKLVFLILRDLLATVQCILVRGEITEQMMRFARELPKESFIEVEGLVKPVNHTTQQVEISVTKIYCISRSAINLPFNFDDAARSGLDTRLDNRTVDLRTPANQAIFKIQSVIDSKFTEFLLAKGFMGIHTPKITPGISEGGSSVFKLNYNGQIASLAQSPQLYKQMAINSGLKKVFEVGTIFRAEKSNTHRHLCEYIGLHVEMEIKEHYFEVCNVLGALFIELFDHLAATCGRELDIINKQFPCEPLKFILGKFQEWCASLKSEGFTIEQCDDLSTKAEKKFGQLVHDRYNTDFFILYEFPLEVWPFYTMPCLENPEYSNSFDAFIRGEEVVSGSQRIHCHELLLERIRKCGIDRAALQGFLDSFLYGAPPRGGFGAGLERVLMLYCGLPNIRLASLFPRDPQRLTP 601
28 0.000e+00UniRef50_A0A2I2L4Y8 Aspartyl-tRNA synthetase n=1 Tax=Orpheovirus IHUMI-LCC2 TaxID=2023057 RepID=A0A2I2L4Y8_9PHYC  ali  31  1MEYKHSIRKLGTYNVNENIILRERIHFIRELKNVTIIIVRNKLHSIQLIVAKDVRNG------SELSIGDVVDFYGVLRSCKTSVKNLELHVERYEVVSKCN-DLPFTVEESNNVGLSKKLDNRVVDLRTELNQSIFTIRSYFLSLFREYLHNKDFMEINTPKLIGNKSEGGAQVFHVPYFESQAYLAQSPQLYKQMMINSDYGRVFEIGPVFRAENSGTKRHLCEFTGLDIEMELGKNHNQVINVIWKTLLHIFNNLSKYCENEISYVRSKVGSVELEYPCLTFLECVQLLKESGYEQNELEDLSTENERKMGEIVKEKYGSDIFVITQYPTSCRPFYTKIEESNSLYSNSFDIIMRGTEISSGAQREHNYEALVNNMERCGVSAESLKDYLVSFKYGSKPHGGCGIGLERLIYLYLGLEDVRNACLFPRDPKRLFP 445
29 0.000e+00UniRef50_A0A1V5FVF0 Lysine--tRNA ligase n=1 Tax=Alphaproteobacteria bacterium ADurb.BinA280 TaxID=1852793 RepID=A0A1V5FVF0_9PROT  ali  23  59.......AEALAEQ-GAQVRLAGRLIAKRVMGKASFAQIQDESGRIQLYLKSDALGV-GYDAFKSWDIGDILGVEGGLTRTKTGELS--IAATSLRLLTKALRPLPDKFHGMTDV--EQRYRQRYVDLINPEAREVFVQRSRIIRAIRNWLDERR--------------------FDFHHNDLQLYLRVAPELYLKRLVVGGLERVYEINRNFRNEGVST-RHNPEFTMLELYEAY-ASYHEIMDLTEAVIRHSSESVFGTTIRRWEGAE---IDLGPAFRRWRMDEAVRHHNRLNIKVK-ADYGWGRLLLEIFEKTVEAHLVQPTFITHHPVEVSPLA-RESDSEPGITERFELFICGREIANGFSELNDAEDQAARFQAQGGDDEAMHDYIRALEYGLAPTGGLGIGIDRLVMLLTNSTSIRDVLLFPYMRP.... 482
30 0.000e+00UniRef50_A0A2K4ZMV1 Aspartate--tRNA ligase n=1 Tax=Acetatifactor muris TaxID=879566 RepID=A0A2K4ZMV1_9FIRM  ali  36  4.KKIQDISEISEEHIGETVTLHGSIYKIRKMKGFYFCRVRTPRDVIQCVCDRQ-------ELMEKLREEACVRITAEAVKEERAKAGVELYILSVVILSEPLENMPVVINQKESTSLENKLNFRPLTLRNEKERAIFRIQEGILRGFRHFFEEEHFVEIHTPKIVYAGAEGGANVFRVDYFGREAYLAQSPQFYKQM-MAGVFERVYEVGPVFRAEKHDTARHINEYTGVDFEMGYIESFRELMALEVKMLRCALNMLSREYAHELELLQVTLPELPEEIPELKFTEAKELLAEEGEAAREQAYFEPEEEKMLSEIIWRRTGSEFVFITHYPAAKRPFYVMEDPESPEETLSFDLIFRGLEITTGGQRIHDYNMQVEKMCRRGMNPEAFESYLMMHKHGMPPHGGLGLGLERFTARLLNFDNIRQAALFPRDIHRLTP 455
31 0.000e+00UniRef50_A0A094C563 Uncharacterized protein n=1 Tax=Pseudogymnoascus sp. VKM F-4513 (FW-928) TaxID=1420907 RepID=A0A094C563_9PEZI  ali  33  178............DMMDQIIIFRARIHTIRRMSKLIFLIFRQQTFTIQGVLSASIISEQMVRAVVHYPSESIVLVKGIIRSPPQTIHDAEIMVLEIHLISQLSENVPFTVYDAENIGQTYRLSNRVVDLRTASSQGIFRIQSGISKIFRDYLDSKGFIEIHTPKLQGSATESGASVFEINYFGRPVYLAQSPQLAKQMCIAADFERVYEIGAVFRAENSNTSRHLTEYTGLDLEMAFEEHYHETLDLIDEMFKSVWKGLYKRYSKEIGVISQFYPHEKLAWPRLSFSDGVKLLLEDGWPPCDTEDLSTRAEIRLGQLVKERFHADYYILDKFPASARPFYTMPDPNNESFTNSFDIFLRGQEILSGGQRIHDAEFLEERMRKLGVKPENMNDYLEGFRWGAPPHAGAGVGLERLTYLFLNLGNIRLASLFPRDPKSL.. 692
32 0.000e+00UniRef50_A0A1M6YYA9 Aspartate--tRNA(Asp/Asn) ligase n=2 Tax=Actinobacteria TaxID=201174 RepID=A0A1M6YYA9_9ACTN  ali  35  9.....LAAEL-PAHVGETVDVSGWLHRRRELKSVTFLVLRDRSGLTQVVLTTPG---------GDVPEETVLRVRGTVTANAQAPGGVELTSPQIEPLSSAQAPPFDLYRPAVSAGLPTILDHAPVALRHPHLKAPFQLSAASVAGFRAALDALSFTEIHTPKVVSSATESGASVFALDWFGRPAYLAQSPQFFKQ-AMVGVFERVYETGPVFRAEPHDTARHLAQYTSLDAELGFITDHRDVMAVVREAVAGMVEGIEERSAEAVERLELTLPEVPAEIPQIHFADAMKMLG------VDEPDLAPAHERFLSEWALREHGSELLFVTGYPMAKRPFYTHPDPERPAYSNSFDLLFRGLELVTGGQRLHRYEDYVAALAARGESAEPYESYLSAFAHGMPPHGGFALGLERWTARLTGADNIRRTTLFPRDLHRLTP 425
33 0.000e+00UniRef50_A0A1Q3MPU7 Lysine--tRNA ligase n=1 Tax=Armatimonadetes bacterium 55-13 TaxID=1895717 RepID=A0A1Q3MPU7_9BACT  ali  26  45...........DSLVGESVKMAGRVVSYRLMGKAGFAHISDGDAKIQVYFRKDDLTETEWELYRLLDIGDHVGIHGELFRTKSEEKS--IHARSLAVLSKALEVLPIGKEKDGQSDTELRYRHRHLDLINPDARRMLLNRSRIVTAVRHYFDQAGYLEVETPLLQLEAGGAAARPFLTHYNDIDVKLRISLELYLKRIICGDVPRVYEIGRVFRNEGV-SNRHNPEFTLLEFYESY-ANLEDMMVRVEELFKHVAIEVFGSPWVKFKLTEGEIIDFSKPWRRVSLLGEIERHTGLKRINPDDEHNLGGLIEKLLEVFVEPTLQEPTFVIGYPIETSPLAK-KDPNNPKMTRRFEGYIRGREVCNAFSEINDPIDQRERFEEKGDDEAMDEEFIYALECGMPPTGGCGIGIDRMAMMLTGADHLREVLLFPTMRP.... 517
34 0.000e+00UniRef50_A0A202DJH1 Lysine--tRNA ligase n=1 Tax=bacterium F11 TaxID=1932698 RepID=A0A202DJH1_9BACT  ali  25  69...................KVVGRLMTRRDLGKLCFAHLHDQTGRLQLKINRQDIGPEAYEFLKDVDIGDILGAEGTLCRTKTGELSIQLV--KFEILSKSLRPWPEKFHGLTDV--EARSRQRELDLVTNESRKRFEMRSILIQSLRKSLHENKFMEVETPLMQPVPGGAAAKPFITHHLDVDLYLRVAPELFLKRLLVGGFDRVYEIGRAFRNEGIDT-RHNPEFTILEAYQAY-ADVNDMMDLTEKLIGNVARELNIKES----TYRDEVCSFTEPFERRSLIDLFQEYQEKGINIPST-ASDRKAFDLLFDERILIHLKKPTFVLDYPTVFSPLAK-PKSNEPLLTDRFELFLAKEEVANAYTEQNDPDEQSRKFKRQKGDEEAMEEFITALQFGMPPAGGLGIGIDRLAMVLSGSSSIREVILFPLLRP.... 501
35 0.000e+00UniRef50_A0A0G4IRN2 Uncharacterized protein n=1 Tax=Plasmodiophora brassicae TaxID=37360 RepID=A0A0G4IRN2_PLABS  ali  25  8.....LICNALKAAAGTQVCVRGWVRSVRKHARRSFIQLNDGTTPIQIICDHEKTGP-----IPDIGNGASISVDGQLGPSKRNEKELEVAAESLALIGHSDA--AEYPVQKKHHTMEFLRKVQHFRGRTAAFSSVLRIRNTCSMAIHEFFQNRDFQLVHTPIITGCDCEGAGEQFRLPFFGQPAFLTVSGQLHAEMF-ACSIGPVYTFGPTFRRENSHTRRHLSEFWMVEPEIPYAT-LNDIMDTAEGLVKYCVNQVQGRNGGDVEVIRKIAHTPDSDFARVSYTRAIEILQKAAVGFAFTPEWGHDLQTEH-ELFLCKHFNSPVFVTDFPAKIKPFYMKASDPDKKTCASVDLVPNIGELVGGSERIDDPALLMKSMGDHGVDPSELQWYLDLRRFGSVPHGGFGLGFDRLVQAITGTKNIRDVMPVPRIPSAIS. 457
36 0.000e+00UniRef50_N0BI26 Lysine--tRNA ligase n=1 Tax=Archaeoglobus sulfaticallidus PM70-1 TaxID=387631 RepID=N0BI26_9EURY  ali  23  32..RTANADEIVKKFTDFNVRIAGRLMSKRKHGGVIFADLKDSSGRIQLVFRKDFTNE--FKELKLVERGDILGVDGFVIKTRRGEVS--VLVKEWTVLSKILRPLPDKWHGLE--DIETRYRQRYLDIMNEESRETFFLINKVIHLIRNYLNDNGFIEVYTPILQPVYGGAFARPFETHFLEEKMYLRIAPELYLKRLLVGGFEKVYEFAPCFRNEDVD-PLHNPEFIQLEFYWAYIE-LSQLMDFLEKMFEEVVLKATGKTEIEYQG---KIVNFKRPWKKMRMVDAIKEFGGIDVEKMSDDELFNHAIEKLFDYYAKDKIVNPTFITHFPVDISPLAKKAD----GYADRMELYIAGMEVANGFSELNNPIEQYMRFKEEEEDKKMDKDYIRALEYAMPPASGVGIGLGRLFMILGNKRTLREVIAFPTLAK.... 483
37 0.000e+00UniRef50_A0A151IDC7 Asparaginyl-tRNA synthetase, cytoplasmic n=5 Tax=Attini TaxID=143999 RepID=A0A151IDC7_9HYME  ali  29 1634..KTIKIRQALD-YRDQRVKIYGWVHRLRRQGKLMFITLRDGTDFLQCVLTDKLC--QTYNAL-LLATEAAVQLFGILKAVPEGPGGHELCVDYWELIGSS-PPGGADSILNEEALPDVQLDNRHIMIRGENTSRILMMRSILMQAVRDHYKDRGYYEVTPPTLVQTQVEGGSTLFKLDYFGETAFLTQSSQLYLETCIPA-MGDVYCIAQSYRAEQSRTRRHLAEYTHLEAECPFITLEDLICDVVERVLKSPLGYL-------VKELNPNFQVPKKPFKRMNYSDAIEYLRKNNITKEDGFYEFGEDIPEMPERKMTDAINEPIMLCRFPAEIKSFYMQRCMDDKRLTESVDLLPNVGEIVGGSMRIWDYKELMEGYKRENIDPTSYYWYTDQRKYGSCPHGGYGLGLERFLCWLLNRHHIREVCLYPRFLERCRP 2069
38 0.000e+00UniRef50_A0A2H9LDX4 Asparagine--tRNA ligase n=1 Tax=Candidatus Diapherotrites archaeon CG08_land_8_20_14_0_20_34_12 TaxID=1974404 RepID=A0A2H9LDX4_9A  ali  29  1MELT-KIAGIFEKGKGSFYT-RGWVKRKRELKNKMFILLRDETDELQCVLDKDKADKKLVDVVEKATIESSIELKGSLRKDERAPNGFELDIEDLKIVGLADT-----FPIGRDLSEEFLLDVRHLWIRSSKISNALKVRATVFEAFREFMKENNFTETSGPMFVSGSVEGGSTLFKVPYFDKTVYLTQSSQFYLEVMMYS-LGNCYTIAPSFRAEKSRTPRHLTEFWHAEAEMPWAG-LEDIIDLEERMLKYMVEKVVTDREKELVRLGRDEPSINKKFHRMTYEEAVKEISKKFSYVKSGFDLGEKEEREFTKDLDR-----PIILTHYPTSLKPFYHRADPKDPMHVLCNDILAPYGEIIGSGERCWNTEELIERIKKDKLPLEPYQWYIDLRKYGSVPHAGFGMGLERFTSWLCKAQTIRDVVPIPRTITRTYP 430
39 0.000e+00UniRef50_A0A024GL19 Lysine--tRNA ligase n=2 Tax=Oomycetes TaxID=4762 RepID=A0A024GL19_9STRA  ali  24  16..........KARYVHDEISLAGRIMSIRASKKLVFMDLWNEGQCVQILSEKNNGNETFYQIHESLRRGDIIGVTGFPGKSAKGELS--LIPRKLEILAPCTQPFPNDKYGIK--NPDIRFRKRYLDLVNRDIRSIFETRAKVVKAIRNFLEDRGFLEVETPMLYSSAGGATAEPFVTKALGNDLYLRIAPELFLKQLVIGGFNRVFEIGKVFRNEGIDAT-HNPEFTICEFYQAY-ADYETLMQTAEEMLSDIFSSPHRLCTTILTYVESIEIDFTPPFRRLSICPTLEKLEESLPDLESDPHTVPRLLDRLIGHFIEPMCVHPTFVYNHPKCMSPLAKD-HRKLEGLTERFELFVAGKELCNAYTELNDPGIQRERFEAQQGDREADEDFCKALEYGLSPTGGFGIGIDRLVMLITGKHHIRESILFPAMRS.... 481
40 0.000e+00UniRef50_UPI0008F9BEE9 lysine--tRNA ligase n=1 Tax=Geitlerinema sp. PCC 9228 TaxID=111611 RepID=UPI0008F9BEE9  ali  25  35.QRSHTTADVRAIFEGETLHLCGRITSKRDSGSICFIDLKDATGKIQLKIEKKLVSEESFKQIQKLDKGDFVGVEGIGCRTNRGELS--IQVEKLQLLGKATAPFPDEYYGISE--PETCRRHREIDLVTPEAFERFRRRSQIVKSIRTYLWDQGFDEIETPNLQAIYGGAAARPFVTHHNDVDLYLRIATELFLKRAVCGGFERVFELGRVFRNEGIDST-HNPEFSSLEVYQAY-ADYFEIMTLVEDLICHVVTNTLGEDVREIE-YQGDRIDLERKWQVKTMVEAVR--DETGLDFDTQTQTLGYLLYAIFDEIVAPTLMEPTFIVDFPIEVSPLAK-KHRSQPGLVERFELFIHGTEYSNGFSELNDPQDQRQRFEKQAGDEEADEDFLEALSLGMPICGGMGIGVDRLVMLLTNTASIRDVVMFPTMRP.... 520
41 0.000e+00UniRef50_A0A0N1IGH0 Putative asparaginyl-tRNA synthetase, mitochondrial n=7 Tax=Obtectomera TaxID=104431 RepID=A0A0N1IGH0_PAPMA  ali  27  31.........IKEANVGEVTEVKGWVKNLRVQKELVFADISDGSCKLQIVIPKHLKTDE-------LTYGSSVRVIGKLSKSPRGQL--ELAAEDVKVLGECVVLDGYPFNPRTTHSAEYIRQYLHLRCRTNYISALLRIRNAVSKHIHNYFDTKNYLHIHTPILTSNDCEGAGEVFKVVYFGSKTFLTVSGQLHLE-AMCRGLGNVYTLGPTFRAENSRSRLHLSEFYMLEAELAFCENLEDLQSSIEDLLKYIFIETRNTNEDDLYLIDKEPTWLDKKFITITYTEAKDILKRKGPDTEDGINKEQEL------ALVAHCDNVPVFIVRWPKEQKSFYMKESQDN-TKVEALDLLAPIGEIVGGSLREDDYKKLK-----LKLPSEALNWYLELRKFGNIPTGGYGLGLERLLQVLCSVPNIKDTLPFPRWPHNCD. 464
42 0.000e+00UniRef50_A0A1Y0GXX3 Lysine--tRNA ligase n=1 Tax=Armatimonadetes bacterium Uphvl-Ar1 TaxID=2004467 RepID=A0A1Y0GXX3_9BACT  ali  23  46.....TLADLSEDKPTEEISFAGRLVSMRLMGKAAFAHLSDGEERIQVYFRKNELNPNAWEAFKLLDIGDHVGFTGPLFKTRTGEPS--LHAYSLTPLSKALHNLPLGKQWYGLTDVDQRYRHRHLDLITNEAREMLLNRSRIVSEVRRFFDARGYLEVETPLLQLEAGGAAARPFLTHYNDLEVKLRISLELYLKRIICGDVPKVYEIGRVFRNEGV-SNRHNPEFTLLEWYEAY-ANLEDMMTCVEDLFRHVAEKIFGDP-------HIQNIDFGKPWHRVDLEDAKAAMKRVGLPTEKESNLGGIIEKLL-EHFVEPHLQEPTFVVGYPIETSPLAK-KDPDRPGFTRRFEGYVLGREICNAFSEINDPIDQRERFEQQGDDEAMDEQFLYALESGMPPTGGCGIGIDRLVMLLTGAEHLREILLFPMMRPEI.. 503
43 0.000e+00UniRef50_A0A1W9RC25 Lysine--tRNA ligase n=1 Tax=Candidatus Omnitrophica bacterium 4484_70.1 TaxID=1970782 RepID=A0A1W9RC25_9BACT  ali  24  38..............ENKKTTLAGRVISKREHGKSSFAHIWDITGKIQIYAQFNVL-KEKYELFKDLDIGDIIGVKGYLFKTKTGEPT--VFVEDLRLLSKCLRILPEKWHGLK--DIEVKYRQRYLDLISPDARQVFLKRIEIIEFIRDFFKKLGYKEVETPLLHLIPGGARGTPFATYYIDTQVYLRIAPELYLKRLLVAGFDKIFEINKSFRNEGI-SARHSPEFTMLEAYCAY-QDYEYMIKICEDLVSSLVERIHKSLRIEYQGKK---IDFTPPWPRISFVEIFEKLGSEKLNISLKELSRSQIINLVEEWIERRREEKPIFIVDFFSWMSPLAKTKKE-NPYVAERFELFIGGIEVANSYTELNDSIKQRENFEAQIKEEEGDEDFLLSLEYGMPPAAGLGIGIDRLIMLLLNQASIRDVIFFPLLRP.... 469
44 0.000e+00UniRef50_A0A2E9KWE8 Asparagine--tRNA ligase n=47 Tax=root TaxID=1 RepID=A0A2E9KWE8_9SPIR  ali  33  3.KRYISISEAMKKSSGK-VAVRGWVHRERGSNKLKFLILRDVSKVIQVVLSREDF-EKQWKEIDSLQVEASIEIVGEIKKDVRAPTGYEIRAKEINVVGKSD-----DFPINKSLNEELLGDRRHLWLRSRKMIAILKIRDTVLSSLREHWRKNSFYEYHSPTILGTQCEGGSSLFAVDYFGKELYLAQTWQLHAEPGIFS-LEKIFTIQPSFRAEKSKTSRHLTEYWHAEMEVAW-EDFNYLQDDAEKAVKYVVSEVLKNNLEELEILERDIKKLKPTFPRMSYDEALKILKKKKMEVVWGKDLRTIEEDKLSEFYDT-----PIFVTDYPKKVKAFYMKDSENGKETVLGFDMIGPEGELIGGSQREESIEKLRENLEADGENSENYEFYFDTRRYGSVPHGGYGLGVERLIAWICGLSTIKDAITFPRTMTRHSP 435
45 0.000e+00UniRef50_A0A135VPY4 Uncharacterized protein n=3 Tax=Archaea TaxID=2157 RepID=A0A135VPY4_9ARCH  ali  29  4....IHIGDVLSKFEGKKVYLRGWVHRIRKQKKMVFVLLRDPSGVVQTVIKKTAVSEKEYADAEKMLIESLVTMVGVVKSDARAEGGYEVQVEKFEVLHFAE-----EFPITEHQSIEFLNDNRHLWMRSRKLTNVLKVRDEVFRATREYLRNEGFYETTCPMFVSTMGEEGAELFEVEYFGRKMYMTQTSQMHLEPQLFA-MEKVFILAPSFRAEKSRTRKHVTEFWHLEVEEAWC-DHECNLKRQEGLISYMCHAVAKNRTPELKELGVDPSRLNPPFDRMTYAEAIESCQKAGLEINWGD-----DIRAEAEELLTKDSDNFLFVEYYPKEIKSFYMKHNPDDPRTYKNSDLLAPFGEVIGGSERETDAQLLIDNLLRIGDDPEKYKWYIDIRRYGSVQHSGFGVGVDRIITWMLELDHIRDSIPFPRTVSRIFP 431
46 0.000e+00UniRef50_C5KPS6 Asparaginyl-tRNA synthetase, putative n=2 Tax=Perkinsus marinus (strain ATCC 50983 / TXsc) TaxID=423536 RepID=C5KPS6_PERM5  ali  28  277.............LIGKTVSVCGWVRTKRSQGGFAFVEISDGSCLLQLVL--DSSCPDFEGTIAQIATGASIQAIGALVASPAKGQAVEVSVREIKVIGGVES--AAYPLAKKQHSREFLREIAHLRPRTNLIGAVARVRSSLSGAVHAFFMSRDFKYVHTPLITSADCEGAGEMFQVDFFGRPTYLTVSGQLNVEN-YACALSDVYTFGPCFRAENSHTSRHLAEFWMIEPELCF-ADIHDNMKCAEEFIQHCARHVLAHCREDIAFFDKFIEKIAEPFARVSYTEAIDKLLKAKAKFENTNIYWGDLDSEHERYLTEKIYKKPVIVYNYPAAIKAFYMRANEADKQTVAAMDILAPVGEVCGGSVREERLDVLDKKLSDLNMDVEDYWWYRDLRRFGSVPHAGFGIGFERLIMMMTGVENIRDVIPYPRYPGRCE. 746
47 0.000e+00UniRef50_A3ZMZ1 Lysine--tRNA ligase n=17 Tax=Planctomycetales TaxID=112 RepID=A3ZMZ1_9PLAN  ali  23  243.......KEIT-SFAGPKVRIAGRIVLMRPTGKLVFADLRDRTGRIQIFIGQNQVGERNWQIAQCLDLADIIGVDGELRKTKTGELT--IFVEQLHFLTKTLDPPPEKHKGLT--DPELRQRMRYLDLATDGAIERFVKRTEIVKSIRKTLADQNFIEIEGPTLHAIAGGAAARPFITHHNGMELYMRIALELHLKRLLVGGMERVFELGRVYRNEGI-SPKHNPEFTMLEVYQAY-GDYRSMMDLTEAVISGAINAIGASFELPY---GETMVNFAPPFERRTYAEAVKRYA-INLGLETEGKHPDVIRNEIFEEKVEDQLKGPIFVMDYPASICPLTKRKT-DNPAVAERFELFINGMEVANAYTELNDPDLQDKLFRTQLDDEDSMHDFIRALRNGMPPAGGLGIGIDRLVMLLTNTQTIREIILFPLLRH.... 681
48 0.000e+00UniRef50_A0A0G1R834 Lysine--tRNA ligase n=2 Tax=Parcubacteria group TaxID=1794811 RepID=A0A0G1R834_9BACT  ali  25  50................KSVSLAGRVMSLRPQGGLIFFTLDDGTGRFQGLIKSDEVAPEVFDLFKTADIGDFLQVSGTLFVTKRNEKT--LQIKTWKMLAKSLRPLPEKWHGLQDV--EERFRHRYLDLMSPEVKQRFVLRSKMVSEIRKFYDDNGYTEVETPRLQILAGGATAEPFVTHHNDIDFHLTIAQELYLKELLIGGFTKVYEIGRKFRNEGIDAT-HNPEFTMLESNESYADALSQ-RQFIEKLFKHLVKKMFN---ADSIIHNEQKIDFAENFSVITFFDLLQKATQLGVTVEPEESLE-KIMDNIYKKTCRPKLVQPTFIIDYPVSFNPFAK-RKEENPTLIDRFQLVAGGIELVNAFSELNNPVDQKERYLEQDKKKASDKGYLEAMEYGMPPNGGIGIGIDRLAMLFTDAKNIKEVILFPTLRPKIE. 489
49 0.000e+00UniRef50_UPI0008338C29 lysine--tRNA ligase n=1 Tax=Roseimaritima ulvae TaxID=980254 RepID=UPI0008338C29  ali  24  89............QEIGPTVRVAGRIMLSRPTGKLIFLNIRDWTGSIQIFIGKKQVGETDFELAKQFDLGDLVGVDGRLGRTNTGELT--VFAEKLHFHAKMLDIPPDKHAGLNDPDRKQRM--RYADLANDGVLDTFLDRTKIVKSIRRTLDDDRFCEVEGPTLHSIAGGAAARPFMTHHNDMPLFMRIALELHLKRLMVGGIERVYELGRVYRNEGI-SVRHNPEFTMLEAYQAY-GDYDTMMDLTERLICNAIEALDGQYQR---PFGDKIVEYTPPFQRRTYAELFQEHAGVDPAFDTEGKHPDVIKNEVFEEKVEDALQGPIFVLDYPASICPLTK-RKADAPEVAERFELFICGMELANAYTELNDPDLQEELFKTQGMDEEDDHDFVRALRHAMPPAGGLGVGIDRLVMLLTGQKSIRDVILFPALRP.... 523
50 0.000e+00UniRef50_A0A0G2IBK9 Putative aspartyl-trna synthetase n=17 Tax=Dikarya TaxID=451864 RepID=A0A0G2IBK9_9PEZI  ali  34  192.....NIREVTELSEGAEVTFRARIHHQRNSKHLDFLLFRDQTQSIQGVLQHD--TSHFVKWVQRLEPESLVQVTGTLQVPPEPVRSLEVKIYSVHVVNAA-HDLPFDNYEPPETTQ-ARLSNRILDLRHPSNQALFRIRAMVTRKFRDVLDRDGFIEIQTPKLQPAATESGAEVFKVNYFGRRAFLAQSPQLAKQMTVSADFGKVYEIGPVFRAENSNTKRHLAEYTGLDIEMAIQKDYHEVIREVDSFLKEVFRTLQ--SMPELEIVRQRWPSDDLVWPIIPFTEGLQMLRDDGIDV-DEEDLSTRNEIRLGELVKEKYKTDYYVLDKFPTNARPFYTQKDATDPKWTNSFDMFIRGQEICSGGQRIHDAARLRENMRQMGMSEDGMEYYLAAFDLGAPPHAGAGLGLERILAWTLQLVDVRYATLYHRDPKS... 624
51 0.000e+00UniRef50_F4Q683 Lysine--tRNA ligase n=6 Tax=Dictyostelids TaxID=33083 RepID=F4Q683_CAVFA  ali  24  131...........SKLADVETVVAGRIVSVRASTKLSFIDIMTNGHSLQIMADKHYANKDQFQIVETLRRGDIIEIRGVPSKTKVGELS--IIPKEITLLTPCLKPIPLRL-----INKDTRYRKRHLDLVNHKIRDAFIVRSRMISFLRNYLVERGFLEVDTPVLSTNVGGAMAKPFRTHSNDLDLFLRISPELYLKQLVISGFDRVFEIGKQFRNEGVDLT-HNPEFTTCELYQAY-GDYHTMMALTEDLISKMVYDITGSYRVPLPADNDIEIDFTPPFRRLHFIPKIEELSGEKLPEDSEPHTPTRILDALASHYLEPLCVQPTFIVDHPRAMSPLAKL-HRDNSQWTERFEMFVGGKELVNAYSELNDPTDQRDRFIQQGDDEAQIYDYCNALDYGLPPTGGWGLGIDRLVMLLTNNVSIRDVIFFPTMKPKSTP 583
52 0.000e+00UniRef50_A0A0R1NKB0 Asparagine--tRNA ligase n=14 Tax=Bacteria TaxID=2 RepID=A0A0R1NKB0_9LACO  ali  28  4....ILVKDLFSDQEDQTITLHGWVKTIRSSKKIGFIELNDGSTIAQIVMKASDL--DNYADIAKFPISSTIAVTGKVVYTPDAKQPLEIHADAVVLEGASDSDYPLQ---KKAHTYEYLRTIAHLRPRTNTFYAVFRIRSLAAFATHQYLQAHGFNYLNTPIITGSDAEGAGEMFRVDFFRKETNLTVSGQLEAE-AFALALRKVYTFGPTFRAENSHTARHASEFWMIEPEMAF-EDLDDDIVTIEELIKAVVSYVXXXXXXXXXXXXXXXXXXDEKFARLTYTEAIKELEDADQDFEVPVYWGLDLEAEHERYLCEHIYNKPVFLTDYPKEIKAFYMRANDDGKTVAAVDLLVPEIGELVGGSQREERRDVLAEKIKDNHMSEEEYGWYQDLRKYGETVHSGFGIGFERLVMYVTGMKNIRDVIPYPRTPG.... 460
53 0.000e+00UniRef50_A0A0G1BV11 Aspartate--tRNA ligase n=4 Tax=Parcubacteria group TaxID=1794811 RepID=A0A0G1BV11_9BACT  ali  34  1MTNRILIKDLH-QHIGEEVEIAGWVDVRRDHGKLIFIDLRDASGKVQMVALPS--NEEAHKIAGNLRPEWVIRVDGIVNARPEKMIGELEIEIKEIEILSEAKELPFD--KDTELNLDTYLDYLPLTLRTKRSSDIFKVQATILEAYRESLRKQGFTEFQSPALVGGDAEGGSAVFSVDYYDKKAFLATSPQFYKQI-MVGAFERPFTIAKVFRAEKSATTRHISEITQMDFEMGFIKNHLEPMAILEQAVKDSVEAVASNHPNIFKEFNTEKPLLPKHFPILTLLEAQEILKEFGIKAIGELDMEPEHERQICEWAKKNKDSDFVFITHFPTDKRAFYTYADPTNPKLSLSFDLLFRGLEINSGSQRIHNYDELVEKIKSRGMDPKKFSYYLQIFKYGMPPHGGSSTGLERFTARMLELSNIKEATSFPRDMNRID. 439
54 0.000e+00UniRef50_D2V7Z1 Lysine--tRNA ligase n=1 Tax=Naegleria gruberi TaxID=5762 RepID=D2V7Z1_NAEGR  ali  25  65...TSNIKEYKEKYDDVEECIAGRIISKRKSSKLFFYTIRDHSHQVQIMTSNRTTDETNFSLINTLRKGDIIGIKGFPAKSGKGELS--IIPKQITLLSPCLHQLPHKVSYSEGTDIEKRFRYRYLDLLTNELYNIFLIRNKTMSFIRNFFTNKGFLEVETPILSEKSGGANAKPFETHLNDMDLKLRIAPELYLKQLVIGGMDRVFELSKVFRNEGMDST-HNPEFTSCEAYQAF-ADYNEMMDMTEEFFRQIVTEINGSPILKVDDIGE--IDFSKPFRRVSFIDSIEICKKHKVKYSTEKVNYGYLLDKLLGTFVEPECVQPTFIMDHPVDLSPLSKS-HRDSSLITERFELFIGTKELCNAYTELNDPEDQRERFRKQQDDEENDEAFCKALEYGLPPTGGWGIGVDRLVMLLSNQKSIRDVLLFPMLKPK... 546
55 0.000e+00UniRef50_A0A2H9QEE8 Asparagine--tRNA ligase n=2 Tax=unclassified Diapherotrites TaxID=1046942 RepID=A0A2H9QEE8_9ARCH  ali  31  3.EKTEFIS-IKKAFEKKSISVRGWIKRKRELKDKIFVLLRDETGEMQCIIESDKIEKKDFEELQKNSIEASIELKGKLKEDSRAPNGFELMVNESKIIGSSE-----NFPIQKDLSEEFLLDVRHLWMRSSRMTSIMKIRSTMLYAVREFYKKENYFECSPAIITPNACEGGTTLFPLKYFGEQRFLSQSGQMYLEVMIFA-LGKVFSLTPSFRAEKSKTARHLTEYWHLEGECAWM-NMDDQMGEIEKMVSFICQKIAKENPVELKQLGRDPKDLEAPFSRISYDEAIDVLKKYKTKIPWGTDLSIKEEKILSEDEK-----IPFFIYDYPTAIKAFYAKETA-DPKKCFSFDLIGPYGELCTGGQREDVNENMLKKLKKEKIPLENYNWYLDLRKYGSVPHSGFGIGIERLLRWICKLDSIKETIPFPRTMNRSYP 432
56 0.000e+00UniRef50_A0A1E1KJD6 Lysine--tRNA ligase n=7 Tax=Dikarya TaxID=451864 RepID=A0A1E1KJD6_9HELO  ali  23  121...........EHKKDIEIRIGGRIFNKRASGKLVFYDVVDSGVKVQVMCEAKSDGVPFEQQHEHLRRGDIIGIVGYPGRTAPKEGELSIFATEIILLTPCLHQLPDEYYGFK--DQEQRHRKRYLDLMNQPTRNVFITRSKMITYIRRYFDEQDFIEVETPMMNPIAGGATAKPFKTHHNDMDMFMRVAPELYLKMLVVGGLNRVYEMGRQFRNEGIDLT-HNPEFTTCEFYMAY-ADVYDIMDMTEVLVSGLVKHITGGTTTKYQSGEEFEVNWAAPWKRVEMIPALEILKKMKVDCSPPLTNARMLDKLVGE-FIEETCINPTFITGHPQMMSPLAKY-HRSNPGLCERFEAFVCKKEIVNAYTELNDPFDQRLRFEEQGDDEAQMENFCQSLEYGLPPTGGWGMGIDRLVMFLTDNYSIKEVLAFPFMK..... 584
57 0.000e+00UniRef50_A0A0S8DPQ3 Lysine--tRNA ligase (Fragment) n=2 Tax=root TaxID=1 RepID=A0A0S8DPQ3_9BACT  ali  20  32..KSSAIKELVQNFEGKEVSVAGRIMAIRSHGKSSFIDIKDSTGKIQGYIKSDVVGNDGYWVFENLDIGDIVGLKGKTFKTKTQEPT--INVSEITVLSKSIRPLPEKWHGLK--DIELRYRQRYLDLVNKEVREIFELRSRLISRIRTFLDGKGFLEVETPMMQPLPGGATARPFKTHHLGVDLYLRIAPELYLKRLLVGGFEKVYEINRNFRNEGI-SPRHNPEFTMLEVYAAY-ANYQDMMELACELILDAAKHIFGKYKVNYKDGD---IDLSPPWANLTFHEAVTKYAGIDYKAEKDTKLEEEVVNKIFEKFVEPKLIKPTFVIDYPARLCPLSK-RKPDAPDLAERFELFIGGQELANAYSELNDPLEQRARFEEQ........................................................ 419
58 0.000e+00UniRef50_G4LWW1 Aspartyl-tRNA synthetase, putative n=18 Tax=Opisthokonta TaxID=33154 RepID=G4LWW1_SCHMA  ali  26  113......IRDLQTLYH-QRVCVYGWVHRIRRQSKLMFIILRDGTGFLQCVFSNNLCLTQD---AITLSPESTVEVYGVVKQLPSGPGGIELVADGWAIIGKAPAG-GIDSVLTVESDIDTQLDNRHLVIRGENTAKVLRLVSVALEAFRAHFVDRGYVEVLPPTFVQTQVEGSATLFSLNYFGETAFMSQSSQLYLETCIPA-VGDCFCITRSYRAEKSRTRRHLSEYNHVEAECPFI-DLNGLLERIEDLVVDVCDRIMKRSGDLLLDVNPQFKTPKRPFKRLKYEDAIVYLNNLGITKEDTPFQYGDDIPEAPERRLVDTIGEPVLLTNFPAGLKVFYMLRTKGDERLTDSVDLLVPGGELVGGSMRVDDIDNLLKGYQSEETDPTAYYWYTDQRKFGTCPHGGYGLGFERFCTWLLGKDHIRDVCLYPRFMGRCRP 543
59 0.000e+00UniRef50_C3ZZX4 Uncharacterized protein (Fragment) n=4 Tax=Bilateria TaxID=33213 RepID=C3ZZX4_BRAFL  ali  27  1......................GWVRSIRAQKDVLFLHLNDGSCLLQVVGTPDMGS-------SGLSYGSAVAVEGRLFPSAHPGQDVELHADRLEVIGSCNVKE-FPFKAKKRHTMEYSRQFPHLRARTNSFSALLRIRSQAASAIHKFFQDEGYIEVHTPVISSNDCEGAGELFQVHFFDVPAFLTVSGQLQLEV-MASALSRVYVFGPTLQQESC-----LSEFYMVEAELAFTQQQEDVMEVIEMMVKQPTEQILALCPEDLHLFYKFVSPLTSRFIRMTYTEAIQILKKNSENFQFTPEWGHDLQKEHERHLVRHCGSVPVFVTDFPKELKPFYARDNDDDKTVAAFDLLVPEVGELFGGSLREERLEILQDRLDRLGLS-NSYQWYLDLRRYGSVPHGGFGMGFERYLQCILGVPHIRDVIPFPRFPHSC.. 421
60 0.000e+00UniRef50_A0A058Z8S2 Asparaginyl-tRNA synthetase n=1 Tax=Fonticula alba TaxID=691883 RepID=A0A058Z8S2_9EUKA  ali  29  85..............EQQPVHVGGWVQTVRRMKRDLFLELSDGSTAIQVILPRDSVAADMSDTADGLATGVSLEVRGRLTPSPGKNQTFELLADGVNILGLARSTFPLQ---KKFHRPEFLRDISHLRPKTRNFGSVLRVRDASSKSMHHILDNLGFVHIHTPILTTNDCEGAGETFEVHYFGSPSYLTVSGQLQLEAA-ACGLSRVYTFGPTFRAENSHTSRHLSEFWMLEAEVAFIRSIQDIVGLTSTLFRSNIAAILSRCPEDLEHLEKNPPDGPNPFPVITYTEAIDILEREAPPLAWGDNLSSDHERFLCERV---FAGQPVYVVDYPQALKPFYMRQNDHRPTVAAMDMLVPGVGELIGGSVREERLDRLEQAIAGAGLCPEAYAWYTDLRRYGTVPHGGFGIGFERLIMVLTGMTNIRDAIPFPRYPGRC.. 580
61 0.000e+00UniRef50_R5VWZ3 Aspartate--tRNA ligase n=1 Tax=Corallococcus sp. CAG:1435 TaxID=1262867 RepID=R5VWZ3_9DELT  ali  38  1MKRT-YIKDLTE---GQC-KIKGMVETIRD-KKIMFIVIRDVTGAVQVTIEKDKC-PEVYAEAKKLTPHSFVSVEGEVFSTYVRNGGKEIYPTALEIMSIADV-LPIQ----ADSGQDLRMDYRWIDLRDEKKLFMFKIQTAFEKYAVEFFNKNNFIEIHTPKITALSSEGGSEVFELDYFGQKACLTQSPQLYKQMSMMAGFDKTFEIGEYFRANPSFTSRHDTEFTGIDVEISYIESHHEVMDVEEALLSYIIKGIKNEFNDEYKYFGKDVLDMDVKIPRIPLYEVYRILKEEKNYEVPKGDLDPDGEKLICQYVKEKYNSDFVFIVDFPAKARAFYSMKHEDNPELTKTYDLLFRGIEITSGAQREHRYEQLKQNIAEQGIDPESMHEYLEFFRYGAPTHGGFGLGLTRTLVRLFELPSVKDVTFLFRGPNRLKP 432
62 0.000e+00UniRef50_A0A255IQA3 Aspartate--tRNA ligase n=1 Tax=Romboutsia weinsteinii TaxID=2020949 RepID=A0A255IQA3_9FIRM  ali  39  1MKRTMINK--LSNYINEEVKIEGWIHRIRTLKSISFFIIRDRAGLVQCVVDNKIIESIEVK------LESVVSIIGKVNESNNKLNSYEVQVKSIEIISSCKEELPIEINKEENINLDTMLDNRVLSLRHERINSIFKIQNLIVSGFREYLTHEGFTEIFTPKLVSQGAEGGSDIFEVKYFENKAYLATSPQFYKQMMVAAGFERVFEVAHVYRAEEHNTNRHLNEYVSMDLEVGFIDNEEDLMDIEENLLKFVIQKIENEGRYYLNLLNVELPNINNSIPXXXXXXXXXXXXXXXXXXXXXGDLDPEAEKLICKYAKEKLGSEFIFLTNYPRKKRPMYTMPCGENE--THSFDLLFRGIEITTGGQRIHEYEALIENIKYKGLDPNNYESYTEVFKYGVPKHGGLAIGLERITSKMLGLKNVREATLITRDRTRLIP 429
63 0.000e+00UniRef50_A0A142XN76 Lysine--tRNA ligase n=2 Tax=Gemmata TaxID=113 RepID=A0A142XN76_9BACT  ali  24  40......IRQLPAENFDETVRAAGRVVRYRTGGKLLFLEIWDQTGRVQLMIRVNKVTPQEWQVAQLLDLGDLVGVDGEFGKTKTGELT--IQVEKLTFLTKSLEPHPKDVFGMG--DIEFRLRHRYLDMITPDTLRRAHQRVKIIRTIRTHLDAQGYMEVETPTLHAIAGGAAARPFETHHNDIDLFVRIALELPLKRLLVGGIEKVYELGRVFRNEGI-SPRHNPEFTMLELYQAY-GDYRSMMDLTEGLIVACVDILGGGRTI---PFGEKTVNFEPPFQRAKYADLF--HEHVGCDMTDEVAVHVVLVQELFEDLVEEKLVGPVFVYDYPSPLCPLTK-RKRENPAIAERFELYVHGMELANAYTELNDPITQEQTFTQQGLSDEDDHDFIRALRHGMPPAGGLGIGIDRLVMLLTNTQTIRDVILFPLLRP.... 495
64 0.000e+00UniRef50_A0A0L6UUV7 Aspartate--tRNA(Asn) ligase n=1 Tax=Puccinia sorghi TaxID=27349 RepID=A0A0L6UUV7_9BASI  ali  34  94......IASLHPERIGERVRIQARVHNSRSQKKNIYILISNISLRRQTMLPRTKKSNSHYDPRHGLETNDQIC-HWHPTRIHRGRRGCRTEADRGRLLGKTLRPTKFRKNKNKNVGTDTRLDNRVLDLRTPVNQAIFRVQSRVCNLFRRYLDEAGFIEIHTPKIQGAATESGASVFKLAYFEQTAFLAQSPQLAKQMAIAADFERVYEIGPVFRAENSNTYRHMTEFIGLDLEMAIKEHYHEAVDLLDGLFISIFKGLQASSTKEIEIIKSQHPLDDFKFLRLRHHEAIQILKDNGHDIEFGQDMGTEQERILGKLIKEKCGPDYYIIDKFPLAIRPFYTMPDPVDPTLSNSYDFFMRGEEIISGAQRIHSAGLLMERMREAKIEPGEMKGYLDGFKLACPPHAGGGIGLERVVMLFFGLGNIRRACLFPRDPKRLTP 587
65 0.000e+00UniRef50_A0A1V5R430 Lysine--tRNA ligase n=3 Tax=Parcubacteria group TaxID=1794811 RepID=A0A1V5R430_9BACT  ali  25  42..KTHNLVDAKVAKERTKVKSAGRIMTRRTMGKIAFCHLQDWSGKCQIVFNINEIGEERFKWFDNFDIGDFIGVTGEVFVTKAGETS--ILVKEYEFLGKALLPLPDKFHGLK--DTDTIYRQRYLDLMNEESKKVFQFRSDFIRAIREFYWQENFSEVETPTFLHQATGATATPYKTHNNDIDLFLRISHELPLKELIVGGMEKIFEIGKAFRNEGVD-PSHLPEHTHLEHYCAY-WNFEDNIKFTERMFDYIFDKLGLEHKIEIEEGKKQLVDFTTPWPRMEYDDAKKLLKDKKIEFEDDDMSLAGLVDNLYKKVSRPKLVGPVILYHYPKYLQPLA-RVNDDDNNIVDQFQMVVNGWEIVKAYSELVDPIDQKERFDKAGGEAEVMEEFITALEHGAPPISGWGMGIDRTVAILTGQNNLRDVVLFPLLRPK... 500
66 0.000e+00UniRef50_A0A2M8EJ22 Lysine--tRNA ligase n=1 Tax=candidate division WWE3 bacterium CG_4_9_14_0_2_um_filter_48_10 TaxID=1975078 RepID=A0A2M8EJ22_9BACT  ali  23  33..RGHLIAKVRKLKLGSKVSVSGRIISLRCHGAITFADLRDETAKIQLLFLGDKLPATNLQLLTLLDIGDFLGASGKTFKTKAGELTVE--VSDFTLLAKSLRPLPSKWHGLKDV--EERYRKRYLDLINPEIRERFNVVFKIVGSMRQFLLSEGYTEVLTPSLQPLYGGTLARPFITRFNDADFYLRISNEMYLKRLIVGGYEKVFEFSVDFRNEGIDTT-HNPEFLQMETMWAY-ADYKDNMELAERMFAAIAKNVLGTTKITYQGKK---INLNPPWRRIPMVKAVEKAQKLGVDVR-GKNLKGQILEEIFDTLVRPTIIQPTLICNYPRDIMPLAK-TVEDDLEYTENFEIFIAGMEFGLSYSEGNDPLLLRENFEAQKLRREGDEGFLEALEYGMPPTSGLGVGMERLLMLLTNTSSIREVMFFPALRPK... 483
67 0.000e+00UniRef50_A0A1V8T9N8 Uncharacterized protein n=6 Tax=Dothideomycetidae TaxID=451867 RepID=A0A1V8T9N8_9PEZI  ali  26  19..................ITVNGWIRSVRKQKKVAFAAISDGSTTLQAVLKPG--------QAEGLSTGTAVRLQGQWVKSSGGKQSHELQVSEVAVLGDNDAEG--NPIQPKYQTPEFLRKVPHLRARTPGNALVLRLRSAVIGSLTRFFDEQGFVQCHTPVITSSDCEGAGEVFTVSFFKDPMYLTVSAQLHLE-ALSHAVDRVWTLSPTFRAEKSDTPRHLSEFYMLEAEQCFLDDPKQVMNVVESMLRAVATDLSAHHSDEVNVVRRWEGLQAADWPRITYDEAIKVLEEANPIFTIQPSYNDGLAAEHERYLATHLGKGPIFITHYPAVQKPFYMSRSPEDPAKAECFDLLVPDCELAGGSMREHNAQALHKAMAAKGVSGEGLEWYMDLRKYGSVKHGGFGLGFDRLICYLSGVSNLRDVVAFPR....... 463
68 0.000e+00UniRef50_A0A1W9U7K8 Lysine--tRNA ligase n=21 Tax=root TaxID=1 RepID=A0A1W9U7K8_9DELT  ali  27  2..............................................................FSFIDIGDHVGLKGQFFRTKTHELT--LLASSVVLLTKSQSPLPEKYHGL--VDIETRYRQRYLDLINDTVRHTFILRSKIIRAIREFFDKQGFIEVETPMMQSIPGGATARPFKTYHLGIDLYLRVAPELYLKRLVVGGLERIYELNRNFRNEGISTN-HNPEFTMLEFYLAYAT-YEDLMDLTEKLFIHLLTKLFNKLTVTYQG---NLIDFATPWQRISLIDSLRDIGGIKESALFDSKTDGRVLAKLFDHIVEPKLVQPTFIIDYPIQVSPLS-RRKDDNPTIAERFELFIGGKEIANAFSELNDPDDQRERFLKQGNDEAMDEDYIRALEYGMPPTAGEGIGIDRLVMVLTDSPSIRDVILFPQMRKK... 392
69 0.000e+00UniRef50_A0A0M0JEH5 Asparaginyl-tRNA synthetase n=1 Tax=Chrysochromulina sp. CCMP291 TaxID=1460289 RepID=A0A0M0JEH5_9EUKA  ali  32  204..............EGTRVVVMGWVKTNRTQKKLCFMSINDGSCHLQLVVTKDEVPEAMWEAATGAGNGASVRVEGCLKASPKEGQKWELPVESIEVLGPSDG--AKYPIPPVKINLETLRAITHMRPRTGVMGAVMRIRNSLAYATHNFFQQSGFMYVHAPLITGADCEGAGEMFQVDFFGKPAFLTVSGQLNGE-YYACAFGSIYTFGPTFRAENSNTTRHLAEFWMIEPEIAFC-DLPKNMDCAESYLRHCFRHVLENNADDLAFLEEFEINVKNDFGRLPYTEAIEIVSKEGVPWEFPPVWGQELQTEHEKYLAEVVYKKPVIVYNYPKGCKAFYMRMNPGKETVAAMDVLFPRVGEMVGGSQREERLDILLAKMAEMGLKEEDYSGYLDTRRFGSQPHAGFGVGFERLVLYATGMGNIRDAIPFPRTVG.... 671
70 0.000e+00UniRef50_A0A1F5EWL8 Asparagine--tRNA ligase (Fragment) n=1 Tax=Candidatus Coatesbacteria bacterium RBG_13_66_14 TaxID=1817816 RepID=A0A1F5EWL8_9BACT  ali  31  8......ISEI-AGHAGETVTLRGWVCGRRESGKLLFLLLRDGSGRIQAVASADDLPEAEFAAASGADLESSCEVTGTVREDKRAPGGFELTVTGFTLIGPSSADYPVQPKGEEAHGVDHLLEHRHLWLRTERQWAILRLRDRAILHLRLFLDAEGYACVDSPIITANACEGTSTLFKLEYFDRAAYLSQSGQLYSE-ATCQALGRVYCFGPTFRAEKSFTRKHLTEFWMLEPEAAFLTH-DENVALQERMVKHVAGKVLDQSADLIEVFGRLEAARDKPFARLTYDEALEKLKAAGEPLAWGEDFGAPHETALGALFDV-----PVFIERWPAVAKAFYMEPDPDDDRYVQCDDLIASGGELIGGSIRAHDPELLEKRIAEHGLDRKAFGWYLDVRRYGAVPHG.................................. 421
71 0.000e+00UniRef50_A0A2E3BZT5 Lysine--tRNA ligase n=2 Tax=root TaxID=1 RepID=A0A2E3BZT5_9PROT  ali  24  27...THSIKQIIKDHTDKTVSICGRVMLKRSAGKLIFFTIEESGNKVQIMLNTYANQDKFISDMEKIHRGDIVGVKGTICKTRKGELS--VLPLEMIILAPCLHTLPKQEVSNVK-DKHILHSSRYLDLMNSSSRETFLKRSQIVHSIRSWLNYNEFVEVETPILASQAGGASAKPFKTFHNEQEMYMRIAPELYLKKLVVGGIPRVFEIGKQFRNEGMDTT-HQPEFTTLEWYMAY-GDYNDLMKMTENLLSFLAMKINKSFKIELDVSENTIINFEPPYAKIDIIEAFKLLESNGIKPKSPITIPRLLDQLIGE-FIEPLCINPTFLMNHPLIMSPLAKY-HRDKPHLSERFELFVNGMEICNAYTELNDPIVQKENFMEQGDDEELDKSFITALEYGLPPTAGFGMGIDRLTMILTNNSTIRDVVLFPTLKK.... 495
72 0.000e+00UniRef50_Q057G7 Lysine--tRNA ligase n=4 Tax=Bacteria TaxID=2 RepID=SYK_BUCCC  ali  21  43....HTIKEIKKEKINYKTKISGRIVNKRTFGKALFFVIRNNNHDIQIYIKSNYFPKNYYKNILELDLGDIIGVKGKIFKTNTCELS--ILCKKIYLLTKSLRSLPDKYFGLK--NQEIKYRKRYLDLINNKIIKIFQKRSLIISNIRSFMKQKKFLEVETPMLHPIPGGANAKPFITYHNNEKMYLRIAPELYLKKLIIGGFNKIFEINRNFRNEGIST-KHNPEFTMMEIYMSY-SNYIDIMNLLEELCIFLVKKISKSLIIMYKSKK---INFKKPIKKMTMIESILKFNKNIDISNFKNIKNGEITNLIFEKTTEKKIIQPTFITEYPIEISPLAKEK---NKYFAERFEFFIAGYEIANGFSELNDPEEQKKRFKLQ-ISKKNYKDYIIALEHGLPPTSGLGVGIDRLIMILTNQKTIKDIIFFPLLKK.... 501
73 0.000e+00UniRef50_A0A292PXU0 Uncharacterized protein n=2 Tax=Pezizomycotina TaxID=147538 RepID=A0A292PXU0_9PEZI  ali  26  40.........LSDEKASETVTITGWVRSVRRMKNVSFAHVSDGSTILQAVLTK--------EQSENLSMGASVKITGEWKESVRGQQSRELLAEKVEVFGEADPLT--YPLQKKYQTPEFLRTLLHLRSRIPANTNLLHLRSGLISTLTAFFAENSFIQCHTPVITSSDCEGGGEVFTIDFFKTPKYLTVSGQLHLETL-VAAVPRVWALGPTFRADKSDTARHLSEFYMLEVEIAFIDTLDPLIALIEDMVKTLIRSISGDKAKELE--ERWRGLLERSWSRITYTEAISRLGSADVQFVSPPVWGAALQAEHERFLAQTVFNGPVFVTDYPKGLKPFYMLPSPEGGETVACFDLLVPVGELVGGSLREHRYDELLAEMRRQGIDEEALRWYLELRKWGSVKHGGFGLGFDRLVCYLAGVENIREAVAFPRWYGRCD. 494
74 0.000e+00UniRef50_F0Y5S0 Uncharacterized protein n=1 Tax=Aureococcus anophagefferens TaxID=44056 RepID=F0Y5S0_AURAN  ali  31  48.......AEAPESLVGTRTVIKGWARTVRAQKALGFLEVNDGSSFLQCVFE----GEAALKELKAVSTGCAVAVEGEIV-TSGGKQAIELKAETLEVVGGCEEGYPLQ---KKRHSLEFLRSIAHLRPRTNTLAAAARLRSCLAQATHRFFEQEGFAYVHSPIITASDCEGAGEMFRVDFFARSAFLTVSGQLSAET-YACAMGDVYTFGPTFRAENSQTSRHLAEFWMIEPEMAFAT-ITEAMDNAEALLKSTIAAALDKCGADLKFCDQFYGDKEAPFVRLKYADAVDVLRAEFPDVEFGTDLATEHERWLAE---THCGGNCVFVYDYPRTIKSFYMRDNDDG-ETVAAFDLLAPGGELVGGSQREERTDKLEAKMVEFGLDPEDYWWYLDLRKYGSVPHAGYGLGFDRLVCYVSAIENIRDSIPYPRYPGSAT. 506
75 0.000e+00UniRef50_A0A1Q7P2U4 Lysine--tRNA ligase n=2 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A1Q7P2U4_9DELT  ali  25  70....................IAGRVVALRTMGKATFLSLRDRTGDLQIFVKKDKVGDQAYEVLKLTDLGDIAFARGRAMRTKTGELSIE--ATEYRLLTKALRPLPEKWHGLTDH--ETRYRQRYVDLANLQVREIFLRRTKLIAGIRRFLDDLDFVEVETPVLHKEAGGATARPFGTHHNDLDLKLRIALELHLKRLIVGGLERVYEIGRVFRNEGID-RRHNPEFTMLEFYQAYAT-YEDLMTLTETMVSHLATEVTGADEVTFQGVK---IKFAPPWPRISMLDALARLSAGQWLAPVEDRQMREKFARLFEALLEPMLDRPSFVVDFPLEISPLARKR-DSETRLVDRFEAFAGGMEIANAFSELNDPRDQEARFREQRGDQETMPWYIRALEHGMPPAAGEGVGIDRLAMLFTDSPSIRDVVLFPLLKP.... 515
76 0.000e+00UniRef50_V2X8S7 Aspartyl-trna synthetase n=2 Tax=Moniliophthora roreri TaxID=221103 RepID=V2X8S7_MONRO  ali  31  103...TFSLDELLSEWEGKQVTFRARIHTHRVVGKLAFLVLRQQLTTIQAVVQVQDSVVSFVRWAERLKHETFIIASGTLSKPATPIQSIELHVTALHLIAEPIESVPFTVYADDHISDRTRMDNRIIDLRTPVSQSIFRVSHTISSAFRTHLDSLGFIEIHTPKLQAGATESGSSVFAVKYFGRKAFLAQSPQLGKQMAMSADFGKVYEVGPVFRAENSNTHRHLTEFTGLDLEMTLEQHYHEALRVIDGTLKHIFKTVYERCRREIDIIKSAYPSEDLVWPVLAFSEGIALLRDSGWDPESGDDLGTRDEIRLGQLVKEKYGTDYFILDKFPAGPRPFYAMPDPKDDRLTNTFDIFVRGQEILTGGQRIHDAQFLEDRMAQLGVQVSALREYCKGFRYGCPPHAGGGIGLERVVMLLLALPDIRHASLFPRDPKSLTP 573
77 0.000e+00UniRef50_F9XND4 Asparaginyl-tRNA synthetase n=48 Tax=Eukaryota TaxID=2759 RepID=F9XND4_ZYMTI  ali  24  33....INIADLLQRNVESEVKVNGWIRSVRKQKRVAFAAVGDGSTILQAVLKP--------EQAADLSYGSAVRLTGSWQASMGGKQSHELQVTDVEILGTNDAE--NNPIQPKYQTPEYLRTIPHLRPRIPANALLLRLRSQVIATITRFFNDEGFVQTHTPIITSSDCEGAGEVFTVHFFRTPKYLTVSAQLHLE-ALAHAVSKVWTLSPTFRAEKSDTPRHLSEFYMLEAEMCFVDDMSSVMDLVESMLRATAVEIKDEPQSEEHLVNADTLMASLSWPRITYAQAISTLQENGQHFTFSPTLQDGLQAEHERYLAQVVGEGPVFVTDYPVAQKPFYMPPSAGTSDTAACFDLLVPDCELVGGSMREYRADALQQAMQDKGVAGGGLEWYQDLRKFGSVPHGGFGLGFDRLLCYLSGTGSVRDVVAFPRWVGRCE. 512
78 0.000e+00UniRef50_A0A0F8WLJ7 Uncharacterized protein n=15 Tax=Aspergillus TaxID=5052 RepID=A0A0F8WLJ7_9EURO  ali  33  524.......SNINDEQYEKEITVVARVDNARVQSKLAFLMLRQQGQKIQAVIAAAEISRQMVKYTGGLNVNSIVQVTGIVKKPEVPIASHEIHIRKVYMIAEAAQQLPMQVKDAERPPPETRLDNRVLDLQTATSQAITWISSGVAELFAEYMIKSGSRWIFTPKLVGAATEGGSNVFEIKYFKRNAYLAQSPQLYKQMCIAGDMENVFEIAPVFRAEDSNTHRHLTEFAGLDFEKTFQSHYHEVLEFAENLLVFILTQLKERYKEQIAIIQKSYPK-AGDFKRLNYMDGVAMLKEAGVDMRFENDFTTNMEKQLGQIIREKYDTDFYVLDKFPMAVRPFYTKACPQDPRFSNSYDFFMRGEEIMSGAQRINDVKELEASMAAKGLDPEGFEDYIAAFRQGCPPHAGGGLGMNRIVMFFLGLPNVRLATLFPRDPQRLRP 993
79 0.000e+00UniRef50_A0A2D5TWB2 Lysine--tRNA ligase n=2 Tax=Proteobacteria TaxID=1224 RepID=A0A2D5TWB2_9PROT  ali  22  33...SHNLSELFADEDHSEVSISGRLMALRGKGKAVFANIQAQHQRLQIYIRKDEVGEASFEVFGMCDIGDYLGLQGTMMYTKTGELT--LRVKSLLLLTKSIRPMPVPKVQEKDRDREFRYRQRYVDLLNPEVATVFRQRNVMMQTIRTYLTEQGFLEVETPTLQPVYGGANATPFITHHLDQNFFLRIANELYLKRLIAGGFDAVFEFTKNFRNEGID-RTHNPEFSALEFYQA-NVDYTAMMEHTEQIFSLCAQALHGSMQFEYDG---QLLDVSPPWKRMSMYEVLQELAGIEVESLDGAWNRGLAVQLLFEEKCETQLIQPIFITGHPKETSPLCK-QHRENPNLIERFEAFINGWELANAYSELNDPQLQRSLMEEQGGESETDEDFIRCIEYGMPPMGGIGFGIDRMVMLLTGQTTIRDVILFPTMRP.... 496
80 0.000e+00UniRef50_T1BN88 Asparaginyl-tRNA synthetase (Fragment) n=2 Tax=mine drainage metagenome TaxID=410659 RepID=T1BN88_9ZZZZ  ali  32  2.................RIRIHGWLVRSRSSGGLLFLVVRDRTGQVQVTARRDVLGEADFDRAEHVQIEGSVDIEGTVAEDRRSPGGRELKAARIRVVQS-----GDPFPVMADQTEEFRLDQRHLVVRSPEMVATFRVKAEILRALREFLSSEEVLEMTPPVLTGNPAEGGAEAFQIDYFGRPGYLSQTAQLYLEALIF-PHERVYGLTPSFRAEKSRTPRHLTEYLHLEVELAWC-DLAELLDFEERMIVAVAHTLADRRPTELRELGRELRALAAPFARLSYDEAIERLRARGFAIRWGQDLGTAEERALTMEEA-----APIFLTRFPKEIKAFYMLETPGNPATVEAADLLAPYGELIGGSCRETDLGRLTARLQATGADLPSYQWYLDLRRYGSVPHAGFGLGVERLVRWITRREHIRDTTPFPRTPSRHTP 415
81 0.000e+00UniRef50_Q9V434 Asparaginyl-tRNA synthetase, isoform A n=207 Tax=Opisthokonta TaxID=33154 RepID=Q9V434_DROME  ali  28  135...............DSRVKVYGWVHRLRRQGKLIFITLRDGTGFLQCVLNDQLC--QTYDAL-TLSTESSVVLFGTLKLVPEGPGGHELNVDYWELIGLA-PPGGADAILNEEAQPDVQLDNRHIMIRGENTSKVLKMRSVVTQAFRGHYEARGYNEVTPPTLVQTQVEGGSTLFKLKYFGEEAYLTQSSQLYLETCLPA-LGDVFTISQSYRAEQSRTRRHLAEYTHVEAECPFLT-FDDLLDRLEDLVCDVVDRVLKSPGYLVKELNPDFKPPQKPFRRMNYEDAIKWLKENNVTKDDGFYEFGEDIPEAPERKMTDTINEPIMLCRFPAEIKSFYMQRCKEDQRLTESVDLLPNVGEIVGGSMRIYDSEELLKGYKREGIDPQPYYWYTDQRVYGTMPHGGYGLGLERFLCWLLNRYHIREVCLYPRFLDRCRP 558
82 0.000e+00UniRef50_M7MMS7 Asparagine--tRNA ligase n=53 Tax=root TaxID=1 RepID=M7MMS7_9FLAO  ali  29  3...SSTIANLSKENTLQDVEVKGWVRTFRA---NRFIALNDGSTIIQCVVDFENTDE---ALLKRITTGAAVHIKGALTESQGKGQRVEIQVSSIDILGDSDPESF--PIQPKKHSFEFLRENAHLRTRTSTFSAVMRLRSALSFAIHKYFNENGFYYMHTPIITGSDAEGAGEMFRVDFFGKETNLTVSGQLEAET-YAMSLGKVYTFGPTFRAENSNTSRHLAEFWMIEPEVAFM-DLAGNMDLAEDFMKSVLSYILKHNREDLEFLENRLLEEEKNFKRVSYTEAIDILKNSKPNKKKKEEWGADLQSEHERYLVEKHFNCPVILFDYPANIKAFYMRLNEDGKTVRAMDILFPGIGEMVGGSQREERLDVLKEKMKALDIDEEELWWYLDLRKYGTAVHSGFGLGFERLVMFATGMGNIRDVIPFPRTPQ.... 473
83 0.000e+00UniRef50_A0A1C3K9R9 Aspartate--tRNA ligase, putative n=30 Tax=Plasmodium TaxID=5820 RepID=A0A1C3K9R9_PLAMA  ali  35  187...........DELMGKKIWTRGRIHDIRSKGSLAFIILRYKFYSLQCIIKHNNNDKNMMKWVSNLSLESIVDIYGKLIKPESTNIKYEIHINKIFCISRTTKEIPFLLKDANKVNQDNRLNNRCIDLRTYANFSIFALQSQICKIFRDFLYQHNFIEIHTPKLLGESSEGGANAFQINYFNQKGFLAQSPQLYKQMCINSGFDRVFEIAPVFRAENSNTYRHLCEYVSLDIEMTYKYDYMENVYFYDSLFKHIFKHLLEKNKMYIKIIKNQYPGEDFKWPIFTYIEAIEILIKHNKLNLKEEDMTTDMEKELGKIIKVSHNTDYYIIVNFPSALRPFYTMYNERDPKISNSYDFFMRGEEILSGSQRISDVKLLINNINLFKLDVNKLNFYVDSFAYSSYPHSGCGIGLERVLMLFLGLNNIRKTSLFPRDPKRLVP 640
84 0.000e+00UniRef50_A0A0L1HD61 Wd repeat-containing protein mip1 n=1 Tax=Stemphylium lycopersici TaxID=183478 RepID=A0A0L1HD61_9PLEO  ali  36 1547...........ASNEDKEITFRCWVENARVQSKLAFLNLRQNLSTVQVVAASDKLSKQMVKFCGNVSTESTLVVTGLVKRVKEPIKSFEIHIQKLFVEASAEIPLPLQVSDAERVSLNTRLNNRTLDLRAKINQSIFVIKSGVCALFQEFLSKKGFVLVHTPKILGAASEGGANVFELKYFGRPAYLAQSPQFYKQMLIASRFQKVMEIGPVFRAENSNTARHLTEFTGLDLEMEFQENYHEVMGVLEDLMLFIFNELNARYSKETELVRGHVEPFKLPVPRIPFQEGIKMLREAGEELGDYDDLTTPQEKKLGRLVLEKYNTDFYTLDQFPLAIRPAYTMPSPADPALSNSYDMFMRGQEICSGAQRIHSSALLADQMRKHDIDPAGTKDYVDCFKYGCPPHAGGGFGLERIVQFWLGLPNIRMCSLFPRDPQRVVP 2012
85 0.000e+00UniRef50_A0A2D4BHZ9 Cyclin-dependent kinases regulatory subunit n=3 Tax=Pythium insidiosum TaxID=114742 RepID=A0A2D4BHZ9_PYTIN  ali  28  22....IRIKELFAAMEGQSVTVKGWGKTLREAGAFAFLELNDGSCFLQVLINRGET-EGFEQALESGGCGASFSVTGT--------------ASKVEVYG-NIPDPATYPMSKKRHTLEHLRQHAHLRPRSNIHGAAMRVRNAMTFATHQFFQTRGFLYIHTPIITESDCEGAGEMFGVDFFDRPSFLSVSGQLNVETHCCA-LSDVYTFGPTFRAENSNTSRHLAEFWMIEPEIAF-ADLTDNINLAEDYLKYCVQYALDHCKEDLDFFNKNVEKMAAPFERISYTDAVNLLTEKAGKFEKKPEWGIDLGSEHERYLTEKVFKKPVVIFNYPKEFKSFYMRLNEDGRTVAACDVLVPNVGEIIGGSQREERLDVLRDRIIESGANPEDYQWYLDLRKYGTVPHSGFGLGXERLVRFVTGIENIRDVIPFPRWPG.... 477
86 0.000e+00UniRef50_Q74MV5 Aspartate--tRNA ligase n=1 Tax=Nanoarchaeum equitans (strain Kin4-M) TaxID=228908 RepID=Q74MV5_NANEQ  ali  44  8....................IKGWVHKVRDLGKIKFLLIRDGYKIMQAVIKKGESPDYLLDL--DIPIESAVEIEGEERETNGKK---EILVKDLKILAKAE-PLPIDP---KKATPKKRFDYRIIDLKLPERQTLFRLRAKVQKFFRDWFMENGFVEINTPKIVIIGAESGAEVFPVLYFGKEAYLTQSPQLYKQM-MVSVFPKVFEIAFAYRAEPSRTSRHLAEFTSVDAEMGFIKDEYDVINTIKKMLIDVSEKAMQT-----KEFEELAKPIDLGFEIITFDEAKEIVKGN-----PNEDLTTEEERKLGEHFMEE-GVSFVAVTKYPWSERPFYTMRLDDNPSYTRGFDIIFRGLEIISGAQREHRYEKLLENIKEKGIDPNKLEYYLMAFKYGMPPHGGFGLGLERYLRQLLGLDDVREVILFYRDIDRLLP 404
87 0.000e+00UniRef50_A0A1F9TW74 Lysine--tRNA ligase n=2 Tax=unclassified Elusimicrobia TaxID=1797919 RepID=A0A1F9TW74_9BACT  ali  25  52.................KVRIAGRMMTRRDMGKACFAHLQDGAGRIQIYVRKDVLGEAAFESFKDLDLGDWLGAEGLVFRTKTGEIS--IRAEKIELLSKALRPLPEKWHGLK--DPEARARQRELDLLNEDSRAVFASRSRIIQTLRTLLAARDYMEVETPMMQQVPGGAVARPFETFHNKQKFFLRVAPELFLKRCLVGGFEKVYEIGRVFRNEGIDT-FHNPEFTILEAYEAY-GNIDTMMDLTEYLVTGAAEAASDKCR-------------KKPFARRSIPELFKEY--VGKDYTAFMDEHKAFDHAFDEKIV-PHLTEPTFVTDFPAELSPLAKLR-ADNPRLTERFELYVDGGEIANAYSELNNSEEQRRRLVEQGSEKEEDESFIEALEYGMPPAGGLGIGVDRLVMLFTGQTSIRNVLLFPTLKK.... 462
88 0.000e+00UniRef50_L1JKJ1 Aspartyl-tRNA synthetase n=2 Tax=Guillardia theta CCMP2712 TaxID=905079 RepID=L1JKJ1_GUITH  ali  36  27..RYLSSSELDGLPEGESFWIRARVQQSRVKGNTVFLVLRLQGVTVQALFKSDSVTKDMIRFCGSIPRESVVDVQGKVAATSCKVTTYEVHVQRIYCVSRAAPALPLLLEDAARVNLETRLNERVLDLRSPSHNSIMRIQSHVGQAFRNFLAARGFVEIHTPKLQGSSCEGGAAVFPLDYFGSKAWLAQSPQLHKQMAVMSGFERVMEVGPVFRAESSHTSRHLCEFVGLDFEMEISESYAEAMDIVEGFVVTLLEELYHS-----QPLSSHVDEVAKQYPCKRLREAVDLLNDRGCTNEDGKDLSTQLERLLGEIVAEKHETDFFFITDFPSGVRPFYSMPSSSDPSSSNSFDAYLRGQEICSGAQRIHDSSLLVESLKSRGIDPSSMQPYINSFKYGGSPHAGAGLGLERLTMTILGLDNIRLASMFPRDPKRLSP 490
89 0.000e+00UniRef50_A0A136LXR3 Asparagine--tRNA ligase n=1 Tax=candidate division WS6 bacterium OLB20 TaxID=1617426 RepID=A0A136LXR3_9BACT  ali  29  220..RIASAAELDADYTEKEITVHGWVYNIRSSGKIMFLQIRDGAGDIQTVIEEEKTGKDVWDAANELTIESSLQITGIVHADERSPFGYELEVTGIKIIQVS----PEYPIGRKEHGPDFLLDNRHLWLRAQSQRAVMRIRDEIFWSITSFLREEGFVRFDTPIFQPVSCEDTSELFEVDYFGEKTYLTQSGQLYSEAAEMA-LGRCYDFGPVFRAEKSKTRKHLIEFWMMDAELPFTT-LDGLMDFEEAMLKRIISDCLKNTARELSILERDTAKLKKPFIRMPHKEVIALLNQNYSALSELDDIGAPEEAQLSELYDV-----PVFIYDWPAEIKAFYMPKFKDTLERVRAVDLVAPGGELMGGAEREFDYNKLLTELEKRNYDYKDYEWYMDLRKYGTIPHSGFGIGLERTVRWISGIKHIRESIPFPRMLNRLYP 662
90 0.000e+00UniRef50_A0A1X0NQW4 Lysine--tRNA ligase n=1 Tax=Trypanosoma theileri TaxID=67003 RepID=A0A1X0NQW4_9TRYP  ali  23  98.HRDYTIPAFKAKFAGERVTIAGRIINKRSSGKLHFITLQGDMEVVQVISTGDYVNDGFADIHAKIKRGDIIGVKGVASLSKTGEFS--MSAMEITLLSTCFHMLPDDWYGLS--SVEQRFRQRYLDLINRENANVFILRSKIIKYIRKFFDDLDFLEVETPTLNLIAGGAAARPFITHHNNQKMYLRIAPELYLKELVVGGLDRVYELGKQFRNEGIDLT-HNPEFTSIEAYWAYM-DYNDWMNTTEELLYGLAMHIHGSPLVKYAPRDSEVFNFNKPFKRLHIAEAMDLCKKHKVEC-NPPFTTTRLLDALIAHYLEPECHDPTFVCDHPRIMSPLAKW-HRNDPRLTERFELFINKKEICNAYTELNNPIVQREEFKKQGDDEAMDESFIQALEHALPPTGGWGMGVDRLVMYLTSQSNIKEVLLFPAMKP.... 574
91 0.000e+00UniRef50_R1G3L7 Lysine--tRNA ligase n=1 Tax=Candidatus Nanobsidianus stetteri TaxID=1294122 RepID=R1G3L7_9ARCH  ali  22  39..KTNDVKEIVDKFMDKYVKIAGRVYSVRKHGGIVFYDIKEEGYRIQVVIKKD-ITKNFEDAYEFIQRGDIIGVYGKVGRTKAGELS--VFAEDWIILTKSLISLPDQWYGFTDV--EERYRKRYLDLMNDEVRRYFEIRFKTISYVRKYFENLGYIEVQTPVLQPIYGGANAKPFITYVNDLKEYLRIATELYLKRYLVGGFNKVFEIGPDFRNESIDVT-HNPEFTMLEAYEAY-ANRDKMMEIVENLIYGIAKDIIGKDYIEY---NGKKISLKPPWRRLTMYDALKEYKQNNIQLELKEYNRGLAITALFEELVEDRLIEPTYIIEHPKESTPLCKL-SRKDPSLVERAEGYILGVEVTNIYSELNDPILQQAKMRELGFEEAHDQDFVEALMYGMPPTGGIGIGIDRVIMLLLGIKSIKEIIPFPMVKKKTE. 493
92 0.000e+00UniRef50_A0A2G9N937 Aspartate--tRNA(Asp) ligase n=1 Tax=Candidatus Woesearchaeota archaeon CG10_big_fil_rev_8_21_14_0_10_32_24 TaxID=1974457 RepID=A0  ali  40  1MERT-LIKDL-KDYIGKEVLLKGWVSEMRNLSKVKFIILYDRTGDIQSVANK-TTEEASFSAIDDISKESVIELIGTVKEHPESKWGFEVVIKKVTVIAVAEIPLPVDPSEKSQTHIDKRLDYRFLDLHSKRTQSIFKVQSTILQGFRDFMYQEGALEVTLPSIIGASSEGGTDLFTIKYFEKEALLSQSCQLYKQML-ACSMEKIFTVFTAWRAEKHNTVRHLNESRQFDYEEAFAGD-KRVMAVLTQCVQFMIKKVLQDRKKELEFLGVDLKVPKEKY--ITFEEVREIMKREGIEMPAHD-LSGEAEKKLG--VLYPHTI--VYVHEWPLEGKPFYIMPHGKN---SKGFDAIWQGMEITSGGQRVHDPKLLEERLKAQGLDLAAFKDYINSFRYGAPPHAGWGLGLERFTMLMLGLDNIREAVLFPRDRDRLTP 423
93 0.000e+00UniRef50_H2NET2 Asparaginyl-tRNA synthetase 2, mitochondrial n=11 Tax=Amniota TaxID=32524 RepID=H2NET2_PONAB  ali  28  41...............GERIKVQGWIRSVRSQKEVLFLHVNDGSSLLQVVADSGLDSRE-------LTFGSSVEVQGQLIKSPSKGQNVELKAEKIKVIGNCDAKD-FPIKYKERHPLEYLRQYPHFRCRTNVLGSILRIRSEATAAIHSFFKDSGFVHIHTPIITSNDSEGAGELFQLEAF------TQ----------------VFTFGPTFRAENSQSRRHLAEFYMIEAEISFVDSLQDLMQVIEELFKATTMMVLSKCPEDVELCHKFIHMLKNNFLIISYTEAVEILKQASQNFTFTPEWGADLQTEHEKYLVKHCGNIPVFIINYPLVLKPFYMRDNEDGPQTVAAVDLLVPGGELFGGGLREERYHFLEERLARSGL-TEVYQWYLDLRRFGSVPHGGFGMGFERYLQCILGVDNIKDVIPFPRFPHSC.. 443
94 0.000e+00UniRef50_A0A0P5DIM2 Asparagine--tRNA ligase, cytoplasmic (Fragment) n=14 Tax=Eukaryota TaxID=2759 RepID=A0A0P5DIM2_9CRUS  ali  31  98..........LEPLRGQRVKVFGWVHRLRRQGKLMFITLRDGTGLLQCVLSDQLC--QTFDAV-TLSTESSVQLFGTLKLVPEGPGGHELNVDYWKLIGSA-PPGGAEALLNEDAHPDVQLDQRHMMIRGENTSKVLRLRSVITQAFRDHYSSRGYNEVAPPTFVQTQVEGGSTLFELNYFGEKAYLTQSSQLYLETAIPA-LGDVYCIAQSYRAEQSRTRRHLSEYSHVEAECPFISLEDLVVDVSERVMASPFANL-------VLELNPNFVVPKKPFRRMNYSEAIVYLKENGITKEDGFYEFGEDIPEMPERKMTDKINEPIMLCRFPAGIKAFYMKRCPEDRQLTESVDLLMPGGEIIGGSMRTDDHDELVEAFKAADIDPTPYYWYIDQRRFGTSPHGGYGLGLERFLCWMLNRFHIREVCLYPRFLDRCKP 526
95 0.000e+00UniRef50_A0A0G1QMX5 Aspartyl-tRNA synthetase n=1 Tax=Microgenomates group bacterium GW2011_GWA2_46_7 TaxID=1618502 RepID=A0A0G1QMX5_9BACT  ali  35  2..RT-LISE-TPKKVGAQVIVQGWVHGIRKHGKITFFDLRDRTGLLQVVTDQNI----------ELKPEYVVAVTGKIVARPEKSGTVELQATTITLLASSAPLPFDMNKEVLDVTLPTLLDYRTLTLRHKRINNIFRVQEAVMEGFRRAAQQLGCVEVFTPTISASATEGGAEVFRVKYYDHNAFMIQSPQLYKQM-MVPAFERVYLTSHAYRAEPSVTSRHLSESTQMDCELAFV-DFTELLDALELVGRETVKYVATTHPQILQEFGIEPPKAPTHIPRLTMREAQKILDRTGVDHTQELDLMPEDEREICKWALEKHESDFVTITHYPTKKRAFYTMPDPANPEYSLSYDFLFRGLEILSGSQRINKHDELLAAIKDRGMNPANFKMYLQAFEYGMPPEGGFSFGLERLTMLLLGLSNVREASLFPRDMERVD. 430
96 0.000e+00UniRef50_A0A2T9Z002 Uncharacterized protein n=1 Tax=Smittium simulii TaxID=133385 RepID=A0A2T9Z002_9FUNG  ali  29  545............SFRNQRVKVPGWVHRLRVQGKFMFIVLRDGTGILQCILADRLC--HTFDAI-TLTLESTVMLYGVLNEVPEGPGGHELIVDYWEIIAKAPGGEAVTNKVNSESDPSVMYTQRHLVIRSDTHSATLKLRSYVLKAFRTHFDSIGYLEVTPPCLVQTMVEGGSTLFSLPYYGETAYLTQSSQLYLESCVPA-MGSVYTISESYRAEKSNTRRHLSEYSHCEIEAGFI-DFNDLLNIIENMICGVTDILLNDSAAFIKQLNPDFEAPQRPFMRMRYSDAIIWLNEHGIKREDGDFEFGDDIPESPERLMTDTINRPIMLTHFPGPIKSFYMPKDKEDPRVTESVDLLPNVGEIVGGSMRISNYIDMIAAFKSAGLAPENYYWYLDLSKYGAFPHGGLGLGIERFIAWIANRYTIRECCLYPRFPGRCQP 974
97 0.000e+00UniRef50_A0A2G7G9F3 Lysine--tRNA ligase n=1 Tax=Aspergillus arachidicola TaxID=656916 RepID=A0A2G7G9F3_9EURO  ali  23  118...........DQLPDKTVRIAGRIYTKRSSGKLIFYDIRAEGVKVQVVCQAQNAAGDFEAQHEHLRRGDVVGIVGFPGRSPDGELS--IFASEIVLLAPCLHAIPSEHYGFQ--DKEQRFRQRYLDLMNDRSRNVFVTRSKIVSYIRNFFDTRDFVEVETPMMNAIAGGATAKPFVTHHNDLDMFMRVAPELYLKMLIVGGLERVYEMGRQFRNEGIDLT-HNPEFTTCEFYWAY-ADVYDVMNLTEELVSGLVKHVTGGYETVFQTGEEYNVNWKAPWRRVEMIPALEEATGEKFPPGDPPLTNARMLDKLVGEFIEETCVNPTFITGHPQMMSPLAKY-HRQNVGLCERFEAFVCKKEIVNAYTELNDPFDQRLRFEEQGDDEAQDENFCTSLEYGLPPTGGWGMGIDRLVMFLTDNYSIKEVLAFPFMK..... 576
98 0.000e+00UniRef50_A0A0J5SK79 Aspartyl-tRNA synthetase n=13 Tax=Eurotiomycetidae TaxID=451871 RepID=A0A0J5SK79_ASPFM  ali  34  522.......SELGEDHYEKQVTVVARVDNARVQSKLAFLMLRQQGKKVQAVIAAAEISRQMVKYTGGLNVNSIVQVTGIVKKPSSATLSLEIHIQKVYMISEAAQMLPMQVKDAERPPPETRLDNRVLDLQTETSQAITWISSGVAELFAEYMIKSGSRWIFTPKLVGAATEGGSNVFEVKYFKRNAYLAQSPQLYKQMCIAGDMESVFEIAPVFRAEDSNTHRHLTEFAGLDFEKTFRSHYHEVLEFAENLLVFILSQLKERYKDQIAIIQKSYPK-AGDFKRLNYMDGVALLKEAGVDVRFENDLTTAMEKQLGQIIRDKYDTDFYVLDKFPMAVRPFYTKACPQDPRFSNSYDFFMRGEEIMSGAQRINDIKELEESMIAKGLDPEGFEDYLAAFRQGCPPHAGGGLGLNRIVMFFLGLPNVRLASLFPRDPQRLRP 991
99 0.000e+00UniRef50_UPI000837F386 aspartate--tRNA(Asn) ligase n=1 Tax=Parachlamydia sp. C2 TaxID=1414722 RepID=UPI000837F386  ali  36  1MAR-ILASDL-SHYLNQPVELRGWLNNVRAFGKLNFLILRDRSGFAQIVIE----DKAEYQKIASLQAGSVLRVKGTAVPSSHAELGVEVIQPSLEVEVPVEAPLVEYYKPEIPSDLEFILDHRPIALRNRQLQAVFKIQAEMTHAFRLYMHDVKAVEYFAPNMIGASSEGGCEFFNVDFFGYPATLAQSSQLYKQI-MVGVNERVYALMPFFRAENSNTTRHLTEGKQFEFEMGFFEDWHEILDVQEGCLKFMINHLQTTCAPEIKTLGNQLVPLNVPFPRLTFAEAQEIYKRTGIDERQEPDLSPAAEKELCRYAFEEFGTDLIFITDWLTSKRPFYAYPTDGHPILSNTFDLLCGGTEITSGGQRRHMYDSMIEGIKSKGMDPANFTDYLSIFKYGMPPHGGFGMGLERLTMTLLGLKNIREASLFPSDPKRI.. 434
100 0.000e+00UniRef50_Q9RXE1 Lysine--tRNA ligase n=43 Tax=Deinococci TaxID=188787 RepID=SYK_DEIRA  ali  23  70............KWEEESYSLAGRVTLMRHMGKAAFADLSDEDGKIQLFFSKQDT--AGFDATKKIDLGDIIGVKGHPFVTKTGQLT--LHVTEWQPLVKSLHPLPSKFHGLQ--DEELRARRRYVDLMTEGAREKFQARSRMIRYIRNELDERGFMEVEGPTLQVTAGGAEARPFMTHHNALDFKLRISLELYLKRLLVGGFERVYEIGRVYRNEGID-RTHNPEFTMLELYWAY-ADYSDIAKLVEDLLSGLAKEVHGSYQFEYQG---KTLDFTPPFARVDYREHVDRLRADERFPQWKGVPSYKLLDKLFGEFVEPLLSNPTFVMDHPAVISPLAK-KHRSRPEVTERFEVFCSGFELANAFSELNDAFDQRERFEAQGDDEAQDEDFLLALEYGMPPAGGLGIGIDRLAMLLTDSDSIRDVLLFPLLRP.... 507
101 0.000e+00UniRef50_A0A0G1E829 Lysine--tRNA ligase n=4 Tax=Parcubacteria group TaxID=1794811 RepID=A0A0G1E829_9BACT  ali  25  41.QRSLSLDEVLARFDQNEVTVIGRIRSIRLHGGSCFAHLEDESGKMQAYFKRDETGLEPYKFFQTIDVGDFIQVSGGLFRTQRGEKT--LLVKSYRLLSKSLLPLPEKWHGL--ADVETRFRKRYLDLLNPEVKEIFKKRSRVIRFIRDYFQNDGFMEVDTPILQAVASGAIARPFKTHHNNADMYLRVAPELYLKELVIGGYEKVFEIARCFRNEGID-YAHNPEFTQIEFYWAY-QDYAGLMAYMEKFMARLVEEICGSTKVEYDG---QTVDFAGPYARVDFRQA--LLEEIKIDLDEHDWGKGKLADELYKKFVRPKLINPTYIINHPLELSPLAK-KIKDRPNYVERFQLIVGGRELMNAFSELNDAVDQAERFKGQGDDEAMDDEFVEALKYGLPPTAGLGMGIDRLVNILTQTHNIKEVILFPTLRPVC.. 496
102 0.000e+00UniRef50_D2V1S9 Lysine--tRNA ligase n=2 Tax=Eukaryota TaxID=2759 RepID=D2V1S9_NAEGR  ali  25  165.KYSHLAAEQRVQ--EETVALAGRIITSRPTGKLVFYHIRAEGEDLQVMISDYAEGEDAFKKVHSLRRGDIIGINGFAGKSKKGELS--IIPTKITLLTPCFHMLPKEHYGLT--NQDTRYRQRYLDLMNKKSRDIFVTRSKIIAHLRTFLNERGFLEVETPMMNMIPGGANARPFTTYHNDLEMYMRISPELYLKQLVVGGLERVYEIGKNFRNEGIDLT-HNPEFTACEFYMAY-ADYNDLMKITEELLSEMALVANGKDPKNLPSVVPDVVNFRPPFKRLPMTELVDLLKKNKVDCSPPMTTARMLDKLVGEYL-EPECINPTFITEHPQIMSPLAKW-HRDNKVLTERFELMIIGKEVCNAYTELNQPFIQRERFEDQGDNEAQFEDFCKSLEYGLPPTGGWGIGLDRLTMILSNNYNIKEVILFP........ 635
103 0.000e+00UniRef50_C5PGT1 Lysine--tRNA ligase n=9 Tax=Eukaryota TaxID=2759 RepID=C5PGT1_COCP7  ali  22  123...........EQLREKEIRIAGRIYTKRSSGKLIFYDIRAEGVKVQVACQAQETTSDFEAQHEHLRRGDIIGIIGFPGRTSPKDGELSIFAKQVILLTPCLHQIPSEHYGFK--DQEQRFRQRYLDLMNDKSRNVFITRSKIISYIRRYFDERDFVEVETPMMNAIAGGATAKPFITHHNDMNLFMRIAPELYLKMLIVGGLERVYELGRQFRNEGIDLT-HNPEFTTCEFYWAY-ADVYDLMNVTEELVSGLVKHVTGGYETVFQTGEEYKVNWKAPWKRIEMIPALEEATGEKFPPGDPPQTNARMLDKLVGEFIEEKCINPSFITGHPQMMSPLAKY-HRDHIGLCERFEAFVCKKEIVNAYTELNDPFDQRLRFEEQGDDEAQDENFCTSLEYGLPPTGGWGLGIDRLVMFLTDNYSIKEVLAFPFMK..... 581
104 0.000e+00UniRef50_A0A2S8FXP9 Lysine--tRNA ligase n=4 Tax=Blastopirellula marina TaxID=124 RepID=A0A2S8FXP9_9PLAN  ali  22  252.............YNGPKVRVAGRIVLMRPTGKLIFINLVDRTGTIQLFLGQAQVGERNWDIAQCLDLGDIIGVDGELKKTKTGELT--VFVEELHFLTKTLEAPPEKHKGLT--DPELRQRMRYLDLAGDGVLDRFVQRTQIVRSIRDTLVGEGYYEIEGPTLHTIAGGAAARPFETFHNGMPLVMRIALELHLKRLLVGGMERVFELGRVYRNEGI-SPRHNPEFTMLEVYQAF-GNYETMMELTENIIKNALDAIGSSYKV---PFGDKEIDFTPPFARKCYSDLLAEHAGIDPELETDGKHPDVLRNEIFEETVEDKLIGPVFVIDYPASICPLTK-RKADNPAVAERFELFIQGMELANAYTELNDPDLQEKLFRTQGMDEEDDTDFVRALRNGMPPAGGLGIGIDRLVMLLTNSATIREIILFPLLRH.... 685
105 0.000e+00UniRef50_A0A2J4G9T4 Asparagine--tRNA ligase n=7 Tax=Archaea TaxID=2157 RepID=A0A2J4G9T4_9CREN  ali  38  9......ISEALKLQPGAEVRVRGWVYRRRDLGDKAFVVVRDSTGIIQSVFTPESRS---HAEARRVTVESSVVVQGKLREDPRAPGGKEIQGEELVIIGLAE-----NFPIRRDASREFLLNVRHLAVRSRKMTAVLKIRHTVFGALHEWFRENGFYEVQCPMFISAAVEGGATLFPVKYVDETVYLTQSSQFYLEALIFS-LEKVYTVAPSFRAEKSRTRRHLTEFWHAEAEVAWVG-LEGILKVEEELVSHIVRRVLERNREELDLLGRNLEGLKPPFPRVSYDNAIEILQSKGIQVAWGDDLGADEERALTLEFDK-----PFFLYGFPEKSKAFYHKNDPSRPEVTLSADLLAPEGYGEIIGGRIDRLDELVEKIKRFGFNPKDYEWYLDLRRFGTVPHAGFGLGMDRLVMWIGGLEHIVDSVPFPRTVARTYP 431
106 0.000e+00UniRef50_A0A1I5VZC3 Asparagine--tRNA ligase n=1 Tax=Lachnospiraceae bacterium XBB1006 TaxID=1520827 RepID=A0A1I5VZC3_9FIRM  ali  31  16.............LDGQDVTVTGWVKNKRIGKAVAFLEISDGTTIIQIVVEEACYPKLSF------GIGACVEICGTLLCTPEAKQPFEVKAKDITVLGEVDETFPIQ---KKSHTNEFLRTIPHLRPRTNLYAAVFRTYSVMMRGITKFLDEEGFVQIHTPIMTACDGEGAGEVFRLKFYGQEAYLAVTGQLHLE-AMALSLRKVYDFCPSFRAEDSNTPRHLAEFWQVEPEIAFCT-LEDLIPFIESFCKSVISYCMKEASEELAFFDRFVEPVFSKFARISYEEAIELLMKSGKTFALPAAPGEAIHTEHERYLADEVFRCPVFVTDYPKEQKAFYMHQNDDGKTVAATDLLFPQIGEIVGGSQREDRLEQLLTRIRECGLSEEDYGWYCDLRRFGSAPHSGFGLGTERLMRYITGMDNIRDVVPYPRTPGGI.. 441
107 0.000e+00UniRef50_L7IYK7 Ribosomal protein L19 n=5 Tax=Magnaporthaceae TaxID=81093 RepID=L7IYK7_MAGOP  ali  32  117......IAQLVTLPVGSEITFRARIHHQRDISKLDFLLLRDQTHSIQGVLQG---PPEMVKWAQRLHPESIVQITGHLQVRSATHQGLEVLIDTIHLVAPAKNLSFNNYQPPESLHP--RLTNRVVDLRHPANQALFRVRAAVTRTFRWTLDQQDFVEIQTPKIMAGATESGAEVFKVNYFGRSAYLAQSPQLSKQMAISADFKRVYEVGPVFRAENSNTHRHLTEYTGLDIEMCIDQSHHEIIRMVDRVLKNIFAAVHQ--MEELKIIRERWPSEDLVWPILTFPEALQMLREDGNEDIEEDDLSTRDEYRLGELVKEKYKTDYFILDKFPTIARPFYTHKDDSDPKWTNSFDIFVRGQEICTGGQRIHKYDELRQSMTDSGISGDGMEEYLAAFESGAPPHGGAGLGLERIITFMLQLGDVRNAAPFHRDPKSL.. 549
108 0.000e+00UniRef50_A0LRD0 Lysine--tRNA ligase n=77 Tax=Bacteria TaxID=2 RepID=A0LRD0_ACIC1  ali  24  43..RTAFIAEIRAAYTGQHASIAGRLMLSRIGGKLCFGVLRDGSGDLQIMLSAQKVGDRALALWKSLDLGDHIGVHGEIITSRSGELS--ILADSWSFTSKALRPLPEKHKGLT--DPEARIRRRYVDLINSRARSMVHIRAAVLRSLRDTLSRRGYLEVETPVLQLVHGGAAARPFRTHAFDLPLYLRIALELPLKRLVVGGLERVYEIGRVFRNEGVDSS-HSPEFTELEAYEAY-GDYDTMADLVRELVLDAAKAI---DAVQVLGSSGDVIDLAGPWRTVTVHQAVSEAVGEEITVDPPAAEHGEVVCELFEKVAQPAIVQPTFVRDFPASVRPLA-RPHRTDPRLAEAWDLIINGIELAPAYSELVDPVEQRRRLTEQGGDPEAMEDFLQALEYGAPPMGGLGLGVDRLLMLLTGSG-IRDVILFPLVRP.... 500
109 0.000e+00UniRef50_A0A2P6TCU7 Lysine--tRNA ligase n=2 Tax=Chlorella sorokiniana TaxID=3076 RepID=A0A2P6TCU7_CHLSO  ali  23  694............QHLEEVVSVAGRVVRKAASGKLIFFDLRGEGAKIQVMCDARNFAPEFQKLMNSVKRGDIVGVAGHPGKSKRGELS--IFPQRLQVLAPCLHMPPSTHFGLK--DQETRYRQRYLDLINPEVQDIFRTRTKIIQLLHRFLDDRGFLEVETPMMNMIPGGATARPFITYHNDLDMYMRIAPELYLKMLVVGGLDRVYEIGKQFRNEGIDLT-HNPEFTTCEFYQAY-ADYNDLIAMTEEMISGLVLAIKGSYKITYHPDGPEDIDFTPPFRRISMEEAVDLCKKHNVDC-SPPQTTARLLDKLVGEFIESQCTNPTFICDHPQIMSPLAKW-HRTLPGLTERFELFVNCKEVCNAYTELNDPLRQRQLFKAQGDDEAMFENFCTALEYGLPPTGGWGLGIDRFCMMLTDKNNIKEVLLFPAMKP.... 1165
110 0.000e+00UniRef50_A8ESJ5 Lysine--tRNA ligase n=328 Tax=root TaxID=1 RepID=SYK_ARCB4  ali  23  45......IFQLEEKDENRNYTVAGRIKFFRLMGKASFLKIEDESGMLQIYVARDNLPENFYNEVKNIEVGDIIEISGYPFVTGHGELS--LHADSLKILTKAISPLPEKFHGIQ--DKELRYRQRYLDLMNSEVRKTFHIRSKVISLTRRFFENKGFLEVETPMMHPIAGGANAKPFVTHFNGVDRFLRIAPELYLKRLIVGGFEAVFEINRNFRNEGMDAT-HNPEFTSIEFYWAYKT-YKDLIVLTKEYFEYLFENLNLPTILPYGEFKIDFNKFSEPQDIVEDKDKILAFLKANNLEANANLNLGQLQGELFDEFVEAKLINPTFITEYPVEISPLA-RRSDEKPHLTDRFELFIAGKEIANAFSELNDPIDQLQRFKEAGDDEEMDEDFVNALSYGMAPTAGQGIGIDRLVMMLTNEHSIRDVLLFPAMKP.... 492
111 0.000e+00UniRef50_A0A1G1X988 Lysine--tRNA ligase n=6 Tax=Parcubacteria group TaxID=1794811 RepID=A0A1G1X988_9BACT  ali  24  34..RTSTLAELADNFDGTAVVLLGRISAIRSHGSISFVDIVDDGGKMQLQFAQDGL-QDRFAELETFDSGDFIEAIGIPILSKRGEKT--VMVTQFSMASKAIRPIPSTWFGLK--DIELKSRQRELDLLNPDAKDAAKKRSQTISFVRSYLEEKGFMEVETPMLQPIPGGTLAHPFSTHHNNADLFLRIAPELYLKRLLVGGFEKVFEIGKNFRNEGVDKS-HNPEFTMLEFYWAY-ADYEDLMALAEDLLSKAAEKIIGSLDV---PRENTTISFKPPFARYCYVELLKEFQQHGVKVPDVEN-YGKLVDELYKEIVRPTLLEPTILYDYPIELVPLAK-KKASNPNIAEMFQLVVAGMELVKAYTELNDPVEQRERFMEQKGDAEADESYLRALEYGMPPAAGFGLGIDRLVMLLTNTTHLRDTILFPLLK..... 486
112 0.000e+00UniRef50_A0A1A7W1W6 Aspartate--tRNA ligase, putative n=31 Tax=Plasmodium TaxID=5820 RepID=A0A1A7W1W6_PLAKH  ali  33  182..................IWVRGRIHDIRSKGSLAFIILRQKLYSMQCIIKNNDNDKNMMKWVSNLPLESIVDIYGKLTKPESTNIKYEVHIKKIFCISKTTKELPFLLKDANKVNQDNRLNNRCIDLRTYANYSIFCLQSQICTLFKNFLLKNNFIEIHTPKLLGESSEGGANAFQINYFNQKGFLAQSPQLYKQMCINSGFDRVFEVAPVFRAENSNTYRHLCEYVSLDIEMTYKYDFLENVFFYDSLFKHIFTELTKGEKSEIKTVKGQYPCEDFQWPIFTYEEAIKMLQHNKLDLKDEDILSTDMEKELGKIVKASHHTDYYIIINFPSALRPFYTMYKEDNPAISNSYDFFMRGEEILSGSQRISDVNLLLENIKRFNLDASKLNFYIDSFAYSSYPHSGCGIGLERVLMLFLGLNNIRKTSLFPRDPKRLIP 628
113 0.000e+00UniRef50_A0A2A9NF21 Uncharacterized protein n=1 Tax=Amanita thiersii Skay4041 TaxID=703135 RepID=A0A2A9NF21_9AGAR  ali  28  123..........LSDHVSKRVRVFGWVHRLRDQKGIIFIVLRDGTGFLQAVLSGR--TAQTYEAL-TLNLESSVELVGTLQPVPEGPGGFELVVDFWRVLGGSPAEEAFTNRLNEKSDPSILADLRHLVLRGEVSSSVLRLRSHLLQAFRTSLTSHNLLEVTPPCLVQTQVEGGATLFKLDYYGQSAFLTQSSQLYLETCLPS-LGDVFCVQESFRAENSHTRRHLSEFTHLEGELAFIT-FEDLMDHIETIICETVDILLTDSSQLIKSLNPNFVAPTRPFTRISYKEAIEWLNKHGIEDEDGDHQVGDDIAEAAERQMTDIIGKPVFLYGFPRSLKAFYMKSMPDDRVYTESCDLLIPGGEIVGGSMRISDMEELVAAYKHEGIDAEPYYWFTDQRKYGTCEHGGYGLGVERLLAWLAARHTVRECSLYPRWPGRATP 573
114 0.000e+00UniRef50_A0A178CXD0 Aspartate-tRNA(Asn) ligase n=1 Tax=Fonsecaea nubica TaxID=856822 RepID=A0A178CXD0_9EURO  ali  29  111...WISLADIDTSLIGKEITFRARIHVVRHMSRLAFVVFRQETTTIQGVVRAGGISENMVRWVEHMRAGSIVIVRAKVKEPETSTSDVELEISQILLVSARTAPVPFSVYEADAASDRVRLANRILDLRTPSAQAIFRVQSVVCRTFRRHLEDRGFLEIHTPKLQGGATEGGADVFKLDYFGRSAFLAQSPQLAKQMCISADFPRVFEVGPVFRAENSNTPRHMTEFTGLDLEMAIDRHYHEAMWLIDATLKDIFKTLYNCNRKDIDTLKHHFPHDDLVWPRITFAEGVKLLNESGWTNDDGDDLPTRGERRLGELVKQKYHTDYYILDKFPAAARPFYTMPDPKDGNITNSFDFM--------------------ERMEAQGMDPDDLKEYVQAFEWVAPPHAGAGIGLERLVALILDLGNLRYASLFSRDPKS... 546
115 0.000e+00UniRef50_A0A2H5UZE7 Asparagine--tRNA ligase n=9 Tax=Archaea TaxID=2157 RepID=A0A2H5UZE7_9ARCH  ali  35  2..KTSYLADVRGLQDGSRFKAVGWVMRRRSHGRLVFLDLRDSTGLLQVAVKAGVADEASLKAASMVGRESLVEVDGLVRTEARAPGGKELTALQVRVLSGVAQDFPL----RKGVGAKVLWDNRHLALRSLRVSALMKIRARLLSALRRWFEENGFTEINCPSFITAAVEGGATLFKVDYFGKTAYLTQSVQFYQEAAIF-GLEKVYSVQPSFRAEKSKTKRHLTEFWHVEAEIA-HAGLSDMMGVVERLVGESSIQALQQSGEELRILGRKLDVLEPPYERIKYSEALEILESKGVDVPWGTDLGADEERVLTEGFEK-----PFFLTHFPREAKAFYHRIDPSDGRVTLSADLLAPYGEVVGGGERIFSLEELVARIEAEGLDPKDYEWYLDLRRYGSVQHAGFGLGLERLIQWLLELKSIKTATLFPRTRARIYP 430
116 0.000e+00UniRef50_A0A1Z8MN70 Lysine--tRNA ligase n=1 Tax=Rhodopirellula sp. TMED11 TaxID=1986614 RepID=A0A1Z8MN70_9PLAN  ali  24  90............EEIGPTVRVAGRIMLSRPAGKLIFLNLKDWTGEIQIFIGKKQVGEDDFALAKLFDLGDLVAVEGRLGRTNTGELT--VFAEQLFFHTKMLEPAPDKHAGLTNPDLKQRM--RYADLANEGPLETFMARTKIIKSIRNTLDSHDFCEVEGPTLHTVAGGAAAKPFNTHHNDMPLTLRIALELHLKRLMVGGMERVYEIGRVYRNEGL-SPRHNPEFTMLELYEAY-GDYRSMMDITEQMICDAIDAIGGGYQRE---FAGKTVDFTPPFERATYADLFQKATGKKIGLDTAGKHLDVVRNEIFEEKVEDSLEGPIFVIDYPASICPLTK-RKRDNPDIAERFELFICGMELANAYTELNDPDLQQKLFETQGQDEEDDHDFIRALRHAMPPAGGLGVGIDRLVMILTGQKSIRDVILFPVLRP.... 524
117 0.000e+00UniRef50_A0A2A4U487 Asparagine--tRNA ligase n=1 Tax=Thiotrichales bacterium TaxID=2026796 RepID=A0A2A4U487_9GAMM  ali  27  2......IKDLYKENLPVTVCIQGWVRTRRDSKGISFLAINDGSCLIQVVA-PDSLANYSSEIIE-LTKDCAVTITGELVESRGKGQTVEIKASEIVVHGVVEEPL-TYPVSPKRHTMEHLREYAHLRARTNIFGAITRVRHTVANIIHNFFHNEGFFWINTPIITSNDCEGAGELFSIDFFSKESFLTVSGQLCLES-YCLAMSKVYTFGPTFRAENSNTSRHLAEFWMIEPEIAFADLQMDV-QLADKLLRHVTKTVLQECQEDMQFFNQWVDKLANKLEVIEYKDAIKHLEKAKQKFEFPVAYGKDLQSEHERYLVEKLFDAPIAIINYPKNIKAFYMRVNDDDQTVAAMDIIVPGIGEIIGGAQREERMDVLDARMQECNVNAKDLAWYKDLRRYGTVPHAGFGLGFERLLGYLTGVANVRDLIPFPRTPGNIN. 456
118 0.000e+00UniRef50_A0A2R5FZ94 Lysine--tRNA ligase n=1 Tax=Aurantiochytrium sp. FCC1311 TaxID=2023137 RepID=A0A2R5FZ94_9STRA  ali  26  347...........KQDDSSEVSIAGRIIGKRAQGKMVFYTIQGEGNRVQIMLQHYKDGEDAFFAAHNLRRGDIVGAVGFPGKSKKGELS--IFPSKLVLLTPCMHMLPVEKKGQEFTNQDTRYRKRHLDLLTPATRDVFCKRAQIISYIRRFFDARGCLEVETPVLDMQAGGATAKPFITHHNSLNANLRVAPELFLKKLVVGGLDRVYEIGKNFRNEGID-PTHNPEFTACEMYEAY-ADYNDLMDMTQELLSGMVKAICGSYVIEFLPLGAEEPDFTPPFKRISMDEAVKMLDDLLKKHELEPRTSSRMFDTLVGEFLESKCINPTFLTDHPLVMSPLAK-KHRDDPFLTERFELFVATKELANAYTELNDPVDQRERFKAAGDDEAQDEGFIEALEVGLPPTAGWGLGIDRLAMFLTNKNTIKEVILFPAMKP.... 804
119 0.000e+00UniRef50_A0A0G1FGU3 Lysine--tRNA ligase n=2 Tax=Parcubacteria group TaxID=1794811 RepID=A0A0G1FGU3_9BACT  ali  24  36.......ADILSLKEGEQISTAGRITSIRTMGKITFCHISDISGKIQIVIQEDTIGKDVYKQFHDISIGDFIGASGELFTTKSGELS--IKATSTTFLGKALLPLPEKWAGLK--DTETKYRQRYLDLINPESKKLFLFRSNVIKAVREFYWRNGFQEVETPTLLHVATGAVANPYKTHHLNQDLFLRISHELPLKELIVGGFEKIFEIGKAFRNEGID-PSHLPEHTHLEHYSAY-WNFEDNIAFTEKMFSYLFETL--GIAQTLVMDSGVEVQLKQPWPRYNFVELIKEIKKKNISFDGDQMSLAGLMDNLYKKIVRPTLINPTFLTTYPEILQPLA-RRNDENQNVVDQFQLVINGWEVVKAYSELVDPIDQQQRFKEQGEIEEGDDEYITSMKHGMPPISGLGMGLDRLVALLSGNSNLRDVVLFPLLRKK... 485
120 0.000e+00UniRef50_C9RMI6 Lysine--tRNA ligase n=30 Tax=Bacteria TaxID=2 RepID=C9RMI6_FIBSS  ali  24  34..RTHDSKVLKENKDKEPVAFAGRVVRFNRKGKMCFMHLKDRYGRLQVVVARDEVGEENYEIVKMTDLGDFIGVNGTMFETQSGEYS--VRAEKVTMLSKAVRPLPVKVVFNEFADVDTRYRQRYIDMLNDDVKEVFIKRSKIMQAIREYLIEKGFIEVETPTLQPIYGGANARPFTTHHNDMTLYLRVAPELYLKRCIIGGMEKVFEFCKNFRNEGMD-RTHSPEFTGLEFYEAY-ADYNDMMVHFENIYERACIAANGTTKVNYQG---KEIDFKAPWPRYSMIEAIEKFGGIKVNHLDGEFTRGRGILELFDLTVEGKLIQPTIIKDMPTESTPLCK-KHRTTAGLIEQFEPYANGWELGNAYTELNDPIRQRELLEDQGGEGEMDENFMHAVESGLPPTGGVGFGIDRMVMLLTNQQTIRDVQLFPLMKP.... 499
121 0.000e+00UniRef50_A0A2E6BQC5 Aspartate--tRNA(Asn) ligase n=2 Tax=unclassified Saccharibacteria TaxID=1895827 RepID=A0A2E6BQC5_9BACT  ali  35  1MTRVLTNQ--LAKHVGETVTIQGWLHKKRLLGGLNFITLRDRAGVAQTKID----NKDEVEKLRGMQIGTVLTMTGVVVADERAPGGAELHDVTLEVVVPVLDESPIEIDKKLDHNLDTLFEHRVIGLRNLQETAIFRVQAAVKEAVRQYFHANDFTEFNSPKLLPAATEGGAEVFTLDYFGKEATLAQSGQFYKQM-MVGVFERAYEINPTYRAEPSATTRHMTEFLHIDAEMGFV-DFQELLSVVGGLLKSVAASVWEQKASELESLQAKPVTLPESIPQLTLEKIHELYSEAGQDTRGEKDLRPDEERWITEYAKENLGSEAVFVTEWPASEMKFYHRKSAENPEFAERADLIFRGVEIATISMREHRYDVLVEQLRTAGGDPEADGFYLQAFRYGLPPHGGFGMGLERLTQKIIGLANVKEAALFPRDINRLTP 437
122 0.000e+00UniRef50_A0A2H0SWK1 Lysine--tRNA ligase n=1 Tax=Candidatus Pacebacteria bacterium CG10_big_fil_rev_8_21_14_0_10_40_26 TaxID=1974767 RepID=A0A2H0SWK1_  ali  24  57.....TIAQVRE-MMDQSVQTAGRIMSIRAHGKVVFLDLQDSTTNIQVMVREAEVDSKAFEWLKTLDRGDYLGVSGTVMTTKTGELT--ILATEFQMLSKALRPIPTAFNAAD--NKEVRFRKRYVDLINPDTKRILDARWLIEKEIRRFLDQHDFIEVETPILQPLYGGTNATPFTTHMLDSDFYLRIAPELYLKRLIVGGYDRVFEIARNFRNEGIDQT-HQPEFTMIEWYETY-ADYTRMMNVAEALVKHLTFKLYGNHEIT---VGEKIIDIAGDWPRVRMDEALKQHANIDFDSLSDEFTRGKALFELFDELVTPHLIAPIWIVDYPRDISPLAK-QHRTQPEFAERFEAYIGGKELADGWSEIVDAVDQRNIWENEQGDTEADEDFLEAMEHGMPPLGGIGMGIDRLVMFLTNTWSIKEVIAFPTLRP.... 503
123 0.000e+00UniRef50_A0A1F9X5J8 Lysine--tRNA ligase n=5 Tax=unclassified Elusimicrobia TaxID=1797919 RepID=A0A1F9X5J8_9BACT  ali  24  65...............ETEVKVCGRIIARRDMGKATFSHIQDFTGKLQLYFKMDNVGSETYKFIDTVDIGDFIGVTGKLFRTRTGELT--VNVKNYTLLSKALRPLPEKWHGLKDV--DTRYRQRYLDLINQEVKEIFIKRARILNLIRDQLNNNAFLEVETPIIQRLAGGALARPFKTFHNNTDLFLRIAPELYLKMLVVGGLERVFEIGKSFRNEGID-RQHNPEFTMVEIYQAY-SDCAGMIELCRNLIKGIVNALDLNEKVMFEGQVLNF----AEFRIASMNELFTEAFGKNVNILETETNDKKIFDHLFEQFIQPKLINPTFVTDHPLAYSPLAKAKDD---ITADRFELYIAKEEMANAYSELNDPQEQRKRFANQNQNQTMDDDFVTALEHGMPPCGGLGIGIDRLTILLTNSTSIREVILFPLLRS.... 500
124 0.000e+00UniRef50_Q554D9 Asparagine--tRNA ligase, cytoplasmic n=33 Tax=Eukaryota TaxID=2759 RepID=SYNC_DICDI  ali  28  216..KRLKIRECSPKFANQRVEVHAWAHHVRNQKKIVFLELRDGTGFLQCVLSGDLVHPSIID---KLLREATVKIVGTLVADKKCPGGVELQADYWELLGPSNADL--EGVINQESNVDHLFDQRHIMMRGTRASSIMKIRSLCLFAFRQHFFENHYMEVTPPTLVNTYCEGGSELFTVDYFGKPAYLTQSSQLYLETMLP-VLGDNFTITQSYRAEKARTRRHLTEFLHLEAECPFIT-YEELQDRIEFLVVDVCEKLFKMDPELILSVNPDFKVPKRPFMRMNYSDAIEYCKKNGIKLEDGDFEFGDDIPEAQERRMNDQIGEPIFLCRFPAEMKAFYMARCPEDRTLTESLDLLMPGGEIVGGSMRISDFNELVAAYKKAGLDTDEYYWFTDQRKYGTTQHGGYGLGVERFLTWMLKEEHIRNVCVYQRTKDRITP 653
125 0.000e+00UniRef50_D2SH05 Lysine--tRNA ligase n=7 Tax=Geodermatophilus TaxID=1860 RepID=D2SH05_GEOOG  ali  24  42.....TAAGIRAAHPGDRVRVAGRVELIRRQGWLTFATLRDRTGAVQLYVDSSVLGPERHAEFDDVDRGDWIGAEGTVMTTRRGELS--VCVEDFAVLGKALHAPPPEHAGLSDV--ETRYRQRYVDLVNERTRQVFRIRHAAVRAIRRHLEDRDFTEVEGPVLQTIQGGASARPFVTHSNDLDLYLRIALELHLKRLIVGGLERVFEIGRVFRNEGVDT-RHNPEFTLLEAYQAF-GDITDMMELTEGLVTAAARA-ALGADLTVHYAGHSIDLAATPWPRMPIDDARAVLDRLGIPYE-ASWGAGRLMKEVYDEKVQHSVVGPVFCVDYPREVSPLA-RVHRDDPAYVERFELIVAGFELCNAYSEQNDPVEQLAAFEAEAGDPEADTDYVRALECGMPCTGGLGIGIDRLVMLLAGVDSIREVILFPTLRP.... 498
126 0.000e+00UniRef50_D5G534 Uncharacterized protein n=6 Tax=Pezizomycotina TaxID=147538 RepID=D5G534_TUBMM  ali  27  39.........LSDERANETVTVAGWVRSVRRMKNVSFAHVSDGSTILQAVLTK--------EQSENLSMGTSVKITGEWKESGKGQQSKELLAEKVEVLGKADPLT--YPLQKKYQTPEFLRTLLHLRQRIPANTNLLHLRSNIISTLTAFFVEHSFIQCHTPIITSSDCEGAGEVFAIKFFNTPKYLTVSGQLHLE-ALAAAVPRVWTLSPSFRAEKSGTTRHLSEFYMLEVEAAFIDTLDPLVALIEDMVKTIVRSISTSRVKAVQLEERWKGLLERPWSRITYTEAISRLGQKEVQFDIPAVWGAALQAEHERFLAQTVFNGPVFVTDYPKSLKPFYMLPSPGEGETVACFDLLVPVGELIGGSLREYRYDELLTEMRRHGIDEGSLRWYLELRKWGSTRHGGFGLGLDRLVCYLAGVENIREATAFPRWVGRCD. 491
127 0.000e+00UniRef50_A0A067MYZ7 Uncharacterized protein (Fragment) n=1 Tax=Botryobasidium botryosum FD-172 SS1 TaxID=930990 RepID=A0A067MYZ7_9HOMO  ali  27  11.....TIRHILAQQPSESLQAHGWVKSVRKQKRVAFAEVSDGSS----------VKGLQFTYACRLNVGASVSLTGKLVQSLGKGQALEMRAEDVRLLGACDPE--AYPLQKQAHTAEYLREHLHLRSRTNTMSAMLRLRDRLGRSFHDYFQSQDFYNVNTPIFTSSDCEGAGEAFRVEFFGRPAFLTVSSQLHLE-ALSSSLARVYTLSPAFRAERGVTHRHLSEFWMLEAELSFCENMEDVMGVVEGLIKHSLNDVRKTCEAELELLGATADADSGSWQRMTYTQAVKELAAHDSQFQFRPRWGAPLQSEHEKWLAGSLVGGPVFVTDYPIDLKPFYMRNNADDTGTVACFDLLIPVGELVGGSLREERLAHLEHAMKKHGLPVEEYEWYLDLRRFGSVPHGGFGLGFERLVSWVAGIDNIRECIPFPRWPGK... 491
128 0.000e+00UniRef50_A0A256YAY8 Lysine--tRNA ligase n=2 Tax=DPANN group TaxID=1783276 RepID=A0A256YAY8_9ARCH  ali  24  49...........EEKSKERVKVAGRLLSIRRHGKINFAHLQDRSGKIQVIFEESTLGKEKLKFFQNIDAGDIIGCEGIVMRTKKGELS--VLVKNFILLSKSIRALPEKWHGLK--DPELRYRHRCLDLMNPNVRDIFKKKALILKTIRNFLDERGFIEVDTPALQLVYGGAAAKPFKTFLNKQEMFLRISDELYLKRLIVGGLGKVYEICKDFRNESID-RLHHPEFLQVELYEAY-SDYNDMMKLFESLMKTLAKTLYGTTKITYQGNKIDF----GKWKHLTVIDAIKKYANINVNVSREEASWGTIVNELFESLVADKIMEPTLILDYPLESTPLCK-PHRKDKRLVERFEGVCCGIEVCNAYSELNDPILQRKLLEEQVKKRKQDEDFLFALEHGMPPLGGLGIGIDRITMILTDQPSIREVIPFPLKRPK... 489
129 0.000e+00UniRef50_B0E615 Asparaginyl-tRNA synthetase, cytoplasmic, putative n=12 Tax=Eukaryota TaxID=2759 RepID=B0E615_ENTDS  ali  29  16.....NIRDA-AGLEGKLVTFKGWAYHIRKAKTLIFVELRDGSGYCQCVIFGKELCDP--EKIKLLTRECSLEITGRLNAYAGKILNLEMQVTEWKVVGESPIDL--ENIINKDSSIPQKMQNRHIVIRSEHTQQVLQLRSEIQWYFRKYYHDNHFTEIQPPTIVKTQCEGGSTLFKLQYFNEPAYLTQSSQLYLESVIAS-LGKSFCMLSSYRAEQSRTVRHLAEYLHLEAELPFI-SFEDLLNHLEDLVCTVIDNVMAVHGDKIRKMNPHLKLPTRPFKRMTYADAIKYCNDHGILNKDKPFEYGEDISEKPERQMTDEIGCPIFMIHFPSKMKAFYMSKVPGHPDLTESVDLLMPGGEIVGGSMRIWDYNELMGAYKANGLNPDPYYWYTQQRKYGSCPHGGYGLGVERLVMWLLGEDHIRKVCLYPRYLERCEP 451
130 0.000e+00UniRef50_A0A0G0SYD2 Aspartate--tRNA ligase n=26 Tax=root TaxID=1 RepID=A0A0G0SYD2_9BACT  ali  37  1MERT-LVKE-TVNKVGEKVTLAGWVNTIRDHGKITFIDLRDRSGIVQCV----------GKDLTKVNPESVVEISGLVKKRPENTGTIEIEIENLNILSKSAELPFDMGVENLELELPTLLDYRSLTLRHPKIKAIFKVQEVVVDAFRRALQQKEFVEFQAPSIISSAPEGGAEIFEVKYFDHKTYLAQSPQLY-KSLLVSVFERVFSVNKVFRAEPSVTTRHLTEVISLDAEFGFIKDYLEVKGMAEYVIKFILKEVDEKCKKELAMYNATTPSVAENIPIIKLRDAQQIFERTGRDVRREKDLAPDDEREICLWSKEVHGSDLVFVSHYPTYARPFYTYPDPDEPEYNQGFDLIGRGTEWMTGGRRIHDYDTLVEHAKKWGVTPENIELYLQAFKYGMPPLGGFAFGAERITMHILGLKNIREASIFPRDMERVD. 432
131 0.000e+00UniRef50_A0A2G6LU61 Aspartate--tRNA(Asp/Asn) ligase n=5 Tax=FCB group TaxID=1783270 RepID=A0A2G6LU61_9BACT  ali  36  14.....SAGELRA-LEGQTVAVHGMIQRIRRLGWGAFIVLRRHDGLLQCVISR----EGNEDLIDSLAEEQSVAVTGLVKAAEINPGNVEIQVESVETISPSEHPPVDLSKKLLDLHIDTNLDMRPLSLRHPVERARLKVSESLAAGFAEFLRSEGFTEIRTPKLGVAGAEGGANIFKVEYFDREAYLAQSPQFYKQMG-VGIYERVFEIGPVFRAEPHQTSRHINEYTSMDFEMGFIRDHRDVMEMETALLGFCLEKVAEDCSAELALLETELPDLSEDIPVVTLDEAHRIAEITGKDCSSEPDLEPEEERAVCAYSADNWGSEFVFVTHFPTEKRPFYTKDDPETPGKTLSFDLLFRGLEITTGGQRIHNYHEQVVKMKDFGLDPSDFQGYLQAHKYGLPPHGGLAVGLERLTARLLGVDNIRYTTMFPRDVKRLTP 447
132 0.000e+00UniRef50_A0A136K0G6 Lysine--tRNA ligase n=3 Tax=unclassified Acidobacteria (miscellaneous) TaxID=305072 RepID=A0A136K0G6_9BACT  ali  23  81.......AEVKDKLNETTVRIAGRIATIR--GN--FVHLTDGREKLQIYAKKDRDSDQAWEAWQILDHGDLIGVEGYLFVTNTGEVS--VHVERLYFLAKALSPMPDKMHGIEDA--EIKQRQRYLDLIASSTRETFEVRAKTISSLRRFLEDNGYIEVETPMLTPKATGAAAKPFKTHHNDIDLYARIAPELYLKRLLVGGFEKVYELNRNFRNEGI-SYKHNPEFTMLEFYCAYM-DVNGMMDFCERMIQESVRRATGGLTVNYERHTIDFSA----FRRLTMKEAIAETGRSEPMSDDGLVAC-------FEEFVEPNLIQPTFITDFPKSISPLSKA-SPENPQVAERFELYINGMEVANGFSELNDPREQYERFRERGDDEAMDEDYVRALSYGMPPAAGIGIGIDRLVMLLTNKHSIRDVILFPHMRP.... 524
133 0.000e+00UniRef50_Q6YPY6 Lysine--tRNA ligase n=23 Tax=Mollicutes TaxID=31969 RepID=SYK_ONYPE  ali  23  59..................VCVAGRIVLKRGQGKAGFLHLQDFNFRMQAYIKLDLVGKDAFQIYQNCDLGDIIGIKGFLFKTKTQELT--IKALEFIHLTKALKPLPDKFHGLQ--NREEMRKNRYVDLINEKTRQVFLTRSLIMKYIRNFFDNQGFLEVETPILQPTLGGASAKPFITHHNNCDFYLRIATELPLKKLIVGGMNKVYEIGRLFRNEGIDAT-HNPEFSTIEAYLAY-ADMQDIMDLTKQCLQELAQKLFGKLQFTYQNQEIDFSH----FAKVSMVASIKELAKKHQIEVMPHFSQGHIIEAFFGKYVENTLIQPTFVYGHPLEISPLAK-QNEADPRFTDRFELFIVGKEFANAFSELNDPIEQEKRFKQLGNDEDMDYDFLNALNYGMPPTGGLGMGLDRLVMLLTDTANIRDVILFP........ 487
134 0.000e+00UniRef50_A0A0C9R925 NARS_0 protein (Fragment) n=34 Tax=Eumetazoa TaxID=6072 RepID=A0A0C9R925_9HYME  ali  28  150..RRIRISH-GEEYRGERIKIYGWVHRLRRQGKLIFITLRDGTGFLQCVLTNRIC--QTYEALV-LSTESSVLLYGVLKPVPDGQGGHELHVDYWELIGLAPAGGAENILNEEAH-PDVQLDNRHIMIRGENTSKILKIRSVVIQAFRSHFFDRGYNEVNPPTLVQTQVEGGSTLFKLQYFGEEAYLTQSSQLYLETCLPA-LGDVFTVSQSYRAEQSRTRRHLAEYTHIEAESPFITLEDLVCDVVDRILKSPWGSI-------VRELNPEFKPPKKPFRRMNYADAIKWLKENNVTKDDGFYEYGEDIPEAPERKMTDTINEPIMLCRFPLAIKSFYMARCPEDSNLTESVDLLPNVGEIVGGSMRIYNYEELLEGYKREGIDPTPYYWYTEQRIYGTQPHGGYGLGLERFLCWLLNRYHIREVCLYPRFLDRCKP 585
135 0.000e+00UniRef50_A0A0A2KXX2 Lysine--tRNA ligase n=2 Tax=Penicillium TaxID=5073 RepID=A0A0A2KXX2_PENIT  ali  24  120...........EQKPDVTVRIAGRIYTKRTSGKLNFYDIRAEGVKVQVMCQAQSTGKPFEEQHELLRRGDIVGIVGFPGRTSPKDGELSIFATEVVLLSPCLHAIPSEHYGFQ--DKELRFRQRYLDLMNDRSREIFRTRAKIVSYIRQYFDSRDFTEVETPMMNAIAGGATAKPFVTHHNNMDLFMRVAPELYLKMLIVGGMERVYEIGKSFRNEGIDLT-HNPEFTSCEFYQAY-ADVYDLMDLTEDLVSGLVKHVTGGYETVFHTQSGETVNWKAPWRRVEMMPALEILKKMKVDCSAPQTNARMLDKLVGE-FIENTCINPTFITGHPQMMSPLAK-KHREHVGLCERFEAFVCTKEITNAYTELNDPFDQRMRFEEQGDDEAQMETFCQSLEYGLPPTGGWGMGIDRLVMFLTDNYSIKEVMTFPMMK..... 577
136 0.000e+00UniRef50_R8BEX4 Putative aspartyl-trna synthetase protein n=97 Tax=Opisthokonta TaxID=33154 RepID=R8BEX4_TOGMI  ali  31  144......IEELADMAEGTEVTFRARIHTRRISAALDFLLFRDQTHSIQGVMTSEHCTPHMVKWVQRLHPESLIQVTGTLKKPIEPVKSLEVLVYSIHLISAAE-DLPFDNYYMNQESLHKRMTARVLDLRHPSNQALFRIRAAILREYRRKLDDLGFIEINTPKLQAAVAESGAEVFKVNYFGRRAVLAQSPQLNKQMSISADFKRVYEIGPVFRAENSNTKRHLAEYTGLDVEMEITNDYHEVINTVDSVLKSIFAAISKMP--EIQVVRERWPSEDLQWPVIPFKEGIQMLRDDGRDVEEED-LSTRDEIRLGELVKEKYKTDYYILDKFPASARPFYTHPDENDPFWTNSFDIFLRGQEICSGGQRIHNPKKLRESLEKANLPEEDMEEYLSAFDLGAPPHGGAGLGLERVVAFFLNLGDVRFGTMYYRDPKSL.. 579
137 0.000e+00UniRef50_A0A235BYY1 Lysine--tRNA ligase n=3 Tax=unclassified Bacteria TaxID=2323 RepID=A0A235BYY1_9BACT  ali  24  31..RTHTVGEIKRSFDGKDVRVAGRLVALRKHGKSTFGNILDDGEKIQIYLKKDMLGEK-YSLLEFLDIGDFLGIRGNTFTTHTGEPT--ILVEDLVLLSKSISPLPEKWHGLQ--DKELRYRRRYIDFINPESRGSIETRAKILRLTRKFLDDRGFLEIETPILQPLYGGAFAEPFKTHYLDREFFMRISDELYLKRLICGGFNKVYEIGRDFRNEGQD-RLHNPEFTQLELYEAYK-DYTDIKNLVEELFSHLTQNLYGSRKINYGELELDF---ASPWETIPYFDAIAKYTNYDLKNLTPSYIRDKLIDKIFGDEVIPMIEQPTFITDYPKSISPLAKEK-EDNPDLVERFEPVIAGIEIGNAFSELNDPLEQQKRFMEQEGDKETDEDFLKALGMGMPPTGGLGLGMDRISMILSNSSTIKDVIAFPQMR..... 491
138 0.000e+00UniRef50_A0A077YZS1 Asparaginyl-tRNA synthetase, cytoplasmic n=3 Tax=Trichuris TaxID=36086 RepID=A0A077YZS1_TRITR  ali  28  139...........ENNIGIRVRIYGWVHRLRRQGKLMFLVLRDGTGFLQSVMTDKLC--QTYDAL-TLSPESSIFVVGTLKKLPEGPGGCELQADFWKLIGDA-PPGGIDHVLNEDAHPDVLLDQRHLVLRGESLSKIMKVRGLLLAAFRAHYTSRGYYEVTPPTMVQTQVEGGSTLFKFDYYGEEAYLTQSSQLYLETCLPS-LGDVYCIAMSYRAEKSRTRRHLSEYTHVEAECPFIT-FDELLCRLEDIVCDVAKRVVKSCEHLVMELNPKFKIPSKPFRRMAYTDAIKWLNEHGVKKEDGDFQFGDDIPEAPERLMTDTINEPIFLHSFPATLKSFYMSRREDNQLLTESVDLLPNVGEVVGGSMRIWKEQELMDAFKRHGIDPEPYYWFTDQRKYGSCPHGGYGLGLERFLTWVTGRYHIRDTILYPRF...... 560
139 0.000e+00UniRef50_A0A1Y0L3L2 Asparagine--tRNA ligase n=1 Tax=Spiroplasma clarkii TaxID=2139 RepID=A0A1Y0L3L2_9MOLU  ali  29  3......IKELYAKHVGKQVELIARVRNHRQGKSIGFLVLNDGTSIVQVVYKADVAG---FSKISEARVAAIVAVTGTVVLTPGKPQPFELQATKCELLAQCVEDYPLQ---KKEHSPEFLREIAHLRARTKTFQAIFKIRSAASFAIHQFFNSNDFLYVQTPIITENDAEGAGEAFIVDFFGKKAALSVSGQLNAE-AYAQAFKKVYTFGPTFRAENSYTSRHASEFWMIEPEVAF-SDLKDNIELIEAMLKAVIRYLFENVSEELEFCDKNLEPRDAKFVVTEYAQVIEILQTNGHVFEDNNVYFGDLGTEHERYLCEVVNKAPTFVINYPKEIKAFYMKLNADQKTVAAVDLLVPGIGELVGGSQREDDYDKLIARCHEMKIDPKELGWYNDLRKFGYYKSAGFGLGFERLIMYVTGAQNIRDVIAFPRTPKNL.. 452
140 0.000e+00UniRef50_A0A1G7KSD5 Lysine--tRNA ligase n=3 Tax=Actinobacteria TaxID=201174 RepID=A0A1G7KSD5_9ACTN  ali  24  57.................RVRLAGRAELVRRQGYLSFATLRDRTGAVQLFVDTSVLGAQRHAEFDEVDRGDWLGVEGTVMRTRRGELS--ICVEDFAVLGKALLEPPDKHLGLTDV--ETRYRQRYTDLVNERTREVFRIRHTAVRAIRRHLEDAGFTEVEGPVLQTIQGGASARPFVTHHNDLDLYLRIALELHLKRLIVGGMERVFEIGRVFRNEGIDT-RHNPEFTMLEAYQAF-ADYGDMMDLVEGMVTSAARAALGD-DLTVHYGGHAIDLAATPWPRMPIAEARAVLDRLGLAHE-PDWGAGRLMKEVYDQRVQHSVVGPVFCIDYPREVSPLA-RTHRDDPAYVERFELIVAGFELSNAYSEQNDPVEQLAAFEKQHGDPEADLDYVRALERGMPCTGGLGIGIDRLVMLLASVDSIREVILFPTLRP.... 493
141 0.000e+00UniRef50_A0A2H0TYV6 Lysine--tRNA ligase n=2 Tax=Candidatus Magasanikbacteria TaxID=1752731 RepID=A0A2H0TYV6_9BACT  ali  23  37..RKQTIKEALDSAEDTKLSVAGRIMTKRDMGKLMFCHLQDESGRMQIAFKQDEVGVDNYKLFKKMDAGDIIEVKGKKFITHKGEPS--ILVSTWQVLAKTLLPLPDKFHGLN--DEESRYRKRYLDLVNPEEKAKIVVRGKILRYLREFLQNENFIEVETPVLETISSGAMAKTFDTHLNDLDVHLRICGELWQKRLLVGGFEKTFEMGRAFRNEGVD-HQHNPEFTMLEYYWAY-ADYEDNMTLHEKMIPYVVENSIGKLEVEIDNHKINFI---GPYPRITFHDAVLKYSGIDIDEHENLTERGKLLDNLYKQSARKELIQPTFVLNYPIELKPLAKKAK--DPRYTEMFQLIVNGFELSNSYTELNDPIDQRERFEEQGDDEAMDWSYVEALEHGMPPATGTGIGIDRFAALITGSHTLREVTAFPLMKP.... 487
142 0.000e+00UniRef50_A0A286UGI1 Lysine--tRNA ligase n=1 Tax=Phellinus noxius TaxID=418867 RepID=A0A286UGI1_9HOMO  ali  25  114.........AGEKLNGVVESLAGRIHNIRASGKLRFYDLHAEGQKVQIMANAQDAPAKYLEIHESFRRGDIVGVKGTPSRTKKGELS--ISPSQMVLLAPNLHQLPSSHFGLK--DQETRYRKRYLDLINDETRRIFVTRSKIINYMRRFFDGLGFLEVETPITSMLAGGATAKPFITHHNDLDLYLRIAPELYLKELVVGGLDRVYEIGRVFRNEGIDLT-HNPEFTICEFYMAY-ADMYDLMDITESLIEGLVIYLTGGTTLKYKPEGKDEVEFKRPWKRYDMIETLEELCKKHNVDCSEPRTNPRLLDKLVGEFIEPLCISPSFIVGHPQVMSPLAKW-DRSRPGLCERFEGFLCGKEFCNAYTELNDPFEQRARFEEQGDDEAQDETFIDALEHGLPPTGGWGIGIDRLVMFLTNSTNIKEVLLFPAMKP.... 571
143 0.000e+00UniRef50_A0A2W5E7U0 Lysine--tRNA ligase n=1 Tax=Pseudomonas fluorescens TaxID=294 RepID=A0A2W5E7U0_PSEFL  ali  26  80...................KLAGRLMLFRTFGKLIFARIQDAAGQLQVSVSIDASGAEVFGLFNDLDIGDIIGVEGPLSRTNKGELT--LQVQKFELLTKGLLPLPDKYHGM--ADVEQRYRQRYLDLITPEVRHTFVTRSRAITAIRRFLDDNGFLEVETPVLQHQAGGASARPFSTHHNDIPLNLRIAPELFLKRMLVGGFERVYELSRNFRNEGI-SIKHNPEFTMLEFYCAYGT-REDAMSMMEDMLRHTVQAVSGNHAVPY---GEHVIDFAPAFQRYTMRDALKTFKAKGVPTPSPVPSYGELFQLCFEELVEKQLIQPTYIMDYPIETSPL-VRQIPGRPGWTQRAELYIAGREHGEFYSELNDPIDQRSRFERQKGNAEAMHDFLQALETGMPPAFGVGLGIDRLAMLLSNAPSIRDVILFPLLRPK... 515
144 0.000e+00UniRef50_A0A1G3PAR7 Lysine--tRNA ligase n=1 Tax=Spirochaetes bacterium GWF1_31_7 TaxID=1802187 RepID=A0A1G3PAR7_9SPIR  ali  25  32..RTHSLTEARKLDIGTTVELRGRMMLKRSFGKLLFATIQDFDERMQICLNIKSIDTERFKFFDKIDVGDFVWLTGDIFKTEKGEIT--LNVKEFVLLSKAIRPLPEKFHGIT--DLETKSRQRYLDLMDSSTRDRFKKRFKIITTIRNFLNDNDFYEVETPVLQAKPSGALAKPFKTHHNDIDMFLRISPETYLKRCIAGGFERVYEFARSFRNEGMD-PSHLQDFTLLEFYASY-WNYEDNMKFTEALIKKILMDVNGSLMLEYHGTK---IDFSGEWPRYSFRDLIIKHANIDIDVDFNKIGRGNLIDQLYKKVARPSMINPQFLIHHPLDLSPLA-RRNDANPDITDRFQLVVNTWEIINAYSELVDPIDQRARLLDQAGDDEAMEDFIQCMEYGMPPISGWGMGIDRFVALLTNQENLREVILFPLMRP.... 487
145 0.000e+00UniRef50_A0A0E9NDM1 Uncharacterized protein n=2 Tax=Saitoella complicata NRRL Y-17804 TaxID=698492 RepID=A0A0E9NDM1_9ASCO  ali  25  42.....TINELAAALPEDEVTVTGWVRTVRKLKNVAFASVNDGSSNMQVVLK--------HDQLEGLTTGTSVQITGRYEQSTKGQQDRELKASNVQVLGASDGET--YPMQKKYHGAEHLRQNAHLRPRTSSTSALLRLRSKTMSALNNFFDTQSFTQTHPPILTSSDCEGAGEVFSISFFGHSTYLTVSTQLHLE-ALAHGLGRVWCVCPAFRAETSLTNRHLAEFWMLEAEVAFVREQGELMTLTEEMIRHVAKGLLENPAAELAPYNDTKIDLPSRWRRMSYTTAVNHLQHAVSTFKFPPIWGHALQSEHEKWLAGEFVKGPVFVHDYPASLKPFYMLPSLPSNTVSECFDLLVPEGELVGGSLRQHDAAALESQIEKAGMKAEEMAWYVELRKWGSVPHGGFGMGFDRFLAYLGGVENLREVVAFPRWAKHC.. 507
146 0.000e+00UniRef50_A0A254U624 Aspartate--tRNA(Asn) ligase n=178 Tax=Eukaryota TaxID=2759 RepID=A0A254U624_ASPNG  ali  34  132..RTNL-DAISESLVGQQICFTARLHIIRRMSKLVFLVFRQQLLTFQGVLEAGVKSIAMIHWAEHLRLGSIVRVRGIVQKPQVPILGVEISIDELHQVVRREEPVPFSIYEAEIQTAEVRLTNRLLDLRTPTSQSIFRIQSAICNLFRFALDEQGFMEIHTPKLQGSATESGASVFHVQYFGRDAFLAQSPQLAKQMAIAADFGRVYEIGAVFRAENSNTHRHLTEYTGLDIEMAIEEHYHEMLDVLDAVIKSILQGVYGRYRREVETVKHQFPSEDVVWPILRFADGIKMLNEDGNPLPEDEDLHTRDEIRLGELVKEKYGTDYYILDKFPASARPFYTMPDPDDDRYTNSFDIFVRGQEIVSGGQRIHDPHMLEENMRRSGIDPDTMEDYMEGFRWGAPPHAGAGVGLERLLMLLLKLGNIRLASLFPRDPRS... 595
147 0.000e+00UniRef50_A0A146MWJ3 Lysine--tRNA ligase n=5 Tax=Eukaryota TaxID=2759 RepID=A0A146MWJ3_FUNHE  ali  25  139...........DQLTDVVLSVSGRIHAKRASGKLLFYDLRGEGAKLQIMASKNYKSEEAFVAINKLRRGDIVGVRGNPGKTKKGELS--IIPIEMTLLSPCLHMLPHLHFGLK--DKETRYRQRYLDLINDYVRQKFLTRAKIITYLRNFLDQMGFLEIETPMMNIIPGGAVARPFVTHHNDMKLFMRIAPELYHKMLVVGGLDRVYEIGRQFRNEGIDLT-HNPEFTTCEFYMAY-ADYHDLMDITEKLLSGMVKHITGGYKVTYHPEGPEEVDFTPPFRRVSMTHDLEKIMGVKFPPTDPPRTTARLLDKLVGDFLEVTCISPTFICDHPQIMSPLAKW-HRSEKGLTERFELFVMKKEICNAYTELNDPIRQRELFEQQGDDEAMFETFCTALEYGLPPTAGWGMGIDRLTMFLTDSNNIKEVLLFPAMKP.... 635
148 0.000e+00UniRef50_D2A0S8 Putative asparagine--tRNA ligase, mitochondrial-like Protein n=6 Tax=Neoptera TaxID=33340 RepID=D2A0S8_TRICA  ali  25  26.....SISQILDKSVGDVITVKGWIKSLRDQKEHVFFDVSDGSTKLQILLPKKSKPED-------LSTGASVVVSGPLTLSPKGQL--ELTANSIEVCGKCVVSEGYPFAPRKQYAAEYIRQYLHFRPRTHKFGALLRLRNAATLAIYNHFNSEGFVNVHTPVLTSNDCEGAGEVFKVVYFNQKSFLTVSGQLHLE-AVAHGLSKVYTFGPTFRAENSKSRLHLSEFYMLEGEIAFVEKLDGLMTCIEQLIKQVTKKLVNDSIEDIEKCQEKFDWLDKSFPVVTYKEAVTILSQNKDKFSENFDSKDGFGKEHEMFLVEYFGKVPTFVIDWPKDMKPFYM--KDNGDGTVAALDLLPNVGEVVGGSLRENNYEKLLEKIPNSNG---HLDWYLDLRKFGSVPTGGFGLGFERYLQLILGISNIKDTIPFPRWPHNCS. 469
149 0.000e+00UniRef50_UPI000D77B50E aspartyl-tRNA synthetase n=1 Tax=Meira miltonrushii TaxID=1280837 RepID=UPI000D77B50E  ali  32  110...............GTELSFKARLHAVRNVSNLAFLILRHQLLTVQGVLRSDNITRHMVRWAERLPIETIVFVRGIVQKPNERLQSVEILIKAIHVISMPNVPLPFHHYGASSVSLPVRMANRVLDLRSPPSQAIFRVQAAVCQAFRQFLNEQGFIEIHTPKLLGGASESGASVFKVDYFGRRACLAQSPQLFKQMCICADFGRVFEIGPVFRAENSNTHRHLTEYTGLDLEMELSDDYHEAMYMIDGLLKSIFAKLQKSHKLEIEIARKMFPIDDFVYPILEYREGIQMLEENGDKPKSDEDLSTRAEMRLGALVKEKYKTDFYILDKFPRSVRPFYTHPDEKNIVASNSFDIFVRGQEIISGGQRIHLADELENNLNKQHIDTHGLEDYLDSFRLAAPPHAGCGIGLERFVMLFLGLNDIRNASLFPRDPKSLR. 586
150 0.000e+00UniRef50_O94567 Probable asparagine--tRNA ligase, cytoplasmic n=101 Tax=Opisthokonta TaxID=33154 RepID=SYNC_SCHPO  ali  28  136..........STNFRDSRVRVNGWVHRMRTQKGIIFIILRDGTGFLQCVLSGKVYDRASYDFI-NLGPESTVCLYGVIKELPEGPGNHELVVDYYQILHAAPTEEAFTNRLNAEAEPSYLLDQRHLVIRGETASSVLKVRARALRAMRDTFENLKMTEVTPPCMVQTQVEGGATLFKFNYYGQDAYLTQSSQLYLEAALPA-LGSVYTIQESFRAEKSLTRRHLSEFTHVEFELPFV-NFGEFLEIIEEFICQTIDRLLDDPIATIKQLNPDFVKPSRPFMRLSYEDAIKYLNEHNILTPEGEHKFGDDIAEAAERKMTDQINRPIFLTYFPLEIKSFYMKRVVDRPELTESVDLMPNVGEIVGGSMRISDIQELLAAYKREGIDPAPYYWFTEQRKYGTTEHGGCGLGLERFLAWLCDRYTVRECCLFPRFTERCTP 568
151 0.000e+00UniRef50_F0WNT8 Lysine--tRNA ligase n=28 Tax=Eukaryota TaxID=2759 RepID=F0WNT8_9STRA  ali  24  130............HLEDTSISVAGRLHSKRASGKLLFYDLRGDGAKIQVMSSLEESHESFYKIHHLLRRGDIVGIQGFPGKSKKGELS--IFPRRITILSPCLHMLPKAHYGLKL--QDTRYRQRYLDLINDETRKVFEIRAKIINFIRHFLDTRRFLEVETPMMNMIAGGATAKPFVTYHNDMNLYMRVAPELYLKQLVIGGLDRVYEVGRQFRNEGIDLT-HNPEFTSCEFYMAY-ADYNDLMTMTEELFSSMVKEISGSYQLTIHSEDPISIDFTPPFRRIKMVTAVEEATGMAIPINEPERSIARLLDKLVGHFIEDNWTQPFFIMDQPVYNSPLAKY-HRETAGLTERFELFLAGAEICNAYTELNNPKVQRERFIEQGDDEAQDEAFCTAMEYGLPPTGGWGCGIDRLAMFLSNKFNIKEVLLFPAMKP.... 584
152 0.000e+00UniRef50_A0A2E0BZP0 Lysine--tRNA ligase n=3 Tax=Bacteria TaxID=2 RepID=A0A2E0BZP0_9BACT  ali  25  59...................KITGRIIAIRSFGKSAFIQISQNTFAFQVFISKDSLGAEMMEFFKKIDIGDFVYFEGSCFYTKTKQLSLE--ATKIELLTKTLSPLPEKWHGLTNV--ETRYRQRYLDLISNAVKDVFKTRAKILKSIRSFLDNKEFMEVETPILHKMAGGAAARPFMTYHNDMDLKLRIAPELYLKRLVVGGLESVYEIGRNFRNEGIST-QHNPEFTMIEIYQAY-SDYEKMMDLVEDLILSCINNLNLDSKIIYQ---ENEINFKKPWKRVHMKDASKLADLAKKMNIDDFGQTGKIIAEVFEENYFKNEYDPTFVYGFPIDISPLA-RRNDLDKNIADRFELFINGKEIANAFSELNDSQDQQQRLKEAGDEEANDMDYVEALSYGLPPTAGAGIGIDRLVMLLTNSPSIRDVILFPHLR..... 487
153 0.000e+00UniRef50_A0A1I7VQ84 Lysine--tRNA ligase n=19 Tax=Eukaryota TaxID=2759 RepID=A0A1I7VQ84_LOALO  ali  25  136...................SVAGRVFSKRESGKLIFYDLHGEGTRLQVLANARHSGDEAFDNLHDIKRGDIIGVNGYPARSKSGELS--IIPYEIIQLTPCLHMLPHTHFGLK--NQETRYRMRYLDLMNPDVKNRFVTRSRMISFLRRYLDNLGFLEVETPMMNLIAGGATAKPFITHHNDMDLYLRVAPELYLKMLVVGGIDRVYEIGRVFRNEGIDQT-HNPEFTSCEFYMAY-ADYEDLMKITEDMLARMVYYMHGTYKIQYHPNGIYEVDFTPPFRKVNIYDGLDKLAVENNVECPAPRTTARLLDKLIGEFLEPTFISPTFLTGHPQIMSPLAKW-HRSIPGLTERFELFVVTKEIVNAYTELNDPLTQRLRFDEQGDDEAQDENYCTALEYGLPPTAGWGMGIDRLAMILTDSNNIKEVLFFPAMRP.... 585
154 0.000e+00UniRef50_D4G7T2 Lysine--tRNA ligase n=4 Tax=Candidatus Riesia TaxID=401618 RepID=D4G7T2_RIEPU  ali  21  24.KRDHLSEDLYKKFYEKEVSVSGRMISKRIFGKASFFTLQDMSGKIQVYVSSNHIKEEIYEKFKKCNLGDLIGVHGKVFKTKTGELT--VDCRKIFLLTRSYRTISSKFYGLK--NKEIQHRNRCLDLINQRSRNTFIIRSKIISWLRCFMNEKGFMEVETPIMQPMYGGASAKPFMTRHNKSELYLRIAPELYLKRLVIGGFEKIFEIGKNFRNEGVSTI-HNPEFTMMEFYEAYK-NYLDLMDFIENLFHEIVESTLKKSGIKY---GENFLNFDKRFKKVTMKQSITIARSYGVQVEKED-SIGEIQYKIFEKVVEKKLIQPTFVTEYPIDVSPLSK-RSRENPLVAERFELFIGGYEIANGFSELNDPVDQTSRFLQQDIDEDTFKDYITSLEYGLPPTAGVGIGIDRLVMLLTNRRSIRDVIFFPALRKK... 490
155 0.000e+00UniRef50_A0A077ZVR9 Lysine--tRNA ligase n=9 Tax=Eukaryota TaxID=2759 RepID=A0A077ZVR9_STYLE  ali  23  106..RTHKLDEFHAAYEEETVAITGRVISIRNSGKLIFIDLQGDDNKVQIFANAANYTGEFDTLLARIKRGDIIGVEGQPGRTKTGELS--VRPTLITSLSYCLHQLPSQHIDTKGLTKDTRFRQRYLDLLNPRTKKTFRVRNEVINFIRNFLLELDFLEVETPMMNMIPGGATARPFETFHNDMKLFMRIAPELYLKMLIVGGIDRVFEIGKQFRNEGIDLT-HNPEFTTCEFYWAY-ADYHDLMDLTEKMLSQMALKIHGSYKFQYHPKGIEEKDFTPPFRRIPMEEAVDKLAAEHKVKCGEPRTVARLIDKLVGHFLEVNCKNPTFITDTPQIMSPLAKW-HRSEAGLSERFELFINYHEIVNAYTELNDPKVQLDFFKELGDDEAQDANFVTALEFGLPPTGGWGIGIDRLTMLMSDTNSIKEVLLFPAMKP.... 585
156 0.000e+00UniRef50_A0A2M7VDV8 Lysine--tRNA ligase n=1 Tax=Candidatus Komeilibacteria bacterium CG_4_10_14_0_2_um_filter_37_10 TaxID=1974470 RepID=A0A2M7VDV8_9B  ali  24  57................KSVTIVGRLRSKRWHGGSCFANLENNWQQIQIYFKKDEVGKADYEFVDLLDVGDIIQISGEPFLTKRGEKT--ILVKKYHLLNKSLLPLPEKWHGLS--DIETRFRQRYLDLINNEVKDIFLKRQAIINYLRNYLDNQSFMEVDTPILQSLAGGAIAEPFVTHHLDIDLFLRIAPEIFLKKLIIGGFTKIYEVARCFRNEGID-HAHNPEFTQIELYWAY-QDYLGLMDFTEQMISQLVWEINGSFLVNYDGHDYNF---QPPWPRIDYRE--ELIKRCKVDINNDEWGKGKIIDELYKKYVRNEIPGPFYIVNHPIELSPLAK-KNKKEPNFVDRFQLVVAGFELVNAFSELNDSFDQAERFVEQQGDQEADAEYVEALKYGLPPTAGLGLGIDRLVQILTNQHNIKNVIFFPTLKPKLE. 496
157 0.000e+00UniRef50_A0A0G0CC05 Lysine--tRNA ligase n=2 Tax=unclassified Candidatus Peregrinibacteria TaxID=1801912 RepID=A0A0G0CC05_9BACT  ali  24  34.QRTHKCEEALELAKNSKIKVCGRLKSFRGHGKLTFGQLQDFSGMIQICFSENALGKDKYKFLKKLDIGDFIGIDGELFQTHKGEFTVFIK--DYFILSKSLRPLPEKWHGLK--DQEALYRQRYLDLMNRNTMERFIFRSDLVKTLREFYWQEGFMEIETPVLENISSGATAKPFITHHNDIDVYLRIAGELWQKMAIGGGMEKTFEVARCFRNEGID-PSHLQEFTMIEHYAAY-WNFEENMRFTERMFEYFLKKLFGSTKLNIKDREGKEVDFKAPWPRKEFVKLIEEIKKKNIQIEDSENLYGGLIDALYKKVVRPKLIQPCFVIKHPADMKPLA-RKNDENEMICDTFQLLVNTWEIINAYSEIVDPVDQRKRFEVQGGDEEAMEEYLLAMEHGFPPISGWGMGIDRLVALLTEQDNLKDVVLFPLLRP.... 507
158 0.000e+00UniRef50_Q9UUE6 Lysine--tRNA ligase, cytoplasmic n=122 Tax=Eukaryota TaxID=2759 RepID=SYKC_SCHPO  ali  23  102...TITLPEFIAKYEGVEVAVAGRVLGLRTAGKLRFYEIHADGKKLQVMCQAQDADTDFAAQHEHLRRGDIIGIRGYPGRSNPKGGELSIFARQCVLLSPCLRMLPKEHYGLK--DLEIRHRQRYLDLMNRSTRDRFVMRSRIIQYIRHFFDSRDFMEVETPMMNMIAGGATAKPFVTHHNDMDLYMRIAPELYLKMLVVGGLDRVYEIGRQFRNEGADLT-HNPEFTSIEFYQAY-ADYYDLMDTTEELLSGLVKDLTGSYKVPYHPEGPEGPDFSRPWRRINMIEYLEEKLNTKFPPGDPPQTCSRLLDKLVGEFIESECINPTFIIGHPQMMSPLAKY-HRSDAGLCERFEAFVATKEICNAYTELNDIFDQRARFEEQGDDEAQDENFCTALEYGLPPTGGWGMGVDRLVMFLTDSNTIREVLLFPHMKP.... 579
159 0.000e+00UniRef50_A0A1G1Y163 Lysine--tRNA ligase n=5 Tax=Bacteria candidate phyla TaxID=1783234 RepID=A0A1G1Y163_9BACT  ali  25  34.EKKQSINQALKTKLGAKIKTAGRILTIREMGKICFCHLFDGSGRLQIVLKQDEV--DLKEFLKLFDPGDFIGLEGERFKTQKGEIS--ILVKKYTLLAKALRPLPEKFHGLQ--DQELKYRRRYLDLISPETYERFLRRSELIKTLREFYWNHGFIEVETPILTNTASGALAKPFVTHYNDLDVYLRLAPEIYLKECLIGGMERVFEIGRCFRNEGLD-PSHLQDFTLCEHYAAY-WNFEDNMKFTEEMFSFILKKLFGGLKLEIKDRAPVKIDFTPPWPRVSFAELLKKDCGLNIDXXXXXXGRGNLIDALYKAVSRDRIIXXXFLINHPLDLSPLA-RKNDKNPQIVDRFQLLVNTWEIVNAYSELVDPVDQKERLEVQAGDQEADDEYIKALEHGCPPASGWGLGVDRLITLLTKQDNLRDAVLFPLLRP.... 489
160 0.000e+00UniRef50_A0A1V9WY89 Lysine--tRNA ligase (Fragment) n=4 Tax=Bilateria TaxID=33213 RepID=A0A1V9WY89_9ACAR  ali  23  391........EIGQVLEDVKLSVAGRCHAKRESSKLIFYDLRGEGVKIQVMANMSYYTSEFYSINAKLRRGDIIGICGHPGKTKKGELS--IVPNHIELLSPCLHMLPHLHFGLK--NQETRYRQRYLDLINDSTRQKFIVRAKVVNFVRKFLDAMGFLEVETPMMNMIPGGAAAKPFVTHHNNMDLYMRVAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLT-HNPEFTTCEFYMAY-ADYNDLMVLTEKMLSQMVLEITGGYKIKYMQVDEFEIDFTPPFRRLRMPETNKMLSEICIKHDPDPRTTARLLDKLVGEFLEEQCINPTFILDHAEIMSPLSKW-HRSVKGLTERFELFMGKKEVINAYTELNDPFVQRERFEQQGDDEAMFENFCTALEYGLPPTAGWGLGIDRLVMFLTNSTNIKEVLLFPAMRP.... 848
161 0.000e+00UniRef50_A0A2C5ZDE4 Uncharacterized protein n=1 Tax=Cordyceps sp. RAO-2017 TaxID=2004951 RepID=A0A2C5ZDE4_9HYPO  ali  32  23.....TIAELDKLPRDSEVNFRARIVTQRQLSKLDFLLFRDQTHSIQGVLSRDEM--EMVHWVQKLPPESLVQVNGKLKAPPEPVGGVEVHIHSIHLVNLAQNAPFTNYRPPE--SLRNRMSSRILDLRHPSNQALFRIRSLVNRKFHEVLFDQGFVEINTPKLQPAATESGAAVFKVNYFGRNAFLAQSPQLAKQMSVSADFGRVFEVGPVFRAENSNTHRHLTEYTGLDIEMAIEHDYHEVIDVIDDFLKAVFKAVY--TMPELAEVQKRWPSSEFKYLILDFRDGVRMLRDDGRDVDEFEDLSTPDEIRLGQLVRDKYDTDYYVLDKFPASARPFYTHKDTQDPRWTRSFDIFIRGQEICSGGQRIHNVDELRASMRAAGMAEDGMEDYLSAFDLGAPPHAGAGLGLERIVAWMLELGDVRYASLFHRDPKSL.. 457
162 0.000e+00UniRef50_Q7NC34 Lysine--tRNA ligase n=13 Tax=Mycoplasma TaxID=2093 RepID=SYK_MYCGA  ali  23  35...THNTKSLKEKYDDKPITVSGRVILIRR----TFILIQDFHSELQLYINKNKQPDLFKYFNDYLDLGDVVCATGKPMKTNTNELSLDL--ESLKIISKSLRVPPEKFHGI--ADEEIRSRKRYLDLVNKESKERFVYRSKIIAAMRQYFNENGFLEVETPFLHAQIGGAAAKPFVTRYNDRDYYLRIAPELPLKKLIVGSFEKIYEIGKCFRNEGMDST-HNPEFTSVETYVAYV-DYIYMMELTEAIIKYIAKAIGISHTN----IKNETIDWNKPFKRIKMTEALDLAKKHKVHVKEHEKTIGHIINLFFEEFCEKKLVEPTFVTHHPVEISPLSKL-DYSDPRYTERFELFAFGKELANGFSELNDPIDQRQRFEKQGNDEEMDEDFLEALENGLPPTGGLGIGVDRLVMMLTGTTSIRDILFFPHVR..... 490
163 0.000e+00UniRef50_A0A147ESA0 Aspartate--tRNA ligase n=5 Tax=Leucobacter TaxID=55968 RepID=A0A147ESA0_9MICO  ali  37  2......IKDLAAREDG-TVRVSGWVEKVRDQRYVQFVVLRDETGAVQLVNPRSDVLVPRTTTISELTQGSFVTVTGELQHNERKLGGVEVQIDEIEVVAASLPDNPV----AGDSNIDVRLDWRFLDLRRPEQNLVFRVQTAFLHALRQVWVDRGFIEIQTPKLMASASESRAELFEVEYFEGKAFLAQSPQFFKQMAQAAGFGGIFEVGPAFRADHSFTSRHATEFTSIDTELSWIDSPEDVMELHEELLVAGLTAVKEQLGAEIELFGIEIEVPSRPFPRIPLAEAKEIVKAEGYEVRADADMDPEGERRIAAHVRKKYGHDFVFLTDYDASIRPFYHMRNPENPQLTRSYDLIYRGTEISTGAQREHRIDVLEAQAVEKGMDPKELGFYLDFFRYGVPPHGGFGMGLNRVLMLMLQQQSIREVTYLFRGPNRLLP 442
164 0.000e+00UniRef50_A0A0E0CFC6 Uncharacterized protein n=2 Tax=Oryza TaxID=4527 RepID=A0A0E0CFC6_9ORYZ  ali  33  43......VAALGRDVAGRAVRVRGAAHAVRAVGRVAFLVLRQGSSTVQXXXXXXXXXXXXXRFAAGLSRESVVDVAGVVSARGTTQQEVEIQVKKLYCISKATPNLPISVDDAARVGQDKRLDFRVIDLRTPANQAIFRVQCEILASTR-------------PKLIGGSSEGGAAVFKLDYNGQPACLAQSPQLHKQMAICGGFERVFEVGPVFRAEDSNTHRHLCEFVGLDMEMAIKDHYFEVCDVVDRLFVAMFDHLNKNCAKELEAMNRQY-----PFKPLRHPDA-----EAGVHVEAMGDLNTEAKKKLGELVQAKYDTDFYMLCRYPSAVRPFYTMPCSDDPRYSNSFDVFVRGEEIISGAQRVHVPEVLSRQAEARGIDVGSIAAYVDAFRYGAPPHGGFGVGLERVVMLFCGLGNIRKASLFPRDPRRLNP 483
165 0.000e+00UniRef50_UPI0007EE7B3A probable asparagine--tRNA ligase, mitochondrial isoform X3 n=6 Tax=Boreoeutheria TaxID=1437010 RepID=UPI0007EE7B3A  ali  28  34.........LRAQHTGERVKVQGWIRSVRSQKEVLFLHINDGSSLLQIVADASFDCRE-------LAFGSSVEVQGQLVKSPAKRQNVELKAENITVIGNCDAK-AFPIKYKERHPLEYLRQYPHLRCRTNVLGSILRVRSEATAAIHSFFKDRGFVHIHTPVITSNDCEGAGELFQVNFFDVPTFLTVSGQLHLEV-MSGAFAQVFTFGPTFRAENSQSRRHLAEFYMVEAEISFIENLQDLTQIMEDLFKSTAMMVLSNCPEDVELCHKFL--------------------------APGKKWGADLQTEHEKYLVEHCGNIPVFIINYPLALKPFYMRDNEDGPQTVAAVDLLVPGGELFGGSLREERYHFLEQQLARSGL-TEAYQWYLELRRFGSVPHGGFGMGFERYLQCILGVDNIKDVIPFPRFTHSC.. 440
166 0.000e+00UniRef50_UPI0004969BAD lysine--tRNA ligase isoform X1 n=2 Tax=Stegastes partitus TaxID=144197 RepID=UPI0004969BAD  ali  25 1396....................VTGRVHAKRASGKLIFYDLRGEGVKLQVMANRSYKSEEDFTAINKLRRGDIIGVRGNPGKTKKGELS--IVPSEMFLLSPCLHMLPHLHFGLK--DKETRYRQRYLDLINDYVRQKFITRSKIITYLRNFLDQMGFLEIETPMMNIIPGGAVARPFVTYHNDMNLYMRIAPELYHKMLVVGGLDRVYEVGRQFRNEGIDLT-HNPEFTTCEFYMAY-ADYHDLMEITEKLLSGMVKHITGGYKVTYHPDGPEEIDFTPPFKRVSMTHDLEKIMGVKFPPSDPPRTTARLLDKLVGDYLEVTCINPTFICDHPQIMSPLAKW-HRSQKGLTERFELFVMKKEICNAYTELNDPIRQRELFEQQGDDEAMFETFCTALEYGLPPTAGWGMGIDRLTMFLTDSNNIKEVLLFPAMKP.... 1843
167 0.000e+00UniRef50_A0A2N3HPL0 Asparagine--tRNA ligase n=23 Tax=Bacteria TaxID=2 RepID=A0A2N3HPL0_9FLAO  ali  28  3...TRTVSELLSQKIAAEVDIKGWVRTFRA---NRFIALNDGSTIIQCVVDFENTEEI---ILKRITTGAAVHIKGELVESLGKGQNVEIIVKNIEILGDSDPET--YPIQPKKHSFEFLRENAHLRTRTSTFSAVMRLRSALSFAIHSYFNENGFYYVNTPIITGSDAEGAGEMFRVDFFGKETNLTVSGQLEAET-YAMSLGKVYTFGPTFRAENSNTSRHLAEFWMIEPEVAFM-DLAGNMDLAESFLKYIIKYILDNNREDLDFLNQRLLDEEKNFTRLSYTEAIGILRDSTPNKKKKDEWGTDLQSEHERFLVEKHFKCPVILYDYPANIKAFYMRLNEDGKTVRAMDILFPGIGEIVGGAQREERLDVLKKKMAALNIPEEDLWWYLDLRKYGTAVHSGFGLGFERLVMFATGMSNIRDVIPFPRTPQ.... 473
168 0.000e+00UniRef50_A0A2N2F082 Lysine--tRNA ligase n=1 Tax=Elusimicrobia bacterium HGW-Elusimicrobia-1 TaxID=2013763 RepID=A0A2N2F082_9BACT  ali  24  65...........EERTDVNVRIAGRLTLRRVMGKAAFADVTDSTGRIQIYVKFNVLGEAKYKIASELDIGDIVGVEGHVFRTRTGEIT--VFAKDFALLSKSMRPLPEKWHGLK--DPEARYRRRYLDLINPEVREVFRKRARVVDAVRDGLKARGFLEVETPSMQALAGGAVAKPFITRHNDTNLYLRIAPELFLKRLLVGGFDKVFEIGKSFRNEGID-RWHNPEFTMAEIYAAY-SDYGDMMKLCEELVAASAAAVSD--GKDFVCDGKNF-AVNAPFARINFFD--ELAKRSGADFRPGDMPAHKILDAAFDKYVVPHLAEPTFVCDFAARFSPLA-RPSDADPFLAERFELFIASQEVANAYSELNDPSLQKKNFSRQKDDETADDDYVAALEHGMPPAGGLGIGIDRLVMLLSGAPSIREVILFPTLKP.... 503
169 0.000e+00UniRef50_M7Z141 Lysine--tRNA ligase n=1 Tax=Triticum urartu TaxID=4572 RepID=M7Z141_TRIUA  ali  23  131...........EKLADVTECLAGRIMNKRSSSKLLFYDLYGDGVKVQVMADAELEDTEFSSFHSGVKRGDIVGICGIPGKSNRGELS--VFPRKFVVLSPCLHMMPRQKSEGSAVDQETRYRQRYLDLMNHEVRHIFKTRSKIVSFIRRFLDGLDFLEVETPMMNMIAGGAAARPFVTHHNDMKLYMRIAPELYLKELVVGGLDRVYEIGKQFRNEGIDLT-HNPEFTTVEFYMAY-ADYNDLMELTEAMISGMVKELTGGYKIKYHANGVDEIDFTPPFRRIDMIEGLEAMAKLEIPKDPPPQTTTRLLDKLVGHFLEETCVNPTFIINHPEIMSPLAKW-HRSRPGLTERFELFVNKHEVCNAYTELNDPVVQRQRFEEQGDDEAMDETFCTALEYGLPPTGGWGLGIDRLTMMLTDSQNIKSATLF......... 602
170 0.000e+00UniRef50_D5EVC3 Asparagine--tRNA ligase n=39 Tax=root TaxID=1 RepID=D5EVC3_PRER2  ali  28  1MKRTKIIDVLKSTEYGKEVCVKGWVRTHRSSKAVDFIALNDGSTIVQIVVDPTKFDEQV---LKDITTGACISAEGTLVESQGAGQSSEIQATKLEVYGLCGNDYPMQ---KKGQSFEVMRKNAHMRLRTNTFGAVMRIRHNMAMAIHTYFHEHGFFYFHTPLITASDCEGAGNMFQVDFFGEQTSLTVSGQLEGE-LGATALGSIYTFGPTFRAENSNTPRHLAEFWMVEPEVAFL-DQEELMDLEEDFIKYCVRWALDNCKDDLEFLNKMIDKLKETFVRLPYTEGINILQENGKKFEFPCNWGDDLASEHERYLVEEHFKKPVIMTDYPRAFKSFYMKQNQDGPTMQGTDVLFPQIGEIIGGSVREESYDKLMGEINRREMDQTHLWWYIDTRKWGSCPHAGFGLGFERLILFVTGMQNIRDVIPFPRTPKS... 476
171 0.000e+00UniRef50_A0A218NLR4 Lysine--tRNA ligase n=3 Tax=Archaea TaxID=2157 RepID=A0A218NLR4_9ARCH  ali  25  29...TNHSEEIKDKLEDTDVTAAGRIIGLRHMGKLYFFDLLDGEGKIQVMAAPNFSSESSLKILENLDTGDFAGVEGKVTKSKRGEIS--IAAKEITVLSKSLLSLPEKFHGLT--DIELRYRKRYLDLINTEVRKFFVTRSKILKYMRDFFDSRGYVEFETPILQPTYGGANASPFKTYFNNQDMFLRIADELYLKRLIVGGFEKVYEVSKDFRNEDIDST-HNPEFTQIEAYEMFK-DYEDYMKMTEELLSGMVKYLFGSYKIKYQGKELDF---TPPFKRLTDKEAKEVAERENLDI--PMKNSYHVADALFDKYIKPELFNPVFVLDFPAYMSPLTKDK-RGNNKLSERFELYLAGKEDANCYSELTDPIEQRKKFEEQKGDPEADEDFLEAIEYGMPPTAGIGIAIDRLAMILTDNISIKEVITFP........ 474
172 0.000e+00UniRef50_M3BBH4 Uncharacterized protein n=19 Tax=leotiomyceta TaxID=716546 RepID=M3BBH4_PSEFD  ali  38  110...............GPQVVFRATVENARNQSKLSFLVFSQQSATIQVVAASDTLSRQMVKFAGSIPTESEVIVHGLLNKPKTTIQNLEVHVNKLYILCKADTQLPLQVADAEIVSLNTRLNNRTIDLKANLNHSIFKIKHGVQRLFTEFLEERGFIGINTPRMLGAASEGGSSVFEVKYFNDKAYLAQSPQLYKQMMIASRFERVMEIGPIFRAENSNTARHLTEFTGLDLEMAFEEDYHEVVSLIEELMLFIFDGLRTRYKKESDYVRTQVEDFKLPVPRLHFSEGIAMLRAAGEEVGDFDDLSTPQEKKLGALVLEKYGSDFYVLDQYPLAIRPFYTMPKEPNAGYSNSYDFFMRGQEIMSGAQRIHSAPYLEQRMKEHLVDPKSDGDYVNAFRYGCPPHAGGGIGLERIVMLWLGLPNVRLASLFPRDPGRLMP 577
173 0.000e+00UniRef50_A0A1V5RPW5 Lysine--tRNA ligase n=1 Tax=Parcubacteria group bacterium ADurb.Bin305 TaxID=1852941 RepID=A0A1V5RPW5_9BACT  ali  22  49................KKVVVAGRIKAIRGHGALIFADLSDQNSQIQIILKADILGKEKIKFFEDIDLGDFIEVAGKFYLTQKKEKS--VLVSNFKILAKSLRPLPKSWYGLE--NIEERYRKRYLDLVNQEVKQRFVVRSKIISLIRDYLNREGFLEVETPILQTLYGGANAKPFITHLLDLTLYLRIAPELYLKRLIVGGFEKIYELGRNFRNEGLD-REHNPEFTMLELYEAYKT-RDDLMKLISDLILYVVKNLKNE-------INVKFSS-KKRWPVIDYEELLKKHKSRDFQIAANQNDSVAKISELIFKKIRSQIIEPTFVINQPVEISPLAK-TCPKDPLKAHRFQLIVGGWEIVNGFSELNDPLEQRKRFDWQKGDLEADKDFLEALEYGLPPTAGLGVGIDRLVAVLTGAPSLNEVILFPFMKP.... 477
174 0.000e+00UniRef50_Q2IPX5 Lysine--tRNA ligase n=11 Tax=Bacteria TaxID=2 RepID=SYK_ANADE  ali  25  39....HLAEELLRHHGDQPASLAGRVLAVRSFGKAAFLRVRDRSAELQVWVKKDRVGDQAFEVFKLLDIGDIVGAEGPATRTKTGELTLE--ARTFTILTKATRPLPEKWHGLTDV--EQRYRQRYVDLVTPGVREAFVKRARIVSGIRRFLDARGYLEVETPTLHKEAGGAAARPFETHHNDLDLKLRIATELHLKRLVVGGLDRVYEIGRIWRNEGID-RRHNPEFTSIEFYQAYATH-EDLMRLTEELMHQLAVEVTGGPVVTFQG---QAIDLTPPYPRVSMAEALSRAAARENDSEDAKKTPGEAVALAFEIFGEPQLDRPAFVVDFPLETSPLSRRRDA-DPRLVDRFELFAAGMELANAFSELNDPADQRARFEAQAGDEEAMEDFVRALEHGMPPTAGEGIGIDRLAMLFTDSASIRDVILFPLLKSR... 512
175 0.000e+00UniRef50_A0A1J4WMX6 Lysine--tRNA ligase n=4 Tax=Parcubacteria group TaxID=1794811 RepID=A0A1J4WMX6_9BACT  ali  25  32..RTHEIKTVHDQFKKKTVTVCGRMTGLRFHGGAIFADLKDSTGKIQILFKKDTL-AEQFEFIQYFDIGDFVWASGALFATQQGEQTIE--AKQFGMLSKSVRPIPQEYFGLS--DEEERSRRRYVDLLNEDVYARFQKRFAIIKAMREYLYDKGFIEVETPILQPIHGGANAKPFKTYHNGIEMYLRVAPELYLKRLIIGGFDKIFEIGKNFRNEGID-REHNPEFTTMELYWAY-QDRDGLMQFTQDLFSHMFESFIKNVK-EYEYQNAVY-RLKTPYPRIQYDQALKQAKAKGIEVEHNEPKYKIADTII-KKLVYPTLTQPTFLIDHPIEASPLSKASN----NKALRFQLVIAGLELCNAWSEINDPAYQKEQFANQAGDEEADTDYIEALEYGMPPTAGIGIGIDRLIAFITNAPSIKEVIPFPTLRPR... 483
176 0.000e+00UniRef50_A0A0N1K480 Lysine--tRNA ligase n=47 Tax=root TaxID=1 RepID=A0A0N1K480_THEVU  ali  24  39....HDLKDAAELSDGQGVRVAGRIYAIRKMGKLDFISISNIEGKLQLLLKKDIVGEEAFDQFHEIDIGDFIGVEGEMFTTKTGQKTLRIH--SYKFLGKSLKPLPEKWHGIQDV--ELRYRQRYLDLMTDESKKRFLLRSKMISEMRRFLDDRGFFEVETPVLTNKASGALAKPFITHHNDIDMFLRIAPETYLKRLIVGGFTKVYEFAKCFRNEGV-SPQHLQEFTMVEGYVAY-WNYKQMMKLMRDLILHTLDKVFQTTKV---VVQGNEIDFSKEWEVVSFRDLI--LKDIGIDIDPELLGRGNFIDLLYKKVSRPKIIEPIFLVEHPIDLSPLA-RANDENPSLTDRFQIVVNGAEIVNAYSELVDAIEQRKRLETQALDEEAMEDYLLAMEHGMPPIAGWGFGVERLLMMFTDCDNIKDCVLFPITRPKIE. 495
177 0.000e+00UniRef50_A0A2P4YCL1 Lysine--tRNA ligase n=2 Tax=Phytophthora palmivora var. palmivora TaxID=611791 RepID=A0A2P4YCL1_9STRA  ali  26  519........EAGSHETDVVVSVAGRLHSKRASGKLVFYDLRADGLKLQIMSDVGTYSPEAFSQIHNLRRGDLVGVKGHPGKSKKGELS--IFPQQLVLLSPCMHMLPKSHAGLTLQ-QDTRYRQRYLDLMNDDTRGVFQTRAKIINFIRRFLDEKHFLEVETPMMNMIVGGATAKPFVTYHNDMNLFMRVAPELYLKQLVIGGLDRVYEIGRQFRNEGIDLT-HNPEFTSCEFYMAY-ADYNDLMTLTEKLFSEMVKEITGGYTITIQDEEPVTIDFTPPFKRVSMVSAVEEATGVKIPIDEPDKCVAILEDKLVGHFIEDYWTKPFFIMDQPVYNSPLAKY-HREKPALTERFELFLAGAEICNAYTELNNPKVQRERFIEQGDDEAQDESFCTAMEYGLPPTAGWGCGVDRLTMFLSNRFNIKEVLLFPAMKP.... 978
178 0.000e+00UniRef50_A0A0V1D289 Lysine--tRNA ligase n=14 Tax=Trichinella TaxID=6333 RepID=A0A0V1D289_TRIBR  ali  23  464...........EEVLNETVCVAGRIHSKREAGKLIFYDLRAEGTRLQIMANGKFYKTGEAEFLESVRRGDIVGCTGHPSRTKKGELS--IIPTELVLLTPCLRMLPHLHYGLK--NQETRYRMRYLDLINNNVRNIFIRRAQILNYIRKYLDSIGFLEVETPMMNMIPGGATAKPFVTHHNDRDLYMRVAPELYLKMLIVGGIDRVYEIGRNFRNESIDLT-HNPEFTMCEFYMAY-ADYNDLMKITEDLLSGMVKHLFGSYLVTYHPNGPETIDFTPPYRKISMSELVKELCLKHEVECPPPRTTARLLDKLVGEFIEIDCITPTFIIDHPQIMSP-----HRAIPGLTERFELFVMTRELCNAYTELNDPVVQRERFEEQAGDEEADEVFCNALEHGLPPTAGWGMGIDRLTMLLTDQNNIKEVLLFPAMKP.... 917
179 0.000e+00UniRef50_A0A223B3U7 Lysine--tRNA ligase n=228 Tax=Bacteria TaxID=2 RepID=A0A223B3U7_9FIRM  ali  24  36...TAHSNDIKDALEDEEVSCAGRIMSRRIMGKAAFFDIQDKQGRIQCYIKRDDIGEEEYKWFKTYDIGDIVGIEGKVFKTKTDEIS--IHVTRLELLSKSLQVLPNKWNGLK--DTDIRYRQRYVDLMNQDVRETFVKRAKIIHEMKRVLEEDGYLEVDTPILTTIAGGANARPFATYHNGLDLHMRISNELYLKRLIVGGLDRVYEMGKMFRNEGMD-RNHNPEFTSMECYMAY-GNMENTMDVTEQLVYKAQMEVNGTPIIKYQGKEFDV---TPPWRRLNMADAVKEVTGVDFEAEVKHLNRGKLIAEMFEEYCEDYLDGPIFIVGHPVEVSPLSK-RDPEDPRITRRFEAYINGWEIANAFSELNDPIDQFERFAEQGIDEEADLDFVNALEVGLPPTGGLGVGIDRVIMLITDSASIRDVLLFPTMKP.... 494
180 0.000e+00UniRef50_A0A0G0YLZ2 Aspartate--tRNA(Asp/Asn) ligase n=32 Tax=root TaxID=1 RepID=A0A0G0YLZ2_9BACT  ali  37  3.ERT-LIADLHGGIDG-EITVKGFIDVRRDHGKLIFFDIRDRSGFVQAVALPN--NAEALTVAQSLKPESSVSVKAKVNKRPERMGDIELELLDIEVLSLG-GELPFE--KDADINLDTSLDNRPFTLRNTRNRAIFKVQHEILQAYRSFLVDKGFTEFEAPKIVGDDAEGGGNIFRIEYFDRWAYLATSPQLYKQIL-VGVFERVFSIGNVFRAELHSTSRHINEYTSLDVEMGFITDHTDIMRLEEEFMHHLYTALEKNCKAELTIFKAELPMPEGNFPSMKLKEALAIAKETGEDCVNEPDLAPEHERWLSKYAKEHFKSDYLFVTHYPVTKRPFYTYEDENDKGYTKSFDLLFRGVEVTTGGQRIHTYDELIEKMKAKNLVPENFSFYLQTFKSGMPPHGGWGMGLERLTQKILGLENVKEATLFPREINRID. 440
181 0.000e+00UniRef50_Q4WHE9 Cytoplasmic asparaginyl-tRNA synthetase, putative n=41 Tax=Opisthokonta TaxID=33154 RepID=Q4WHE9_ASPFU  ali  28  148..............AGTRVRVLGRVHRLRVQKDVIFLTLSDGYGYLQCVLTGNLTKTYD---AMTLTLETSMAIHGEMRAVPHAPNDRELHADFFTVIGRAAGDEAITTRVAKDADPQTLYDNRHLVLRGEISSAVMKVRAACLKAFRQVFEEKRMLEVTPPAMVQTQVEGGSTLFKFDYYGEDAYLTQSSQLYLETCLPS-LGDVFCVCPSFRAEKSLTRRHLSEYTHIEAELDFIT-FTDLLDHLEEVICRVIELTLANTAALIKQLNPDFKPPSRPFRRMKYADAIQWLVEHDIPNEEGPHQFGDDIAEAAERKMTDIINQPIFLTHFPAEIKAFYMKKDPEDRRVTESVDVLMPGGEIVGGSMRMDDWDELMAAYKHEGMDPTPYYWYTDQRKYGTSPHGGYGLGLERFLAWLCARYTVRDCCLYPRFTGRCTP 574
182 0.000e+00UniRef50_A0A1F4CB87 Asparagine--tRNA ligase n=14 Tax=Bacteria TaxID=2 RepID=A0A1F4CB87_9PROT  ali  30  20..................VTLKGWVRTRRDSKGISFIHVSDGSCFVQVVAPATLANYAS--EVMHLTAGCALEATGSIVPSPAKGQPFEMQASEIKVLGWVEDPD-TYPIQPKPHTMEYLREVAHLRPRTNVIGATTRVRHSVAQAIHRFFHENGFAWINTPIITSADAEGAGELFRVDFFGRETFLTVSGQLNVES-YCLALSKVYTFGPTFRAENSNTSRHLAEFWMVEPEIAF-ADLADNATLAEALLKYVLAAVLTERGDDMAFFDERIEKVDKAFVRMDYTEAISILGAAKAKFEFPVQWGMDLQSEHERYLAEQHVGGPLVLMNYPKEIKAFYMRLNDDGRTVAAMDVLAPGIGEIVGGSQREERLAVLDARIDEAKLDKNHYGWYRDLRRYGSVPHAGFGLGFERTVSYITGLANVRDVIPFPRTPG.... 462
183 0.000e+00UniRef50_A0A0V1EIT7 Lysine--tRNA ligase (Fragment) n=6 Tax=Trichinella TaxID=6333 RepID=A0A0V1EIT7_TRIPS  ali  23  802...........EEVSNETVCVAGRIHSKREAGKLIFYDLRAEGTRLQIMANGKFYKKGEAEFLESVRRGDIVGCTGHPSRTKKGELS--IIPTEMVLLTPCLHMLPHLHYGLK--NQETRYRMRYLDLINNNVRSIFIRRAQILNYIRKYLDSIGFLEVETPMMNMIPGGATAKPFVTHHNDRDLYMRVAPELYLKMLIVGGIDRVYEIGRNFRNEGIDLT-HNPEFTMCEFYMAY-ADYNDLMKITEDLLSGMVKHLFGSYLVTYHPNGPETIDFTPPYRKISYFELEKKLNVKLPPPKPPPRTTARLLDKLVGEFIEIDCITPTFIIDHPQIMSP-----HRTIPGLTERFELFVMTRELCNAYTELNDPVVQRERFEEQAGDEEADEMFCNALEHGLPPTAGWGMGIDRLTMLLTDQNNIKEVLLFPAMKP.... 1271
184 0.000e+00UniRef50_D1Y3B9 Lysine--tRNA ligase n=2 Tax=Pyramidobacter TaxID=638847 RepID=D1Y3B9_9BACT  ali  22  42....HTVAQVRKDFDEAKFSMAGRLMTLRRQGKAAFVNMQDETGTIQLYFRYDTLGEKDYTFFKKLDSGDIIGIVGHPFRTQRGELT--VAVERFRLLTKALRPLPEKWHGLT--DLEIRYRKRYLDLINPEAREVFRKRAKIISTFRAVLEKHGTLEVETPVLSYLAGGANARPFITYHNGANMYLRIATELYLKRLVVGMMGRVYEISKDFRNEGMDLT-HNPEFTMMEVYWPY-ADYVDMMNLTEELIRESCIAANGTPVIERNGVMLDF---AKPFRRATMVELVKEARKNKIEIT-GHESRFKILTMFMEAFVEEKLVQPTFVMGHPVEISPLSK-KDPEHPDYTHRFELFCCGKELSNGYSELNDPIDQKNRFKTEGEDETHDEDFVEALEQGLPPTGGLGIGMDRVVMFLTNCRSIRDVIFFPTMKP.... 498
185 0.000e+00UniRef50_A0A099P6V8 Lysine--tRNA ligase n=7 Tax=Eukaryota TaxID=2759 RepID=A0A099P6V8_PICKU  ali  24  118...........ETKPDVKVSVSGRIMVKREAGKLKFYNLQNNGVNLQIMAQAQDAEGDFAEMHKLLRRGDIIGVEGYPGRTKGGEGELSVFATKVTLLTPCLHMLPTEHYGFK--DQEARYRKRYLDLMNKNVREIFLARSKIIKYIRKFLDSRDFVEVETPILNIIAGGATAKPFTTHHNDMEMFMRIAPELYLKELVVGGLERVYEIGRQFRNEGIDMT-HNPEFTTCEFYQAY-ADVYDLMDMTELLFSEMVKEITGDYKVKYQPEGPETLDFSRPWKRVNMIEELEILIKNKIDCPPPLTNARMLDRLVGE--IEDASINPTFIFGHPQIMSPLAK-KDRKTPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQGDDEAQDETFCNALEYGLPPTAGWGCGIDRLAMFLTNSNTIREVLLFPTLKP.... 576
186 0.000e+00UniRef50_A0A2D6P655 Asparagine--tRNA ligase n=2 Tax=Candidatus Woesearchaeota archaeon TaxID=2026803 RepID=A0A2D6P655_9ARCH  ali  31  14.....TISEIKAQYSGKKVKLRGWISKKRSLKQKIFLVLRDSTGHIQTVTSSDS---KAWKSAEEITTESSCFIEGVVKKDPRAPDGYELIVSKILIVGLAET-----WPIARDTSSEFLRDIRHLSIRDPKQQAILKIRSGVISGFHEYFRSRGYHEHQSPSFTPTPGESGAETFEVKYFGKKAYLTQTWQLYAEMMLP-VLEKIYTMAPSFRADKSMTSRHLTEYWHAEAETAWQE-FPELLQTIEECVRYICSKISKEYASEMTLLGSDVKYFSKKFKKLKYRAAVEELKKAGFKIKFGDDLGTT-----EEKYLVDKRKIPLFITHYPTSLKAFYMKRDKKDPDQVLASDLLIPGGELVGSSERSLDFEDVKKRLRSAGEDPKKYEFYFDSSRYGKIPHSGFGLGIERLVMWLTGAESVKECIAFPRTPTRFTP 435
187 0.000e+00UniRef50_A0A2D6INH1 Lysine--tRNA ligase n=1 Tax=bacterium TaxID=1869227 RepID=A0A2D6INH1_9BACT  ali  23  33.KRSHTVAEALEDFDATPVTLNGRVMAVRSHGSVAFLDLRDATGTLQVQINKDSMPEDIFAGLDTLDTGDFIEAVGKLITNARGTQTLE--AVEFHMLTKSINPLPSNYHGLKDH--EARFRNREVDLLNDEAREILLTRSRIISWIRTYMLESGYLEVETPALQALHGGAAAQPFTTHHNGVPLHLRIAAELHLKRLLVSGFEKVFEIERRFRNEGID-RQHNPEFTMLEAQWAY-ADYEDLMDAMEQMLHKLCMDLFGTTSIEWQGTMLSW---EAPLPRLRFVDGVDILTETNPNVPPAAKNYYQLVDELYKHLVRPNIVQPTILYDYPAQMVPLAK-PSLSDPRIAEKFQPVAMGLELGNNYTEQNDPVIQRDVLEEQQGDEEADEPYLRAMEYGMPPNVGWGIGIDRLVMLLTNAASIRDVIAFPLLRPK... 489
188 0.000e+00UniRef50_A0A2M7UIG8 Lysine--tRNA ligase n=1 Tax=Candidatus Peregrinibacteria bacterium CG_4_10_14_0_2_um_filter_43_11 TaxID=1974776 RepID=A0A2M7UIG8_  ali  23  70..RTHKIADAREKNPKKDIQVAGRIMTLREHGKLIFAQIQDQEGQLQVCWMRGFTPDAVFDFVKLLDLGDFIGLTGDMFITKHGEPTVLI--SECQLLSKSLRPLPDKWHGLK--DREKCYRDRYLDMMNPETRKRFLVRSRFIQTLRDFYYEHGFVEIETPILENVSSGATAKPFTTHHNDIDVYLRIAGELWQKTAVVGGFERTFEIGRVFRNEGMD-PSHLQEFTMVEHYAAY-WNYEDNMNFTEQMFEHLLKTILGTTQITIKDGKDEVVNFNTPWPRVEFYSLIKKMKKKGIVIEEMDMGFGSLVDHLYKKVSRPKLIQPTFVIRHPVDMKPLA-RKSDDNSNLCDTFQLLVNGWEVINAYGEIVDPIDQRERFENQAGDEEAMEEYLRCMEHGMPPMSGWGMGVDRLLTLLTHQDNLRDLVLFPLMRPS... 538
189 0.000e+00UniRef50_D7G2B1 Asparaginyl-tRNA Synthetase n=14 Tax=Eukaryota TaxID=2759 RepID=D7G2B1_ECTSI  ali  29  42.KRTR-VKAIMEALLGKTVAVKGWVRTKRDQKAFSFVEINDGSCMVQVVIPQDV---PTYSAVERLTTGASVSVTGVVVESPGKGQRFEVKAQEVHVVGECPTEYPLQ---KKRHTLEFLRGIAHLRPRTNTIAAVARVRSALAQATHDFFREEGFLYLQSPIITASDCEGAGEMFRVDFFGKPAFLTVSGQLSGETH-ACALGDVYTFGPTFRAENSQTTRHLAEFWMIEPEMSF-ADLRDDMDNAEAFVKHVVSHAMEVCGSDLEFFNKFYD-----------KELLQRLQRIKDK--------PFVRTEHERWLAETRYDTAVFVYDYPRDIKAFYMRDNEDGKTVAAMDLLVPGVGELIGGSQREERLEQLEAKMVEFNLSPEDYWWYNDLRRYGSVPHAGYGLGFERLVCYVTGVENIRDAIAFPRSPGS... 475
190 0.000e+00UniRef50_A0A087G590 Lysine--tRNA ligase n=11 Tax=Mesangiospermae TaxID=1437183 RepID=A0A087G590_ARAAL  ali  23  121...........DHVEDDQISLAGRIMSKRSSSKLFFYDLFNRDYTVQIMADKSELDEAEFARLHNVKCGDIVGVSGFPGKTKRGELS--IFPRLFTVLSHCLHMFPRQKAGRSNIDQETRYRQRYLDLINNESLQIFKTRTIITKHIERYLDDRDFWEVETPILNRNAGGAAARPFESHHNDMKLSMRIAPELFLKQLVVAGLDRVYEIGKQFRNEGIDLT-HNPEFTTCEFYMAY-ADYNDLMDMTEELLSGLVKELTGGYKIKYHANGYDVIDFTPPFRRIDMVEDLKKIAEINIPKDPPPMTTARLLDKLVGHFLEGTCDNPTFIMNHPEIMSPLAKS-HRSKKGLTERFELFVNQHELCNAYTELNDPVVQRQRFADQGDDEAMDESFCTALEYGLPPTGGWGLGIDRLVMLLTDSLNIKDVILFPLMKPQDEP 597
191 0.000e+00UniRef50_A0A0G0QIN7 Lysine--tRNA ligase n=2 Tax=Microgenomates group TaxID=1794810 RepID=A0A0G0QIN7_9BACT  ali  22  37....IDIASALEKSE-QAVSVCGRIMSIRGHGNMSFFDLKDETGKIQLWFQKNVL-KKIYKTLELIDVGDIIFAKGDVTKTKSGEIS--IDVSDFQLLSKSIRPLPSTWFGVK--DIEDRYRKRYLDLINDDVRRRFNLRTKLVREIRNYLDGLGYWEVETPTLQPLYGGANAKPFKTHHNDHNFYLRIADELYLKRLIIGGYQKVYEICKDFRNEGVDQT-HSPEFTMIEYYESY-ADYQKMMDVTEGLFKHLADRVLGQMKIK---VGGREIDISQKWPRVTMVDEIKEKLGLDVEKEDGGETKGQLVYTIFEHKVTDQLNGPIWIIDYPKDVSPLSK-KHATKEGWVERFEGYIGGKEICDGWSELTDPMEQRSRFSDEKLSREDDEEFLEAMEYGMPPLGGIGIGIDRLTMFLTNTWLIKETILFPTLRP.... 481
192 0.000e+00UniRef50_A0A2T0FDU9 Asparagine--tRNA ligase, cytoplasmic n=1 Tax=Wickerhamiella sorbophila TaxID=45607 RepID=A0A2T0FDU9_9ASCO  ali  27  119..RTKIIKA--TPYRGKRIQVSGWIHRLRQQKGFTFIVLRDGTGLLQVILSGDLSNAY---QTQRLTLESTITVYGELHPLPEGPGGHELVADYYEVVGLAPSDDAFSNQLQADTDPSILLDRRHLALRGDALTSIMKVRAALLKSIRSVYEDEGITEVTPPCLVQSMVEGGSTLFKLDYYGQNAYLTQSSQLYLETCVPA-LGDVYCIQESFRAERSHTRRHLSEYTHIEAELGFLT-FEELLGHVERMFVSLVDKVLKDPGPLVKQLNPKFEPPQLPFMRMTYVDALEWLNEHGIPNEDGEEFFGDDIAEAAERKMTDTINKPILLTRFPVEIKSFYMEKCKDDPRVTESVDLMPNVGEVMGGSMRISKLDELMAAFKRENMDPAPYYWFSDVRKYGAFPHGGYGLGTERILAWLCDRFTVRDCSLYPRFP..... 550
193 0.000e+00UniRef50_P41258 Lysine--tRNA ligase n=839 Tax=root TaxID=1 RepID=SYK_CAMJE  ali  26  50............EKRDESVVVAGRLKLLRIAGKSIFANIEDEDTNLQIYFSKDSVGEELYTILKKLEVGDIVLVKGFPFVTKTGEFS--LHASEVKLATKAIVPLPEKYHGLT--DIEQRYRKRYVDMMNVEVRKDFLVRSKVVSLIRHFFENKGFLEVETPMMHPIAGGANAKPFVTFHNGVERFLRIAPELYLKRLIVGGFEAVFEINRCFRNEGMDLT-HNPEFTTIEFYWAYH-NYKDLMDLTEELFALLLDKLNLGKTIE---FDGKMINFSKPFERITYKDALCKYGGLDRDLIEDKEKIGHLQAELFDNYVEEKLINPTFVIDFPISISPLS-RRSDEDSQIAERFELFICGRELANGFNELNDPLDQYERFLKQAGDEEADEDFVNALGYGMPPTAGQGIGIDRLVMLLTNKKSIRDVILFPAMRP.... 492
194 0.000e+00UniRef50_A0A1Q9NHG7 Asparagine--tRNA ligase n=5 Tax=Candidatus Heimdallarchaeota TaxID=1936272 RepID=A0A1Q9NHG7_9ARCH  ali  35  17..KTQLCSEISKENTKKTVRVAGWVHFIRDKGKIIFIQLRDASGLCQITLNETKSPEEAFKNAKQLSLESIISVEGIIKEDARSINGAELIPSIIFILSKAEPKIPIDINEKVPFDKDTEFRFRELSIRTKRVQAIMNVKSEIAFAVRNFFRKNGFFELFTPYILSTATEGGAEKFETSYFGKKAFLAQSCQFYKQAA-VQTHEKVFGIIPSWRAEKSRTPKHITEFHQIENEIAFGTN-DTIMEIQENLLHEVVKHVKEHSNSELVLLNRDLKIPELPMKRVTFAEAKKILREKLNFEEPADADFTTPE----ETALSKYFPDPFFITKFPTHLRGIYYETDPENEKLTDSMDCVAPYGEMSSGGQRVASKDRLLKRLEIANMDPSNFEWYIRMFEYGFPPHAGYGLGFERLIRWICGLEHIREGILFPRTPDLVTP 451
195 0.000e+00UniRef50_A0A2D5UZT2 Lysine--tRNA ligase n=6 Tax=cellular organisms TaxID=131567 RepID=A0A2D5UZT2_9ARCH  ali  22  32..KQITAGELQKKHLKKEVKTAGRIMMLRRMGKVTFITLRDGTGKIQLYFKQDDLGNDNYKFLKKLDIGDIIGLEGSVFATKTGELT--IAVRLFEILTKSLHPLPEKFHGLKE--KELRYRQRYLDLMNPEVREAFMKRAEIIQGIREFLLKRGFIEVETPILQPIYGGTSAKPFKLHALDMTVFMRISNEMYLKRLLVGGYDKIFEFSQDFRNEGIDKT-HNPEFLLMETMWAY-ADYRMNMDLTEEMFEFLAKRVTGGTKV---RFQGKEIDFKRPWKRITMVDAIKEYVGIDIEKLSDDEIQGFIMEFIFGELVEEKLIQPTMVYDYPFETCGLAK-PKKDNPRFAERFEPYINGWELGNSYSELNDPQILKEYWEREEKDEEADTDFIRALEYGMPPASGLGIGVDRLVMLLTDSVSIRDVILFPFMKP.... 489
196 0.000e+00UniRef50_A0A1Y1YIA7 Asparaginyl-tRNA synthetase n=7 Tax=Fungi TaxID=4751 RepID=A0A1Y1YIA7_9FUNG  ali  30  143...............GKRVQVSGWVHRMRTQGKMRFIILRDGTGYLQVVMTGRLC--HTFDAL-TLTMESTVTVYGVINELPEGKTHHELVADYWEVIHKAPGEEAFGNKLNEESDPSVLFDQRHLVIRGETASSILRARSSIQKAFRDHFYSRGYSEVVPPCMVQTQVEGGSTLFEFNYYGESAYLTQSSQLYLETCLPA-LGDVYCMSESFRAEKSHTRRHLSEYTHLEAEMAFI-DFDDLLNRIEDLVCDTIDRALADTRDLVKSLNPDFKPPQRPFLRMDYTEAIEWLRENNVRKEDGTYEFGDDIPEAPERQMTDKIGRPILLCRFPVEIKSFYMKKDKVDPRVTESVDLLMPGGEIVGGSMRISDLDELLAGYKREGIDPTPYYWFSDQRKYGSCEHGGYGLGVERFLAWILNRYTVREVCLYPRFTGRCKP 569
197 0.000e+00UniRef50_A0A087EQP1 Asparagine--tRNA ligase n=14 Tax=Bacteria TaxID=2 RepID=A0A087EQP1_9LACO  ali  30  5.....SVKDLYTKDDNTTVSLEGSIKTIRGSKNISFIELNDGSCFAQIIVKKSN---ENFEQISKLPIASTITVEGAFVKTPDAPQPFEVHGEKVELVGRSDSDYPLQ---KKKTSYEFLRTIAHLRPRTNTFYSVFRIRSLAAFAVHEYLQHNDFVYVNTPIITSSDTEGAGEMFRVDFFKTETNLTVSGQLP-EEAFTMAFKNVYTFGPTFRAENSHTPRHASEFWMIEPDMAYTR-LPGMMDVAEGLLKYVINYVLDHAKDELEFLDENVKPASEDFARVTYTDAVKLLQEADVEFKVPVEWGIDLQSEHERYLCEDVYKRPTFLTDYPRDIKAFYMRDNDDGKTVAAADCLVPGIGEIVGGSEREERYDVLNNKIKEFDLNPEEYDWYEDLRKYGEIKHSGFGIGFERLVMYVTGMENIRDVIPFPREPGS... 459
198 0.000e+00UniRef50_A0A0P0FJK5 Lysine--tRNA ligase n=5 Tax=Verrucomicrobia TaxID=74201 RepID=A0A0P0FJK5_9BACT  ali  24  59.....SIASIRSQFDGKLLYVAGRVTAYRDMGNSQFLDLADITGHMQVFVCAKEIKLEDLEVLPLLDIGDFIGVTGECFTTKTREPT--LRARSFQVLSKAIRPPPNKWYGIRHT--ETKYRQRYLDLINPASCEVFRQRIRIIHEIRSYLEGNGFLEVETPMMQVVPGGAAAEPFKTHHLDMDLFLRIAPELYLKQLLVAGFPRVFELNRNFRNEGI-SRHHSPEFTMLEAYIAY-SDFEQMALLVEEMICHIAKKVCGGLLIQHKNEAGEIIDLTPPWKRARYSDLIRSIQPSWYELSSDQKRACCTQMGLFEKFVEEKIIDPLFVTHCPRELVPLAK-QNEIDLSVVDAYELVINGHEISPGYSELNDPDIQRRRLEYQGGEIQKLDDFLTALEYGMPPAGGLGLGVDRLVMLLTGAESIRDVILFPHMRSK... 505
199 0.000e+00UniRef50_A0A2E9CZM7 Lysine--tRNA ligase n=15 Tax=Bacteria TaxID=2 RepID=A0A2E9CZM7_9ACTN  ali  23  61...................SVRGRILSIRSFGKLTFIDLKDETGKIQLVYSDKDLSEELIDYLQNLDVGDIVGVSGIIMKTKKGELSIYIR--NLSLLTKSFRNFPEKWHGLK--DKETRFRQRYLDFVNEDAKNTISTRFXILXLIREFMTSEGFTEVETPTLQPKAGGAIARPFSTHHNNIDMYLRIAPELYLKRLIIGGFEKVFELGKVFRNEGVDQT-HSPEFTMMESYEAY-TDVNGVMDMVENMCQYVLENLKVDKSIE---FNEKVADFSFPWDRKSMFELVKALLESKYQIESESTTVGELVFDIFENYIEHDIVDPVFVTDYPKEVSPFA-RESDEKEGITERFELFAFGSELANGFSELIDPVDQENRLKSQAGDEEADSDYIEALEFGLPPTGGLGFGVXRFVMMITNNDSIREVIAFPHLKP.... 493
200 0.000e+00UniRef50_L8PQP3 Lysine--tRNA ligase n=4 Tax=Actinobacteria TaxID=201174 RepID=L8PQP3_STRVR  ali  24  326..RTHALAEVRE---GEQVTVAGRVMVVRDFGGIVFVVLRDWSGDHQLALTREDSGAALDRFTADTDLGDLITATGRAGRSDRGEPT--VFVTSWQLVGKCLRPLPDKRRGL--ADPEARVRMRYLDLVSPAARDVVRARSTAVQALRQGLLERGFLEVETPMLQQIHGGANARPFHTHINDLDLYLRIAPELYLKRLCVGGLEKVFELGRTFRNEGV-SYKHNPEFTMLEAYQAY-ADYDVMLDLTRELVQRAATAAFGSP---VARKDGTEYDLSGPWPVKTVYGAISEADEIGPDTETGDDGHGDIVLEMYERLVEVKTQLPTFYKDFPTDVSPL-TRQHRQDPRLAERWDLVAFGTELGTAYSELTDPVEQRRRLTAQGGDPEAMEDFLDALEYAMPPTGGLGIGVDRLVMFLTGL-TIRETLPFPLVRRR... 772
201 0.000e+00UniRef50_A0A1V0SJ84 Aspartyl-tRNA synthetase n=1 Tax=Klosneuvirus KNV1 TaxID=1977640 RepID=A0A1V0SJ84_9VIRU  ali  34  15......IRSLTPTDINTPLFIRARVHNSRNKGNFTFLVLRYQSTTLQAIGMKNTLGDDIFKSLTSITNESIIDCYGTLQLAKVKTCSFELVIDKYELVSKAN-DLPFQLDDANNVNMDTRLNHRWVDLRTPMNNTIFKLQSYIGQYFRQYLLKNNFIEIHSPKIIGVQSEGGSQVFEMKYFDKPAFLAQSPQLYKQMAINADFDRVFEIGPVFRAENSFTNRHLCEFIGLDVEMALCQTYREIQILLWNLVTFIYDQIKQNHSNELQAITFNYPVYPKDPLIISFAQCVKMLNDIGFQQHELEDLSTVNEKKVGELVKDKYGSDLFIIDQYPLNVRPFYTMPSDDIP-YSNSFDMILKGVEICSGSQRVHDYQMLMTKVAEKGINTESLKYYLESFSHGSRPHCGFGLGLERLVSLFLDIGNVKLASLCPRDPKRL.. 455
202 0.000e+00UniRef50_A0A067SE45 Uncharacterized protein n=4 Tax=Dikarya TaxID=451864 RepID=A0A067SE45_GALM3  ali  33  48.........LSQQKVEEDV---ARIQSLQKQGNMVFLILRQRTETVQGVVTPEKISRKMVRWAANLNNESIVLVEGVVRKPPTSIPDIEVHLSTIYLIAAPQSYLPFTNSPDTRVLLNTRLSNRVVDLRTQTNQAIFKINSGMGHLFHEYRRGNGFLEIHSPKLQSAPTEWG-TAFKVNYFSEKAFLAQSPQLAKQMAIAADFERVYEIGSAFRSEAI-SYRHMPEFTGLDLEMAFEEHYHEVLEMIDDMLKHVFSGLREKYRTEIEIIRKQFPTEDFKWRILPFKEAVKILVEDGVPRERLECLSTENEKRLGRLVKAKYDTDYYIINKFPIMLRPFYTMPDLENPTLSNSYDFFMRGEEILSGSQRIHDPKLLLEAMLSNGVNPDSLKSYVDAFRMGCPPHGGGGIGTERVLTLFLKLNNIRRTSLFPSDPWRLKP 489
203 0.000e+00UniRef50_E1QX83 Lysine--tRNA ligase n=29 Tax=Bacteria TaxID=2 RepID=E1QX83_OLSUV  ali  23  41...TAHAAELAERYASDEYSLAGRIRAYRRQGKARFLVIEDVSGEIQLFCRVNNLSAEDWGLLGQLDLGDIIQARGTVLRTRRGQLS--VSPTSVTLLSKSVRPLPEKFHGLT--DRELRYRQRYVDLMNRDVRDTFRMRSAIVSQIRRYMESDGYIEVETPMMHAILGGANARPFVTHFNDRNFYLRIATELPLKRLIVGGMERVFEIGRQFRNEGMDLT-HNPEFTSMEAYCAY-SDLQGMKDLTMGLFKAIAREACGEEGHEAIVYQGQEIDLSGTWRSATVAEILDHLREAAHSIEWRENWGGKLLFELYDELGEETLVNPTFVCDYPEEVSPLAK-RKDDDPCITDRFELVIAGHEYANAFSELNDPVDQAGRFAEQGDDEAMDYDYVRALEYGMPPAGGIGFGIDRMVMLFCDQPAIRDVLLFPQMKP.... 501
204 0.000e+00UniRef50_A0A2C9JJK9 Uncharacterized protein n=9 Tax=Eukaryota TaxID=2759 RepID=A0A2C9JJK9_BIOGL  ali  29  126...............DVRVKIFGWVHRLRRQGKLMFVILRDGTGFLQCVFADKLC--QTYDAV-TLATEASIAVYGVIRKLPEGKTNHEMAVDFWELVGPS-PPGGADNLLNEDAHPDVQLDNRHMMIRGENTAKILKMRSVIVHCFREHFFDRGYFELTPPTIVQTQVEGGSTLFKLNYFGEEAYLTQSSQLYLETAIPA-MGDVFCMAQSYRAEVSKTRRHLAEYTHCEAECPFIT-YEKLLDKIEDLVCDVVDRVLKSYGPIVFELNPDFKPPKKPFRRMDYTDAIVWLKENNVTKEDGTYEFGDDIPEAPERKMTDTINEPIMLCRFPAEIKSFYMPRCKEDNRLTESVDLLPNVGEIVGGSMRIWRQEELEAGFKREGIDTSPYYWYFDQTKYGSCPHGGYGLGVERFLCWILNRYHIREVCAYPRFVGRCKP 549
205 0.000e+00UniRef50_A0A252F670 Aspartate--tRNA ligase n=1 Tax=Butyricicoccus porcorum TaxID=1945634 RepID=A0A252F670_9CLOT  ali  33  15........ELCAAHIGESVTFRGTVHRVRDMSDFAFVIVRVDRGLIQCLLKNELDGITK----SDIRDGMVVEVSGTVHEEPRAENGFEVELSAVSVLAKPYDKMPVPLGKKYMINLDTNLEYRPVTLRHPRMKAIFRIQGALCDGFAEYMMSQGFVHMNSPKIVAAGAEGGANIFKLDYFGQKAYLAQSPQFYKQYL-AGVFGRVFEIGGVYRAERHSTSRHLNEYIGLDFEMAYIDSMKDVMEMETGMLKYVMDYIRAHCKPELELLKADIPTIDT-IPSITFKDAKQILDKFGHKSKNRFDLNPDEEQMLCDYAKSELGSEFIFVTHFPSAKRPFYAKDDPSDPSLALSFDLLFRGLEITTGGQRINDYQEQVDKLNARDMDVSLFESFLLLHKYGMPPHGGLGIGLERLTMQLLGLKNIREAAYFPRDMSRLIP 440
206 0.000e+00UniRef50_B1GYN8 Lysine--tRNA ligase n=7 Tax=Elusimicrobia TaxID=641853 RepID=B1GYN8_UNCTG  ali  29  57..........REQLANIKVKAAGRVMTYRNMGRAAFLDIKDGLAKIQIYIRADKMGEEQYKFFKSVDISDIIAVEGIPFRTRTNELS--IMVEKWTMLTKAFRPLPEKWHGLK--DIEIRCRQRYLDLINSEVKDIFVKRSMVISAVRHKLEELGFIEVETPILQSLAGGANARPFITHHNDINLFLRIAPELFLKRLVVGGLDRVFEIGRNFRNEGIDKN-HNPEFTMLELYQAY-ADYNDMMDMSEILIKAAAKKVGS--------------ALNLEFTRVKMFDLIKKYAESGKMFEQEDATDRKILDQLFEEKVVPNLKNPTFVMDYPAVYSPLSKVKFDQ-PEIAERFELYISGIEIGNAYSELNDPELQKIRFKNKGDDKVMDEDFIFALEQGLPPTGGLGIGIDRLVMVLTGVESIREVIIFPAMRP.... 488
207 0.000e+00UniRef50_F0WXP7 Lysine--tRNA ligase n=25 Tax=Eukaryota TaxID=2759 RepID=F0WXP7_9STRA  ali  26  64.................EVSLAGRIMSIRASKKLVFMDLCNEGQCVQILSEKNNVMEEFHQIHESLRRGDIIGVTGFPGKSAKGELS--IIPRKLEILAPCTQPFPNDKYGIK--NPDIRFRMRYLDLVNRDVRSIFETRAKVVRSIRNYLESRGFLEVETPMLFASAGGATAEPFVTKALGNDLYIRIAPELFLKQLVIGGFNRVFEIGKVFRNEGIDAT-HNPEFTICEFYQAY-ADYETLMQTAEEMLSEIVKSVTGTAILKFANEESVEIDFTPPFRRLSICPTLEKLGEPLPDLESDPHTVPRLLDRLIGHFIEPMCIHPTFVYNHPKCMSPLAKD-HRQFKGLTERFELFVAGKELCNAYTELNDPDIQRERFEAQLENKEMDEDYCKALEYGLPPTGGFGIGIDRLVMLLTGKHHIRESILFPAMRP.... 519
208 0.000e+00UniRef50_A0A1F9Z922 Asparagine--tRNA ligase n=2 Tax=unclassified Euryarchaeota (miscellaneous) TaxID=115531 RepID=A0A1F9Z922_9EURY  ali  33  8.........LRGTHTGHEVELRGWIYRTRSVGGKVFVVLRDDTGIVQATVSRGSVPPESFAAIEKALIESSALVRGTVVQDKRAPGGVEIRASDVRVVHFAE-----KFPIQEDLSEEFLLDVRHLWVRSQRMTTIFRIRHTVFDAVHEYFRDRGFWEVHPPMLTPAGSEGGSTLFEVEYFGRKAYLAQSWQLYAE-ALVLAMKKVYYIGPSFRAEKSRTTRHLTEFWHAEMEEAWAG-MDDVLRHAEGVISHVCRRVAEERPDEVVALGRTPEFLKPPFERFTYDEALKLLVSKGVEVEWGKDLRT-----LEERVLTEGKSKPVIVTHYPRISQAFYKARDPQKPDVVLGFDVIAGVGEVVGGSERETDLETIQQSLRDQGQDPASYDWYLDSRRFGSVQHAGFGMGMERLIQWICKLEHIRDAVPFPRTPARYSP 429
209 0.000e+00UniRef50_A0A094PGY2 Lysine--tRNA ligase n=2 Tax=Actinobacteria TaxID=201174 RepID=A0A094PGY2_9ACTN  ali  21  35..RTHEIAVIRKQHTGEVVSITGRIMLNRVAGKLIFATLRDATDDIQIMLTADVTGEVGIEEWKTIDLGDQISVTGEVVTTKRGELT--VKANSWMLTAKCLHPLPDKHKGLS--DPEARVRQRYLDLIRPESKNLVQLRSNAVASVREALRKRGFTEVETPMLQVMHGGANARPFVTHINDMKMFMRIAPELYLKRLLVGGIEKIFEINRNFRNEGADSS-HNPEFTMLEMYEAY-GDYTTMRNLTKELVLNAATAVYGSTKHEDEAGNVIEHDLSLGWESISVTEAISKAAGEQISIEKPNWDVGQIILEMYEHLVEDKTVLPTFYTDFPQSVSPLTKA-HRSNPLLAERWDLVTFGFELATGYSELNDPQDQRNRFLAQGDDEAMDEDFIRALEYGMPPAGGQGMGIERLLMTLTGKG-IRDTILFPLVKP.... 497
210 0.000e+00UniRef50_A0A016TDL4 Uncharacterized protein n=13 Tax=Bilateria TaxID=33213 RepID=A0A016TDL4_9BILA  ali  30  119............KFRGQRIRVKAWVHRLRRQGKLMFWVLRDGSGYLQCVLN--DVLCQSYDAV-TLNTESSVEVYGTIQKVPEGKQGHELIVDYWRLIGSA-PPGGIDNVLNEEAGVEVMLDNRHLVIRGENASRILRIRAAATRAMREHFYHAGYTEICPPTLVQTQVEGGSTLFALDYFGEQSYLTQSSQLYLETCIAS-LGDVYCIAQSYRAEKSRTRRHLAEYAHVEAECAFIT-FEQLMDRIEDIVCDTVDRLMADPKELILFVNPEFKPPQRPFRRMTYTEAIQWLIEHDVRNEHGEKFHGEDIAEAAERKMTDTIGVPILLNKFPAGIKSFYMARCQDDNELTESVDLLMPGGEIVGGSMRLWREEELHKAFIGAGIDPKNYFWYMDQRKYGAVPHGGYGLGLERFICWLTNTHHIRDVCLYPRFIGRCAP 569
211 0.000e+00UniRef50_A0A136MUA5 Lysine--tRNA ligase n=1 Tax=Omnitrophica bacterium OLB16 TaxID=1617433 RepID=A0A136MUA5_9BACT  ali  25  33.ERSHTTARAIQLFLDSEVRLAGRLMGKREMGKAIFGDLHDLDGHVQLYFKKNDFTPEVFEEIKALNLGDIIGVEGPLFRTRTGEIT--LHVREVTVLSKVINNLPHIHRFFQFADVEMRYRQRYLDLINRDVRDHFRKRSRMVSIFRRELDQMGYMEVETPMMHHIAGGAAARPFITHHNDIDLYLRIAPELHLKRLIVGGMEAVYEINRNFRNEGI-SIKHNPEFTMLEAYKAY-GDRDTVMELCEHLVSTAVEDMFGGHQVAYQGI---TLDFKRPWKRISMIDAIEKTRGLGIDTTD-LTTHGKIINAVFEEKVEESLIQPTFIIDYPTEISPLA-RQKKDDPDLVERFELFIYGRETANGFSELNDPAEQYRRFEEQGGDQEADLDYVNALRCGMPPAGGIGIGIDRLAMILTDSASIRDVILFPLLRPK... 508
212 0.000e+00UniRef50_A0A2M8NKV2 Lysine--tRNA ligase n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2M8NKV2_9CHLR  ali  23  32..RSHTNAEALAEPEGASVTVGGRVRALREMGKIAFAKIEDETGMIQIVLRKGDTAD--FERLKDIEIGDFMRATGSRMVTKTGEQS--VLAARFELLAKALRPLPDSYYGL--ANEEQRYRRRYLDLMNKDVAEVFRKRSIIISSVRRTLERHGFLEVETPTLQPLYGGANARPFITHINGMPMYLKISDELYLKRLLIGGFDKVYEIDKDFRNEGI-SYRHNPEFTMMECYAAY-WDYTDIMRLVEEIYRDAAIAATGSDIVPYDLVTGRDEDGEPPWERLTMKDGIRRHLAIDVDEDAEPFNRGKAIAELFE-FTEDHYIQPTFIIDFPRETTAFCK-PHRDDPTLIERLEPYIARMEVGNGYTELNDPVLQRQMMDERGDDAQPDEDFIQAMEYGMPPAGGLGLGIDRMVMLLTNQSKIRDVLLFPTMKP-LSP 491
213 0.000e+00UniRef50_A0A1F8B588 Lysine--tRNA ligase n=13 Tax=cellular organisms TaxID=131567 RepID=A0A1F8B588_9BACT  ali  25  44............ELMDQEVEVAGRIMSWREHGNIVFADLKDETGQIQLWFQKNNLG-ENFKTLRLFDIGDIFFAKGKIVKTVAGELSVDIV--DFQLLSKSIRPLPSKWHGVKDVQE--RYRKRYLDLINEGVRERFNVRTKLVREIRRYLDDLGYWEVETPTLQPLYGGANAKPFITRHNGHDFYLRIADELYLKRLVVGGYEKVYEICKDFRNEGIDQT-HNPEFTMIEYYEAY-ADYHRVMDVTEGLFKHLAQQVLGKMEME---VGEKIIDISKNWPRITMVDIIKECTENGVEILGGE-TKGQLIFNLFETKVTGTLVEPTWIIDYPKEVSPLSKGKWEE-PEWVERFEGYIGGKEICDGWSELTDPVEQRKRFEARKDKAEADEDFLEAMEYGLPALGGIGIGIDRLTMFFTNTWLIKEVILFPTLRP.... 481
214 0.000e+00UniRef50_E6PHG8 Lysyl-tRNA synthetase n=3 Tax=mine drainage metagenome TaxID=410659 RepID=E6PHG8_9ZZZZ  ali  24  88................QRLRLAGRVLTRRGMGKTSFFDLADATAKLQVYARRDDLGEEPFAALSHVERGDIVGVEGYLFRSKMGELT--LHATALEVLGKALAPLPDKWHGLQDV--EKRYRQRYVDLVNPEVRATFLARSRILSEMRRFIDAQGFHEVETATLLHVAGGAAARPFLTHVNDAQMQLRIATELNLKRLIVGGMERVYEIGRIFRNEGIDTS-HNPEFTMLELYAAY-WDVNDMLAFNEALMEHLARVVTGGTTL---RVGEHEISFARPFDRIGYLEGIARYRERLLDPEPPSPTHGHALDKIFERVLEPHLVAPTFVTEYPLALSPLAK-RVPGDPEMTQRYELFCAQMEISNAFSELNDPDDQRTRFEAQGDEPEPDWDFVRALETGMPPTAGIGIGVDRLVMLLTGASSIRDVILFPLQRQH... 525
215 0.000e+00UniRef50_A0A2N6IFB3 Lysine--tRNA ligase n=5 Tax=Oxalobacteraceae TaxID=75682 RepID=A0A2N6IFB3_9BURK  ali  25  281....HKAADLHAQYGSKTVVLAGRMMLKREAGKAAFATLQDASGRIQIYATLDLTGEAAMAALHHYDLGDILGVTGTLFKTKTDELT--IKVTQLRLITKSLRPLPDKFHGL--ADQETKYRQRYVDLMNEETRRTFKARTAAISSIRRFMEKNEFMEVETPMLHTIPGGAAAKPFITHHNDMQMFLRIAPELYLKRLVVGGFDRVFEINRNFRNEGV-SIRHNPEFTMMEFYAAY-TDYKWLMDFTEAVIRQAAIDAHGTATLTY---GGRELDLAKPFHRLTIVEAIEELKKFGVK-PFATAGLGALQLTLFEETAEAQLWEPTYIIDYPVEVSPLA-RASDTVAGITERFELFMVGREIANGFSELNDAEDQSARFLAQAGDEEAMADYIRALEYGMPPAGGCGIGIDRLMMIITDSPNIRDVLLFPHLRR.... 745
216 0.000e+00UniRef50_A0A1S8VWQ2 Asparagine-tRNA ligase n=4 Tax=Eukaryota TaxID=2759 RepID=A0A1S8VWQ2_9FUNG  ali  29  95.KKIH-IRELT-SHWGARVKISGWVHRLRVQGKIMFIVLRDGSGYIQCVLTGKQC--HTFDAL-TLTVESTVTLYGIIQAVPEGPGGCELICDYWTLLGKAPGDDAFGNKLNTESSPDVLLDQRHLVLRGETASSILRVRALMLKGFRTFFDSRFITEVTPPLMVQTQVEGGSTLFEFNYYEEAAYLTQSSQLYLETCLPS-IGDSYCITESFRAEKSHTRRHLSEFTHCELELAFIT-FDDLLSVMEDMVVSVVDSILADPAAAVKKLNPDFKAPKKPFRRMQYGEAIKWLNDNGVKKDQVDYVFGEDIPEGPERRMTDTIGEPILLCRFPAEIKGFYMKRCSEDPSLTESVDLLPNVGEIVGGSMRISDLDELMAGYKREGIDPTPYYWFTDQRKYGTTEHGGCGLGVERLLAWLLNRFSVREVCLYPRFMGRCTP 542
217 0.000e+00UniRef50_A0A1S7HAK8 DED81 (YHR019C) n=7 Tax=Opisthokonta TaxID=33154 RepID=A0A1S7HAK8_9SACH  ali  30  122...........PEFVGHRVKVYGWVHRLRNNKKLVFIVLRDGSGFLQAVLTGDL---ALAKQTQELTLESSVALYGRVNKVPEGPGGIELIVDYYEIVSLAPADDSFTNKISEGADPSLLLEQRHLALRGETLSSIMKVRAGLMKAVRRVYDEEGLTEVNPPCMVQTQVEGGSTLFKLDYYGEEAFLTQSSQLYLETCLAA-LGDVYCVQESFRAEKSHTRRHLSEYTHIEAELCFL-NFDEFLSHIERVLVKTIDYVLQDPGPLVKQLNPNFKAPTLPFKRLEYNDAIEWLKAHGIENEEGEEFFGDDIAEAAERKMVDTMGVPILLTKFPVEIKSFYMIRCKDDPRVTESVDVLMPVGEITGGSMRISELDELLAGFKREKIDPKPYYWFIDQRIYGSVPHGGYGLGTERILAWLCDRYTVRDCSLYPRFTGRCKP 551
218 0.000e+00UniRef50_A0A0F9YTN5 Aspartate--tRNA(Asp/Asn) ligase n=2 Tax=Parcubacteria group TaxID=1794811 RepID=A0A0F9YTN5_9BACT  ali  36  19............EYDRQKITISGAIYRIRKLGGLFFIVIRDGESLIQC----KLESNESIISIEEYSEGDYVSITGICQKENRAPHGAEIKVQSIEILSKSTEEMPFSINQKFEVGLDSNLNFRPISLRHPKQRAIFAIQSAISMLFRQGLSLIDFTEIHTPKLVFAGAEGGANVFKVKYFERELFLAQSPQFYKQM-MVGVFGKVMEVGPVFRAEPHETSRHLNEYTSMDLEVGPIKSFEDIMEIETYLLRYIFEELPKFCSAELKLLEVSMPQIN-NIPIIKMSEALEII-SKNRKIKDRSDLDPQGEQIICQYIFKETGSEFVFVTHYPTIKRPVYAMEDPENNEVTLSFDLLFRGLEITTGGQRIHDYKMQVEKMKRLGYNPDDFVSYLQIHKYGMPPHGGFGLGLERLTMQLLNLSSIKEACLFPRTINRITP 439
219 0.000e+00UniRef50_Q6K1T2 Lysine--tRNA ligase n=30 Tax=Mesangiospermae TaxID=1437183 RepID=Q6K1T2_ORYSJ  ali  24  99..RTHTTKELQDGYADVAVSIAGRIVARRAFGKLVFMTVRDDSGTIQLYCEKDSLTEEQFEQLKTIIDIGDIIANGSIKKTEKGELS--VYVKNFEILTKSLLPLPDKYHGLTDV--DKRYRQRYVDMINPEVADVFRTRAKAVSEIRKTMESFGFIEVETPVLQGAAGGAEARPFITHHNQRDLYLRIATELHLKRMLVGGLEKVYEIGRIFRNEGIST-RHNPEFTTIEMYEAY-SDYESMMNLAEEIVTRCAMATHGKLRVDYQGTE---ISLERPWRRETMHSLVKEATGIGIKTESNENIVGHVLNEVFETVVESSLVQPTFVLDYPVEISPLAK-PHRRYAGLTERFELFICGREIGNAFSELTDPIDQRGRFENQGKHEEDDEDFLTSLEYGMPPASGMGLGIDRLVMLLTNSASIRDVIAFP........ 580
220 0.000e+00UniRef50_A0A0F7S7N9 Related to aspartate-tRNA ligase n=15 Tax=Ustilaginomycotina TaxID=452284 RepID=A0A0F7S7N9_9BASI  ali  31  158...........DAQIGDTVTLRARVHTIRDSSHLVFIVLRQQIYTIQAVLENDVITGHMVRWAKRLPLESIVLVRGKLQKTGATTQGAEIKVQQLYLVASPKETLPFNPPRDENHSIEVRLTNRIVDLRTPTAQAIFRINAAICNSFRSHLDQNGFIEIHTPKLQGGASESGSSVFMLDYFGRPAFLAQSPQLYKQMCIASDFKRVYEIGPVFRAENSNTARHLTEYTGLDIEMEIV-HYYDAIRVIDGMLKSIFTALKNNFKAERELIKRHFPHDDLVYPILPFAQGVRLLKESGYVEEDGEDLHTRAEIRLGELIRKKYHTDYYILDKFPTSVRPFYAMEDKNDPKVTNSFDIFIRGQEICTGGQRIHDIEELERKMQRLSISAKGMQEYLEGFRLGAPPHAGCGIGLERLVMLYLNLGDVRYGTLFHRDPRSL.. 635
221 0.000e+00UniRef50_A0A109V016 HGL199Wp n=3 Tax=Ascomycota TaxID=4890 RepID=A0A109V016_9SACH  ali  28  126..............VNQRVKVSGWIHRLRLSKSVGFVVLRDGTGYLQAVLSSNLAKAY---QTSTLTLESTVSLYGTVKKLPEGPGGVELDVDYYEIVGLAPSDEAFTNKVQEGADPSLLLDQRHLVLRGETISAVMKVRAAFLKSIRRVFDEEGLTEVTPPCMVQTQVEGGSTLFKLDYYGEEAYLTQSSQLYLETCLPS-LGNVYCIQESFRAEKSHTRRHLSEYSHIEGELCFL-SFEDLLDHIERLITNTVKYILEDPGPLVKQLNPGFEAPTTPFMRLEYKDAITWLNEHDIKNEEGEAFFGDDIAEAAERKMTDTIGVPIFLTRFPLTLKSFYMKRCADDPRVTESVDLMPNVGEITGGSMRIESTEELMAGITREGIDPSSYYWFIDQRRYGTSPHGGYGIGTERILAWLCNRYTVRDCSLYPRFTGRCKP 552
222 0.000e+00UniRef50_H3HDW5 Uncharacterized protein n=23 Tax=Oomycetes TaxID=4762 RepID=H3HDW5_PHYRM  ali  28  22LSRRSTIRDARELDSGSRVAVGGWVKSVRNHKSVSFVNVNDGSGELQITLPKGAVTGVLQAKLSDLTVGSSVFAEGELREVPGGKQKLELHPSTLEVLGKCDTKT--YPLQKKYHSLEFLRESLHLRARTNTFGAVTRVRNALSQGLHSYFQENDFLHLHSPILTSNDCEGAGEMFRIEFFGTPTYLTVSGQLHGEM-YACALSKIYTFGPTFRAENSNTTRHLAEFWMVEPEMAFAG-LEECVASAQGAVQRSVSHALDTCAEDIAFFNKNYDKVEKNFARLTYTEAIDVLQKAKVSFDKKPEWGMDLQTEHERYLAEKYVGGPVFVTDYPADIKAFYMRKNAPDETVAGMDLLVPKIGELVGGSVREERFEVLEEKMRQLGLLPEDLDWYLDLRRFGSVPHAGWGLGFERLVLFATGMDNIRDVIPLPRFPGQC.. 500
223 0.000e+00UniRef50_A0A2G9LVY6 Asparagine--tRNA ligase n=10 Tax=Archaea TaxID=2157 RepID=A0A2G9LVY6_9ARCH  ali  31  5.....SIQEAMNKGSG-EVKLHGWVYRERKSAKVAFVVLRDSTNIIQCVIKKDAVPEKVWDAAIDSPIETSLKITGEIKEDARAPTGFELAVTDMEKVGVSDT-----YPITKDQSTEFLLDQRHLWIRSRRLTAIMKVRSTVFGAIHKFFRERAFHEFAPPILTPNACEGGSTLFEVKYYDQKMYLTQSWQLYAEAAVFA-LEKLYCISPCFRAEKSKTSRHLSEFWMAEMEIAWAG-LDDIGKAAEELVAFIAKEVXXXXXXXXXXXXXXXXXXKAPFPRLTYSEAKLLKEKKDLDVPWGKDLRTVEEDKLMELYET-----PVIVTHYPKETMAFYKPSDPNNPKEALCMDMLAPYGEIIGGSVRDTDLDSLKKALEKEGEKLERYEWYLDLRRYGSVPHSGFGLGVERVVAWMCGIDNIKDAIPFPRTMIRFRP 430
224 0.000e+00UniRef50_G1TKC4 Lysyl-tRNA synthetase n=11 Tax=Bilateria TaxID=33213 RepID=G1TKC4_RABIT  ali  26  105...THFIEEYSDHLTDITLKVAGRIHAKRASGKLIFYDLRGEGVKLQVMANRNYKSEEEFTRINKLRRGDIIGVQGNPGKTKKGELS--IIPHEITLLSPCLHMLPHLHFGLK--DKETRYRQRYLDLINDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHNDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLT-HNPEFTTCEFYMAY-ADYHDLMEITEKMISGMVKHVTETRKILDDIC---------------VAKAVE---------CPPPRTTARLLDKLVGEFLEVTCINPTFICDHPQIMSPLAKW-HRSKEGLTERFELFVMKKEVCNAYTELNDPMRQRQLFEEQGDDEAMFENFCTALEYGLPPTAGWGMGIDRLTMFLTDSNNIKEVLLFPAMKP.... 523
225 0.000e+00UniRef50_A0A1R4H4G9 Lysine--tRNA ligase n=74 Tax=root TaxID=1 RepID=A0A1R4H4G9_9GAMM  ali  24  35..RDVIAGELLAKYADKTVKVAGRIMTRRVMGKASFCHIQDMSGQIQLYVTRDALPENFYEQFKKWDIGDIIGAEGVLFITQTGELS--IKIDNIRLLTKALRPLPEKFHGI--ADQEIKYRQRYLDLMSQESRNTFLIRSKVVAYIRQFLIDRQFLEVETPMMQVIPGGATARPFTTHHNDMNMFLRIAPELYLKRLVVGGFERVFEINRNFRNEGLST-RHNPEFTMLEFYQAYAE-YHDLMNLTEAMLRGIAEEVVGHSVITYQGEQYDF---GQPFQRMTVREAAVMVAEKLRLPVKDSYGLGKIQIEIFEKTVESKLMQPTFITAYPVEVSPLA-RRNDNDPHVTDRFEFFVGGREIANGFTEXXXXXXXXXXXXXXXXDDEAMHDYIIALEHGMPPTAGEGIGIDRLVMLFTDSPSIRDVLLFPHMRPK... 497
226 0.000e+00UniRef50_Q22099 Lysine--tRNA ligase n=143 Tax=Eukaryota TaxID=2759 RepID=SYK_CAEEL  ali  25  97..........KEQVVEEIVSVAGRIHSKRESGKLVFYDIHGEGTHIQIMANAKTGDVDFVTLHDRIKRGDIVGFTGRATRTKAGELS--LIPNEILQLTPCLHMLPHSHFGLK--DKELRFRKRYLDLINPRVKDNFVIRSKIITFLRRYLDNLGFLEVETPIMNQIAGGATAKPFITHHNDLDMFLRVAPELYHKMLVVGGIDRVYEVGRLFRNEGIDLT-HNPEFTTCEFYMAY-ADYEDVIQLTEDLLSSMVMSIKGTYKIEYHPNGPNTEDFTPPFKRVHMREVFDKLCRDNNVDCSAPRTTARLLDKLVGEYLESTFISPTFLIGHPQIMSPLAKW-HRSIPGLTERFELFAVTREIANAYTELNDPITQRQRFEQQAKDKDADETFCNALEYGLPPTGGWGMGIDRLSMILTDNNNIKEVLLFPAMRP.... 555
227 0.000e+00UniRef50_A0A1G2FZI3 Lysine--tRNA ligase n=1 Tax=Candidatus Ryanbacteria bacterium RIFCSPHIGHO2_01_45_13 TaxID=1802112 RepID=A0A1G2FZI3_9BACT  ali  25  31..RTHDIGEVLLKKQKKKLSIAGRIRSIRTHGGSVFFDLEDSEVRLQCYIKKNTLGERLHELFDSIDIGDFVGVSGLLFTTKKKEKT--LLVTDWWPLAKSVRPLPEKWHGIQNV--EERFRKRALDLMNKESRERFLERTKIIKSLRDFLDGNGFYEVETPILQPLYGGALARPFTTHHLDMDLYLRVAPELYLKRLMVGNLRRVYEIGKCFRNEGID-VLHSPEFTMLEGYMAF-EHYESLKVLMEKMIMAAVKEVKKKNSI---VFDGKTITFKKPFRTMTFSESIKRYKQFGVEM-NRVYSRGKILDEIFKKVVRKHLIEPTFITNHPIDISPFAKM-SGQFPETALRFQLIAGGIELINAYAEINDPIEQRSRLIKQEGDEEMDEDYIETLEYGMPPTAGFGLGVDRLVQLLTDTHNIRDVILFPTLKP.... 486
228 0.000e+00UniRef50_A0A2H9LD75 Asparagine--tRNA ligase n=1 Tax=Candidatus Diapherotrites archaeon CG08_land_8_20_14_0_20_30_16 TaxID=1974403 RepID=A0A2H9LD75_9A  ali  32  16..........KEKKIGKEYEIKGWVYRIRKMKDKVFIVVRDSYGIIQVVFDANS---PCFNDAEKLKMESSLIIKGKVKEEPKAPGGYELQGIKLEIVH-----IGEDFPINKDLNEELLGDRRHLWLRSRKMTASMKIRSTVLFALHEYMHKKGFTEIHAPSLSGATSEGGSETFEVKYFDKKAYLTQSWQFYAENFI-GALEKAYAIAPSFRAEKSKTPWHVTEFWHFEVEGAWM-DLKDDMIIAEDCIKYVITKVLAENKKDLEILEVNFENVKTPFKRITYKEAIDTLIKNGHDIKYGDDFKSAEERGLAKY----YGNTFVFVTNYPLELLKFYHGEDPKNPGTGTNFNLLAPVGEMIDGSQREPDLNKIIVRLKKSGIDLGMSDWYLDSRRYGSVPHAGFGLGVERFAAWICGFDNIRDSIPFPRTPNRFYP 433
229 0.000e+00UniRef50_A0A2D5YXI0 Lysine--tRNA ligase n=2 Tax=Planctomycetes TaxID=203682 RepID=A0A2D5YXI0_9PLAN  ali  27  69..................VKVAGRVMLHRDIGRLVFMTIRDGTGDLQIAVSKKAVAEEVFKLAKLTDLGDIVVARGPLGTTKTGE--VTIWAGDGEIATKSLAPPPEKWHGLQDA--ELRYRRRYVDLVNPEVRETFELRSRIVKRIRDFLTDPGFLEVETPMMQPQAGGAAARPFVTHHNDMQLYLRIAPELYLKRLLVGGLHRVFEINRNFRNEGID-RNHLPEFTMLELYQAF-GDYHSMMALSEQLIHTLAMELVGSA---IVRFDEQDIDCSLPFRRARYHELFAEHAGFGSDVETEGKDHELILKDVWEHVVEPHLVQPTFVMDYPAEMCPLTK-RKADDPSVAERVQLYFAHMELVNAYTELNDPDVQATNFSSQGLDDEEDEDFLEALRVGMPPAGGLGIGIDRLVMLLTGQRSIRDVILFPLMR..... 509
230 0.000e+00UniRef50_A0A1G2S699 Lysine--tRNA ligase n=7 Tax=unclassified Bacteria TaxID=2323 RepID=A0A1G2S699_9BACT  ali  25  34....ISIADVIAKFAGKKVGLAGRITAIRGQGSLIFFNFSDGTGTFQGLLKKGDTDDAVLELFSNVDLGDIVWVKGSLFETKTNAKT--VLVKEWTMLAKALRPLPDKWSGLQDV--EERFRKRYLDLMSEDVRARFVVRSQVITEMRNFLDDAGYLEVETPVLQAHAGGATALPFQTHHNDADLYLRIAPELYLKRLLVGGFPKVYEIARNFRNEGIDVT-HNPEFTMLEFYESF-SNATEQRAFVEKLFKHLVKTVFKKVPIEVDGVEIDFKNA---FAVVAFYDLLRKAQQCGVATEKG-ATREKLLDDIYKKMCRPKLIQPTFITDYPVNYLPLAKRT-EGDASLVDAFQLVAGGIELVKAFSELNDPLDQAERFRVQDGDKEADQEYLEALEHGMPPAGGVGIGIDRLVMFLTNTKNIREVILFPTLRTK... 488
231 0.000e+00UniRef50_A0A2A4Y6P4 Aspartate--tRNA ligase n=4 Tax=unclassified Bacteria TaxID=2323 RepID=A0A2A4Y6P4_9BACT  ali  38  1MERT-TLGKLAEK-TGEKVRIEGWVDVRRDHGKLMFLVLRDRSGSVQGIVKGELAAGET---AQKLREQWVVRIEGTVNQRPENMGDIELLVEEITVLAEAAEMPFD---IDAELNLDTHLDHLPLTLRNQKSRDIXSIQATITESFSSFLRGEEFVEYQPPALVGGDAEGGASAFKVSYYDKDAFLATSPQLYKQI-MVGAHERVFSISKVFRAEDHATSRHLSEYTSLDFEMGFIEDHVDVMEMTQRVHANIAKNVAEKHADALARFGVEAPLAPEKFPVLKLSEAQEIIKEFGGKAVGESDLEPEHERQISEWARREHNSDYIFITHYPVSKRPFYTYEDKEDKGMTKSFDLLFRGLEITSGGQRIHDYDTLVASLEAKGLKPELFEFYLQAFKFGMPPHGGTGNGLERMTQLMLGLSNVREATLFPRDMNRID. 436
232 0.000e+00UniRef50_A0A1V4RCT7 Asparagine--tRNA ligase n=2 Tax=FCB group TaxID=1783270 RepID=A0A1V4RCT7_9BACT  ali  26  16.............YTSDTATVYGWIKTARTGKSVAFASLNDGSTSLQVVFDKISFP---VEKLSALQTGACIKVTGTVVESQGKEQTVEISAKDLEIVGPVDSEYPLQ---KKRHSLEFLRTMPHLRSRTNTLGSVFRVSHHISMAIHRFFDTNGFFNVHTPFITESDCEGAGETFQLDYFKKKAFLTVSGQLEAEPF-ALSMGKVYTFGPTFRADPSDTRIHGAEFWMLEPEMAFF-DLEDNLKLIEKFVKFTASYLMEKCSDDIAFFTRFYEKLDNDFGKITYTQAIEIIRSVPDRFDTVPRWGDDLATEHERYLAEEHFGKPVFVIDYPVSMKPFYMYVNDDGKTVGACDLLAPGVGELVGGSQREHRLPILEKRAVEQGLDMDTYRWYMELRRWGTAPHAGFGLGFERLLMYLTGMDNIRDVVPFPRTFGKMY. 461
233 0.000e+00UniRef50_A0A109V511 Aspartate--tRNA(Asp) ligase n=3 Tax=Nanopusillaceae TaxID=1890942 RepID=A0A109V511_9ARCH  ali  38  2.....NIGELEKIEYNKEVVLAGWIVNIKNIGNISFIILRDQTGDAQITIKKDIFND--LEFIKEFSLHTFIVVKGKYIK-GIAKKYKEVVAEEIYLISEPADRLPID----ENSYFEKRMNYRWIDLRDPKKSLIIKLTSYAVKYIREYLYNNNFIEIFSPKIISTASEGGAEVFELNYFNRKAYLAQSPQFYKQMAICSGFEKVFEIAPAFRAEPSFTSRHLTEFTSFDVEIGYISSHYDVMKVLEEIVKYTNKKIKENFEDEIKKYYNVDVFIPENIPKIKMEEVYEIIGKSNIKENGD--ITSEGEKILGDYVKKTYDNEFVFIIDWPWTARPFYHMKGEPMKNTTKSFDLLYNGLEISTGSQREHRYKILLEQIKEKGLNPDNFKYYLEFFKYGAPTMGGFGFGIARYIKQLLNIENVKEAVLIPRDPNRLEP 428
234 0.000e+00UniRef50_A0A1W9SA85 Aspartate--tRNA(Asp/Asn) ligase n=1 Tax=Rickettsiaceae bacterium 4572_127 TaxID=1971637 RepID=A0A1W9SA85_9RICK  ali  35  10..........LKLLAGQEVTTQVWVETIRKSGGIIFLILRDISGKAQAIVTKE--DAELFEEVRALTTESILKITGEIKVEEKAPSGFEMMVKKIKVLSRAEELPIPVVEKGGEVSIEKRQDWRFLVLRRSRDALIMKVRTTMDMAYRNFLIGKGFLEIHTPKLMNSPSESTSDLFELEYFGDKAYLAQSPQLYKQMAIASGLEKIFEIGKIFRAEESLTTRHATECMSYDLETSFVEKIEDIADLEEELIVHMMQEIKNAWGDEIEHFGIEVKIPSTPFPRITFAEAKDLAKKAGVNEEDDPDLATAEEKIIGQAIKEKFNHDFVFVTHYPISGRPFYHKRTEN--ETTESADLLMLGMEITTLAIREENYDQLIKNADHKGVDISNMQWYLDFFKYGCPPHGGFGMGGARILMQLLGLPSIRDAMFLFRGPTRIQP 434
235 0.000e+00UniRef50_S9WCV9 Lysine--tRNA ligase n=4 Tax=Amniota TaxID=32524 RepID=S9WCV9_CAMFR  ali  24  143...THFIQEYSDHLTDITLKVAGRIHAKRASGKLIFYDLRGEGVKLQVMANSRNYEEEFIRINNKLRRGDIIGVQGNPGKTKKGELS--IIPYEITLLSPCLHMLPHLHFGLK--DKETRYRQRYLDLINDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHNDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLT-HNPEFTTCEFYMAY-ADYHDLMEITEKMISGMVKHITGSYKVTYHPDGPEEIDFTPPFRKISMVEELEKALDMKLPETPPPRTTARLLDKLVGEFLEVTCINPTFICDHPQIMSPLAKW-HRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQGDDEAMFETFCTALEYGLPPTGGWGMGIDRVAMFLTDSNNIK.............. 602
236 0.000e+00UniRef50_A0A1C6BKL2 Multifunctional fusion protein n=17 Tax=Ruminococcaceae TaxID=541000 RepID=A0A1C6BKL2_9FIRM  ali  37  528.KKEFMLADAKANM-GKEVEFSGCVHRIKNMGSIAFIVVRTSRDVIQTVYSADNCK----DSIEGLREGFFVNVKGIVKENPKDFNGLEIELDSIKLISTNAAELPLKISQGRNCTIEVNLDNRAASLRNPYERAIFKLQEGLVQGMHKFMQANNFTEIHSPKIVAQGAEGGANIFRLDYFGKSAFLNQSPQFYKQMA-VAFFDRVYEIAPVYRAEKHATSRHINEYIGLDFEMGYIDSMYDVMKMEIAMLKSIFEYIKENYQNELKILDADVPEIKEV-PSIKFADAIELLRG-GEGSGKKFDLDPEDEVNLGKYAKEKYDSDFIFVTHFPSSKPPFYAMNSREDPREAYKFDLLFRGLEITSGGQRIHDYNEQVEKMKAQGLDPADFKNYLEAHKYGLPPHGGLGIGLERLLMKLLNKNNIRETSLFPRDINRLLP 957
237 0.000e+00UniRef50_U4TWR4 Uncharacterized protein n=2 Tax=Dendroctonus ponderosae TaxID=77166 RepID=U4TWR4_DENPD  ali  28  627............KYREKRVKLNGWVHRLRRQGKLMFITLRDGSGFLQCILSNQLCSTYN---ALVLQTESTVLLFGTLKQVPEGPGGHELHVDYWELIGLA-PPGGADSLLNEEALPDVQAENRHIMIRGENTSKVLRMRSVLLQAFRDHYLDRGYCEVTPPSIVQTQVEGGSTLFKLDYFGEEAYLTQSSQLYLETCLPS-MGDVYCIAESFRAEQSRTRRHLAEYTHVEAECPFI-SFNDLLDRLEDLICDVVDRVLKSYGEIVRELNPNFQVPTRPFMRMNYSDAIDYLKEHNITKEDGFYEFGEDIPEMPERKMTDEINKPIMLCRFPANIKSFYMSKCPEDVRLTESVDLLPNVGEIVGGSMRIWDSEELLEGYKREGIDPAPYFWYTDQRKYGTCPHGGYGLGLERFLCWLLNRYHIREVCLYPRYLNHCKP 1053
238 0.000e+00UniRef50_Q9LJE2 Lysine--tRNA ligase, chloroplastic/mitochondrial n=50 Tax=cellular organisms TaxID=131567 RepID=SYKM_ARATH  ali  23  108.EKSHSANQLQEIYKGEEVSIAGRVVARRAFGKLAFLTLRDDSGTIQLYCEKERLSDDQFEQLKQIDIGDILGASGSMKRTEKGELS--ICVNSFSILTKSLLPLPDKYHGLT--DIDKRYRQRYVDMINPEVADVFRRRAKIVSEIRKTVESFGYLEVETPVLQGAAGGAEARPFVTFHNGRDLYLRIATELHLKRMLVGGFEKVYEIGRIFRNEGIST-RHNPEFTTIEMYEAY-SDYHSMMDMAELIVTQCSMAVNGKLTIDYQGTE---ICLERPWRRETMHNLVKEITGINFSELGEDLGNGHLLNEIFEVVVEPKLVQPTFVLDYPIEISPLAK-PHRGNAGLTERFELFICGREMANAFSELTDPVDQXXNAKKDDDDDESYEDFLTALEYGMPPASGMGLGIDRLVMLLTNSASIRDVIAFP........ 596
239 0.000e+00UniRef50_A0A1M3BMA7 Lysine--tRNA ligase n=1 Tax=Solirubrobacterales bacterium 70-9 TaxID=1895833 RepID=A0A1M3BMA7_9ACTN  ali  26  54..RDTTAAAIRAEFDGKVVHLAGRVMGERRHGGLDFADLQDETGKLQLIVTRGEVGGEGLHDFSDLDLGDWIGVEGTVVASDKGELS--VRVDKFELLSKSLRALPDIRHGVTDA--ETRYRRRYLDLILDESRRVFQIRSAVISATRRTLLDKGFREVETPVLLDQAGGAAAKPFITHHNDIDMTLRIALELNLKRLIVGGMNRVFEIGRVFRNEGVDT-RHNPEFTLLEAYQAF-GDYEDMMDLTEAIVEACCIEAIGTTVVTI---NGKEVDLKPPWRRATMAELIEIADERGVEYLD-VWGSGKIMAEVYDDSSEHLLVEPTFVLDHPREVSPLA-RAHRDDPTLTERFELVVAGRELANAYSELNDPVDQAERFQKEGGDEEGDNSYVEALEYGLPPTGGLGIGLDRLVMLISGAEAIRDVILFPTLRP.... 511
240 0.000e+00UniRef50_A0A1Z7M6F3 Asparagine--tRNA ligase n=2 Tax=Firmicutes TaxID=1239 RepID=A0A1Z7M6F3_9FIRM  ali  28  2..KHIDIKKLLESYVDTSVTVCGWVRTARNSKSVSFIELNDGTCLIQLVIDKNEVEVNKNAF----NVGAALKAVGSFVRSER--NGYEIQIQTIEVLGNCPSDFPLQ---KKRHTVEFLRTIPHLRVRTRYFEALFAVRDQLSYAVHDYFHKNGYKYVHTPIITGSDCEGAGEMFRVDFFGTKAGLTVSAQLEGEMA-AMGLGRIYTFGPTFRAEHSNTTRHAAEFWQVEPEVCF-ADIDDIIEIGEDFIKSIIRDVMEHCPDEIQFFNQWVDKLESDFGRMTYTEAVEILQKSGKEFQYPVEWGCDLQTEHEKYLTEEYLKKPVFVVDYPADIKAFYMKQNPDGKTVAATDLLVPGIGEIIGCSEREADMGKLVAAMEKRGMPLEEYQAYLDTRKYGSVPHSGFGLGFDRMLMYVTGVSNIRDTLLFPRTVGNL.. 462
241 0.000e+00UniRef50_A0A0G1N569 Lysine--tRNA ligase n=14 Tax=Parcubacteria group TaxID=1794811 RepID=A0A0G1N569_9BACT  ali  23  29.KRTHGIAECLSHFFRRPVAIAGRVTALRKQGGLIFADVRDRGGSIQVLLKKDELNNFSF-FEDNLDIGDFLEAGGILIKTRRGEKS--VKAREARIIVKSLQPLPSSWYGIKDV--EERFRKRYLDLLNKEVDEKLRERSEIIKALRDFLAGEGFMEVETPVFQPIPGGAKARPFVTHHNDEDFYLRIAPELYLKRLLVAGWEKIYELGKVFRNEGID-RDHNPEFTMLELYWAY-QDYNGLMDFTEKMLKS---------------FKLEALSFEDKLPRITYAEAFKKYAK-----KDSSKLNNDELDEVFKKEVRPKIKEPTFVIDHPKVISPLAKSK-EDNHELAERFQLIVNGMEIVNGFSELNDPIDQRKRMEEQAGDEEEDAEFIEALGYGMPPAAGLGIGIDRLVAIATGTHAIKEIIIFPTLR..... 448
242 0.000e+00UniRef50_A0A0L0DMJ4 Aspartyl-tRNA synthetase n=1 Tax=Thecamonas trahens ATCC 50062 TaxID=461836 RepID=A0A0L0DMJ4_THETB  ali  33  131......IADIDAAMDGQEVTVRGYAQTVRGQGKRAFIVLRSTIHTIQCHYSGN---KAMSKFLASISNESLVDVTATVSIPPTTKSGVELQVLKCYVVNAA-AELPFQIRDASHVGQDTRLDFRWIDLRTRANQGIFRMRSVAVNAFQNFLVSQGFTGINSPKLIQTASEGGADVFTVDFFGDKAYLAQSPQLYKQMAICAGLEKVFEIGPVFRAENSNTNRHLVEFVGADIEATFKEHYHEVLVTITNALVAVFDELSDKYADLRAAVNEQYPFEKFPILVMDYPEAIAMLTEAGVELGDGSHLDTAAERELGRLVREKYGTDVFCVDAYPSSVRPFYTACRPDNPAVSNSYDIFVRGREILSGAQRIHDPAMLVERANSLGVDLTPIQSYVDAFKHGAPPHAGGGFGVERIVLQFFALDNVRKVSMFPRDPKRCHP 613
243 0.000e+00UniRef50_A0A1W9R7N6 Lysine--tRNA ligase n=4 Tax=Bacteria TaxID=2 RepID=A0A1W9R7N6_9BACT  ali  24  19.....SIKNILDNFENKEVATAGRLIAKRDHGKSMFAHISDITAKLQVYAKLDIL-KEGYQVFTSLDVGDIIGVKGVLFKTRTGEPT--LLVREVKLLAKSLKPLPEKWHRLKDV--EVRYRQRYLDLINPTSAQVFLGRSKVISFIRDFFAKEEYIEVETPMLHPLAGGASGKPFVTRHLDCDVYLRIAPELYLKRLLVGGFDKIYEINRSFRNEGL-SSRHSPEFTMLEAYCAY-QNYEYMMEVCEKLFSSLLEYLYGRLEINYQGYS---IDFTPPWLRVSLAEAIKKMRNYFRKSKGEEVLSRSQLLNLTEDLMEKRYTKPVFVTDFFTWASPLAKRKK-DNPNLVERFELFIAGLEIANGYSELNDPIEQRRRFEEHLEFKKIDEDFILSLEYGMPPAVGLGIGIDRLVMLLFNQPSIKDVILFPLHRVR... 466
244 0.000e+00UniRef50_A0A2E5KGN8 Aspartate--tRNA ligase n=2 Tax=Thaumarchaeota TaxID=651137 RepID=A0A2E5KGN8_9ARCH  ali  39  12.........IDESMYNKNAQVTGWIEDSRSIGSLIFLTLKNSTGKLQLIIKKNQVSEELWKQVDNITRQSIVKANGKLVHNEKNNI-IELIIEELNILNEAVHPLPLDPTGRVDSGLDIILDSRSLSLRKPEIKSIFKLRNDSLMYIRDFFINNDFLEINTPKILSLGAEGGATLFKTEYFDKLGFLAQSPQLYKEQLMLA-FEKVFEISHYFRAEKSNTTRHLNEFVSVDFEWAYKNN-EQTMDLCEDLIKYTINNLIKNSFKELKNLDSDLSNYLNKFDRITYQNVIDDLNDLDHKKSFGEDITEHDLVVLSEKHK-----SFYFITDWPSEIKPFYIAGHK-DSDLSMSFDLQFSNVELVSGGVRIHKVDELEKNMKKSGLDIKNFKSHLQTFKWGMPPHSGLGLGFDRLIMILANRKNIREVVLYPRDKDRLEP 431
245 0.000e+00UniRef50_A0A2D6ELE8 Lysine--tRNA ligase n=3 Tax=Proteobacteria TaxID=1224 RepID=A0A2D6ELE8_9PROT  ali  24  33....HTCADLSKRFENENVTLAGRIMLLREFGKLAFFSLADASGRLQCSVSVDTTGKEQYDIFKKVDMGDIIGVEGRMTRTQKGELT--LAADRFEIINKSKRPLPDKFKGLS--DTETRYRQRYVDLMNDDVKETFKKRSQIVSAIREYMTEAGFMEVETPMLHHKASGAAARPFETYHNSMEMKLRIAPELHLKRLVVGGFDRVFEINRNFRNEGV-SVRHNPEFTMMEFYAAY-WDYHDLMDFSAKLIEHCAIKAMGTTELTY---GEHKVSLKAPFTKLSMKEALLTIGEVSEDDKWGDY--GQCFLELFEELCEEKLIDPTFIYDYPTSTSPLS-RPKDGAEEWTERAELFCVGRELGNLFSELNDPVDQANRFQDQGNDEAMDEDYVRALEYGMPYAGGMGIGIDRLVMLLTNQASIRDVILFPHLRP.... 491
246 0.000e+00UniRef50_A3MV91 Asparaginyl-tRNA synthetase n=9 Tax=TACK group TaxID=1783275 RepID=A3MV91_PYRCJ  ali  35  10......IAEALRRGEGKA-TVRGWVYRKRTLKEKVFLLLRDATGVIQLVVPRAKFPE-----AESLNLESSLVATGVLVREPRAPGGVELHVESIDWV-YVGEPYPI-NEDAAVSDSEYLLDVRHLWLRSRKMQAILKIRHTVFGAIHDYFRRRGFYEVHPPMFITAAVEGGATLFKVEYFDRTVYLTQSSQFYLEALIYS-LEKVYTVAPSFRAEPSRTRRHLTEFWHAEMEIAW-AHMDDAAKVGEEVIGHVVERVXXXXXXXXXXXXXXXXXXKPPFHWLSYDEAIEVLRKKGFALSWGDDIGADEERALTLEFDK-----PIILHGFPEKLKAFYHRNNPQRPEVTLSFDVLLPYGEVIGGGERIYDAKELVEKIIRFGLNPEDYQWYIDLRRYGSVPHAGFGLGVDRLVMWIAGADHIRDVVPFPRDIRRTRP 431
247 0.000e+00UniRef50_A0A0G1QFD9 Lysine--tRNA ligase n=6 Tax=Microgenomates group TaxID=1794810 RepID=A0A0G1QFD9_9BACT  ali  24  34...THLIKDAK---FDTEINVAGRIRSLRRQGKIAFFDVSDRSGHIQVFAALPEVGEVVYSLVKLLDPGDFVGVKGTVFKTKSGELT--VRTKELTFLGKAMRPLPDVWYGLK--DKEDRFRHRHVDLLNPISKQLLDSRWTVERAIREFLWSENYQEVETPILQNLYGGTNARPFTTHLNDTDMYLRVAPELYLKRLVIGGYERVFEIARNFRNEGMDQT-HQPEFTMIEFYEAY-ADYHRIMDITEDLFKNVALKLNGNLKLKVE---DKAIDLSGKWRRLTIDQALQILTQHKFKIA-GVYSRSKALFAIFDHLVAPKLIQPTWVIDYPVEVSPLSK-THRSKKGRVERFEGYIGGKEICDGWSEIVSEKEQRERFEKAGDDEAQDEEFLEALSYGCPPLGGIGIGIDRLVMFLTNTWSIREVIAFPLLRP.... 478
248 0.000e+00UniRef50_A0A0S7XDT4 Lysine--tRNA ligase n=1 Tax=Latescibacteria bacterium DG_63 TaxID=1703781 RepID=A0A0S7XDT4_9BACT  ali  27  33...THSSSDVLSESEERPVSVAGRLVSKRKHGKASFGHVQDRTGKLQLYFREDNLGKEAYELLAMVDVGDIIGVSGPVFKTKTGEIT--VKVEAFQLLSKSLRPLPEKWHGLRDV--ETRYRQRYVDLINAEVRELVTTRSRIIKTMRNFLDERGFIEVETPVLQPLYGGAFARPFVTRHLDMDLYLRIADELYLKRLIVGGLERVYEIGKDFRNEGID-RTHNPEFTQLELYQAY-ADYMDMMELFEEMVCEVVTELFGELKC---VYGEHQLDFSRRWKRFGYFEALKLCTELGMDVRSGIDQPAAREILLEELFSEKHLIQPTFVYDYPKEISPLA-REKAGSPGIAERFEPIIAGLELGNAFSEQNDPLEQARQFDLQKGDAEADLDFLRALEYGMPPTGGLGVGIDRLTMVLTNSRNIREVILFPHLRP.... 526
249 0.000e+00UniRef50_A0A2G6N192 Lysine--tRNA ligase n=2 Tax=Proteobacteria TaxID=1224 RepID=A0A2G6N192_9DELT  ali  25  44...THSSADVRDALIDDRFRIAGRIVEFRSFGKATFAKLLDRGGRQQVYVRRDVVGEDVYKVFKKAEPWDFICVEGYPFYTKTGELT--VMAEKVALLTKAVRPPPAKWEGLK--DQETRYRQRYVDLVNPNVAEVFRKRTRLIRYIRAFLDEREFLEVETPILHATLGGAAAKPFATHHNNMPLYMRIAPELYLKRLVVGGFDRVYEIGRNFRNEGL-SRNHNPEFTMLEFYMGYAT-YETLIELTEEMLTGAAELIAGTTALTFQG---QTIDVSRPWPRISVKALVLKAGQDEATLDDPEAFTAWIDDELGEALRRATHDRPVFVIDYPAAISPLA-RRKDANPEYVDRFELFFAGREVANAFSELNDPEDQRGRFQRQGDDEEYDEDYCRALEYGMPPTAGEGIGIDRLLMMLTDQPSIRDVLLFPHMR..... 521
250 0.000e+00UniRef50_A0A1Z5STV4 Uncharacterized protein n=16 Tax=cellular organisms TaxID=131567 RepID=A0A1Z5STV4_HORWE  ali  33  199......IRELKPEQVGQVVAFRARIHNVRKLSHLMFIELRQQTATIQGILHEHAVSQYFLYWAEHLHVETIVRVQGVIQEPKAKEGDVEVHIHELHVEAQPNEPLPFTVHEAERVSDRARQNNRIIDLRTTTSQAIFKVQSGICQMFRHHLDSLGFIEIHTPKLQGVASESGASVFKLDYFGRPAFLAQSPQLGKQMAIAADMRRVMEIGPVFRAENSNTHRHLTEFTGLDLEMAIETHYHELLRVLDSTFKAIFEYIYTKYRPEVEVVKRQFPSDDLVWPIIPFAEAIRMLNESGHRDEDGEDMGTKDEIALGAVIKEKLKTDYYILDKFPTSARPFYAMADPERPEVTNSFDIFVRGQEILSGGQRIHDAPALIAKMQSMKMKPETMEEYMSGFEWGAPPHGGGGIGLERILMLMLKLGDIRHASMFARDPRSL.. 662
251 0.000e+00UniRef50_A0A0G1H312 Lysine--tRNA ligase n=118 Tax=root TaxID=1 RepID=A0A0G1H312_9BACT  ali  26  34..RT-EIAEVKANFKKKPIGIVGRVLAKRGHGGIMFLDVYDGTEKLQVLAAEDKLEKETYSLLETIDVGDFIAVWGKPFYTKRKEPT--IVVEKWQMLSKSLRPLPEKWHGL--VDVEERFRKRYLDLMNGEVKGKAIVRSKIISALRSFLDNEGFLEVETPVLQTLAGGTSARPFKTHHNDIDLNLRIALEIHLKQLLVGGLPKVYEMGRIFRNEGIDAT-HNPEFTMLEAYAAY-WDEEQLMKFIEKLTGELAKTVSGNKAV---VFGENKISFKPPFKRINFFDALERYADYGKKTRDELVTIGKIADKIFAKVCRPKLINPTFVMNYPADILPLAK-RSEKDPGTVIAFQLIAGGIELVKAFNELNDPIDQRERFKKELENKEMDEEFIEALEYGMPPAAGFGIGIDRLVMLLTNTDNVKEIILFPTMKPK... 490
252 0.000e+00UniRef50_A0A1W9UP70 Lysine--tRNA ligase n=1 Tax=Anaerolineaceae bacterium 4572_32.2 TaxID=1971624 RepID=A0A1W9UP70_9CHLR  ali  27  30.KRTHTIAQALAALKGPQVAVTGRLRSMRVMGKIAFAHIEDGSGAIQLFLRIQNVGQETYEMFKDFDLGDFVGAEGALTRTRTGESS--VLVERVDMLSKSVSPLPVIKEKEEDSDIEERYRQRYADLANPEVREIFRVRARTLSALRRFFDEHDFLQVETPILQPIYGGAAARPFVTYHLHQDLYLRISFELYLKRLLVGMYDRVYEIGRDFRNEGI-SPKHNPEFTQLEFYAAY-WDYGDVMTFCEQMVATVAKEVTGSPVVHYQG---HEIDLRPPWRRVTLRDGIDYFQAQGLPTKPGATWGYLIDKGLLG-AVEPTLTQPTFVMDYPRDISPLAK-TKPNDPTHVERFEFFIAGLEMGNAFTELNDPFDQEQRFLEMGDNEEADDDYLRAMKYGMPPNGGFGMGVDRLVMLLTDQSTIREVILFPQLR..... 499
253 0.000e+00UniRef50_A0A0G0WN53 Aspartate--tRNA ligase n=52 Tax=root TaxID=1 RepID=A0A0G0WN53_9BACT  ali  35  2...............GAEIVINGWVQTRRNLGKIIFLDIRDGSGLVQVVCAPSELGSD-YDVAKEVRQEFVVEIAGVVNKRNEKTGTVEILAKDFKILAKAES-LPLDPADEKM-GLDVYLDLLPLTLRTEKNRALFKIQAEIINAFRSFLISYDFVEFQCPKIVGASTEGGANVFKVDYFGQPAFLAQSPQFYKQI-MVGVFERVFTIGNVYRAEEHATTRHINEYTSLDLEFGFITDHLDVINLEIEFLRFLKGFLAERVGAELKLWDYQEMKIPKDIPIMKLRQAQELIKKEGVNHTNEPDLEPSEEQWLGKYTLKQHDSDFIFITHYPTAKRPMYTYPDEADLEFTKSFDLLFRGIEVTTGGQRINDYEQLVANIKKWGMQPENFKFYLEAFKYGMPPEGGLAIGLERMTARLLGIDNIKHATLFPRDLNRID. 427
254 0.000e+00UniRef50_A0A1V4JH70 Asparagine--tRNA ligase, cytoplasmic n=1 Tax=Patagioenas fasciata monilis TaxID=372326 RepID=A0A1V4JH70_PATFA  ali  32  130.........ALEAYRGQRVKIFGWIHRLRRQGKLMFIVLRDGTGFLQCVLSDELC--QCYNGLV-LSTESSVAVYGTLNLVPEGKQGHELSCDYWELLGLAPAGGAD-NLLNEDSEVDVQLNNRHMMIRGENMSKIFKVRSMVVQAFRDHFFANGYYEVTPPTLVQTQVEGGSTLFKLDYFGEEAYLTQSSQLYLETCIPA-LGDVFCIAQSYRAEQSRTRRHLAEYTHIEAECPFI-SFEDLLDRLESLVCDVVGRVLKSPASLLYELNPAFKPPKRPFRRMNYSEAIEWLKEHDVKKDDGTHYFGEDIPEAPERLMTDTINEPILLCRFPAEIKSFYMQRCHDDSRLTESVDLMPNVGEIVGGSMRIWDSEELLEGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWILNRHHIRD............. 546
255 0.000e+00UniRef50_W6QBB7 Aspartyl-tRNA synthetase, cytoplasmic n=138 Tax=Eurotiomycetes TaxID=147545 RepID=W6QBB7_PENRF  ali  33  87.......SELSEEHYEKEVTVVARVDNARVQSKLAFLMLRQQGQKVQAVIAAAEISRQMIKYTGGLNVNSIVQITGIVKKPEIPISSLEIHIRKVYMISEAAQMLPMQVKDAERPPPETRLDNRVLDLQTETSQAITWISSGVSQLFAEYMIKSGSRWISTPKLVGAATEGGSGVFEVKYFKRNAYLAQSPQLYKQMCIAGDMENVFEIAPVFRAEDSNTHRHLTEFSGLDFEKTFRGHYHEVLEFAEDLLVFILTQLKERYATQIATIQKSYPK-AGDFKRLNYMDGVALLKEAGVDVRFENDFSTAMEKQLGQIIREKYDTDFYVLDKFPMAVRPFYTKADPDDKRFSNSYDFFMRGEEIMSGAQRINDIKELEESMRSKGLEPEGFEDYLNAFRQGCPPHAGGGLGLNRIVMFFLGLPNVRLASLFPRDPQRLRP 556
256 0.000e+00UniRef50_C7M1R4 Lysine--tRNA ligase n=7 Tax=Actinobacteria TaxID=201174 RepID=C7M1R4_ACIFD  ali  24  46...............DQQVRVAGRILRLRRQGRMAFGELRDASGAIQLWLRADRT-QAFSTLADSLVLGDWVGVDGVIATTRTGERS--VLVDRIQLLAHARRSFGDKWRGVR--DPDVRYRQRYVDLANPGVRERFLARSRLVRALRDELDARGFVEVETPILQPIASGAAARPFVTHHNDMDLYLRIAPELYLKRLVVGGIERVFELGRDFRNEGI-SPRHNPEFTMLEAYQAY-GDIDAMRELTEGLLASAARAVFGSTRGENELG---VIDLTPPFRAATMEDLVSEAVGERVSLDEPEPEAGRALVALYEELVEPRLIEPTFVLDFPESVSPLA-RRHRSRPGRVERFELVVGGRELVNAFSELNDPDEQRARFEEQGDDEAMDADYVRALEYGLPPTGGLGLGVDRLAMLLTGQRHIKEVILFPTLRP.... 479
257 0.000e+00UniRef50_A0A2M8Q3W2 Aspartate--tRNA(Asp/Asn) ligase n=159 Tax=Bacteria TaxID=2 RepID=A0A2M8Q3W2_9CHLR  ali  36  1MQQRILSSQL-AEYVGQTVCLKGWLHRLRQLGEVNFLILRDRHGIAQAVL-----SAEAATTLSHVPVESIVCVSGRVVQESQAPGGYELHDPTVEVINPSAAPPPLEINKKKKASLPFFLDHAVIGYRHLERRAIFQIASGIMQGFRQTLNAADFTEIQTPKLVGTSTESGANVYAVEHFGQTAYLAQSPQFYKQI-MVGVFERVYEVGPVFRAEKHSTTRHINEYVSMDVELGFIHDHFDVMAVVTQVITGILEYLSADYSQQLALLKVDMPDIQHPFPYIHFADAQQMLAEQFKDAIGAPDLTPEHERLLGKWAQQKYQSDFLFVVGYPMQKRPFYTHPDPDRPDYSNSFDLLFRGLELITGGQRLHRYEDYITAIEKMGHSLESYAHYLEAFQYGMPPHGGFAIGLERFVMQLLKLDNIRLATLFPRDIHRLVP 439
258 0.000e+00UniRef50_A0A2T7NGX0 Lysine--tRNA ligase n=2 Tax=Pomacea canaliculata TaxID=400727 RepID=A0A2T7NGX0_POMCA  ali  25  502............EMLEEDITVAGRIHAKRLSGKLIFYDLRGEGVKIQVMANAKSSDDEYEKVIEKVKRGDMIGVRGKPAKTKKGELS--IVPVEMTLLSPCLHQLPHLYYGLK--DKEKRYRQRYLDLINDNVRHIFITRTRVINYLRHFFNGLGFLEVETPMMNMIPGGATAKPFITHHNNMDLFMRVAPELYLKMLIVGGFDRVFEIGKNFRNEGIDLT-HNPEFTMLEFYMAY-ADYNDLMQLAEELLSGLVKHLTGGYKVVYHPEGPEEIDFTPPFKRFSLVRDLEKLCIKHEVECPPPRTVARMLDKLVGVFLEEKIISPTFIIDHPQIMSPLAKW-HRSEHGLTERFELFIMKKEICNAYTELNDPVIQRDCFQQQAKDKAADENFCTALEYGLPPTGGFGLGIDRLTMFLTDNNNIKEVLLFPAMKP.... 957
259 0.000e+00UniRef50_A0A0G0NIV3 Aspartate--tRNA(Asp/Asn) ligase n=19 Tax=Bacteria candidate phyla TaxID=1783234 RepID=A0A0G0NIV3_9BACT  ali  36  13MRDRILSRDI-KNHIGKEILMQGWLHKKRLLGGMMFVVLRDRSGVSQILVEAKEESEK----LEGLQIGTVFGIIGTVAEEPRAPGGIEIHDPKITVILPVTETSPIKPLSHKSDNLDTLFEYRVLGVRNINEGKVFRIRSELNRYLREFLNQNEFVEIQTPKILAGATEGGAEVFKFDYFGKEATLAQSPQFYKQI-MVGAFERVFEIGPTFRAEPSTTSRHLSEITMLDIEMGFIESHDDVLKMTENLLYNVLTKIYGEHVEELKSLNAPELVLKPSFPRYTLKQVHEMYAKAGINTVGEKDMRPEEEKWICDYSKKENGCEAVFVTEFPVEGMKFYHMINPQDTTTVLWADLLFRGLEIATCPMREHRYQNLVAQMKKAGLNPEHYKYYLQAFKFGLPPHGGFGFGIDRFLEKILGLGNVKEATLFPRDINRLTP 450
260 0.000e+00UniRef50_A0A261XWV8 Uncharacterized protein (Fragment) n=1 Tax=Bifiguratus adelaidae TaxID=1938954 RepID=A0A261XWV8_9FUNG  ali  34 1525...............GDQVTMQARVHAIRNMGQLTFIVLRQRALTIQSVLHRQVVSSHMMKWIARLRPEDIVLVRGILTKPPKSIRDTEIDVREIFLISQVTQRLPFPISHATHITDRKRLMSRIVDLRTPVSQAIFRVNAGICTLFRSYLEGHDFIEIHTPKLQASATESGSSVFQVNYFGREAFLAQSPQLSKQMCIAADFGKVYEIGPVFRAENSNTHRHLTEYTGLDLEMTIDGHYHEAMELIDDMLKSVFAGIHKRYRSQLDLIKTQFPAQDIVWPRLSFTEGVRLLHDSGWTDENNEPLSTPAEIRLGELVREKYGTDYYILDKFPASARPFYTMLDPENPKFTNSFDIFLRGQEILTGGQRIHDPKMLEQRMRESGVRPETMEEYMNGFRWGAPPHAGAGIGLERLVMLMLGLGNIRLGSLFPRDPKSL.. 1973
261 0.000e+00UniRef50_A0A1F6IGB1 Aspartate--tRNA ligase n=2 Tax=Candidatus Levybacteria TaxID=1752719 RepID=A0A1F6IGB1_9BACT  ali  39  14..........TPQLIGKKILLAGWIKTRRDHGKLIFFDLRDRTGLVQLVVNPK-VSGGSYKIAQDLRPEYVIGVIGEVKRRPEGTGEVEVEISEINILSRA-KPLPFDIGGEESLELPTLLDHRSLGLRHPKISAIFKVQETIANTFRKTLREEGFTEIFVPTLVPFATEGGAEVFPVDYYTHKAYLAQSPQMYKQI-MTSIFERVFTIAHAYRAEPSVTTRHLSEYVSLDAEFGFIDSWEDLMDMAEKIIKEIIDEVEDKNDKDLKIFNKKLPEIKHKIPRLKMREAQEIIKRTNTDHKGEPDLDPQDEKEILRWAEEETGAPFVFITHYPTKKRPFYTMPDPKDPDFTLSFDLLGINEEWVTGGQRINNYDQLLSNIKKWGNSPSNFEIYLQAFRYGMPAEGGFAMGLERITKDILGLLNVREASLFPRDMERID. 447
262 0.000e+00UniRef50_A0A1F9VQ68 Lysine--tRNA ligase n=13 Tax=unclassified Elusimicrobia TaxID=1797919 RepID=A0A1F9VQ68_9BACT  ali  24  46..KTHSARQSAESALESRVQTAGRVVLMRPMGKAAFAHLQDSTGKIQVYFKQDILGAEPYQLVKAVQAGDFVGVEGKIFKTKTGEIT--IQAESVTLLCKSLRPLPEKWHGLKDV--ETRYRSRHLDLLNPETFDTFRKRTVIIRAVRAVMDEAGFLEVETPVMLPKAGGAAAKPFVTHHNDQDLVLRIATELYLKRLIVGGYERVYEIGRIFRNEGVDT-RHNPEFSMMEAYQAY-ADYHTMRELVEK----IFDRCSSALGVEQVEYRGRTLGLKPPFRALRLPEVQEKCGEDIHQIKAEELPSAKVFEQIFDAKILPELDAPTFLFDYPAAITPLAKSK-PGDEALVERFEFFAAREEIANAYSELNDPEVQRTRLEEQEKDEEADEDFVQALECGMPPTGGVGIGIDRLVMILTGQASIRDVILFPTLKN.... 500
263 0.000e+00UniRef50_A0A0K3C7P7 BY PROTMAP:  ali  28  149....IKIRQATEQ-RGKRVRVFGWVHRLRQQGGMTFVILRDGSGYLQCVLSGRLS--QTYDAL-TLTLESTIQITGVINQLPEGPENHELTADWFAVVGKAPGDDAFLNQVNEDADPSQLADARHLVIRGENASAILKVRAALLQSFRQSYANLGLLEVTPPCMVQTQVEGGATLFAFDYYGEQAYLTQSSQLYLETCLPS-LGDVFCVQESFRAEKSHTRRHLSEYTHVEAELAFLT-FKDLLEHIEELICQTIDRVLADPKIKLWAGKGKFEPPSRPFMRMDYRDAIKWLNDHNITRPDGPHVVGDDIAEAAERKMTDTIGRPIFLINFPKDIKSFYMSRVPGDEEYTESVDLLPNVGEIVGGSMRISDLDELLAAYKREGIDPEPYYWFTDQRKYGTSPHGGYGLGLERLLAWLLNRYTVRECSLYPRWTGRCTP 591
264 0.000e+00UniRef50_F1NE72 Lysine--tRNA ligase n=60 Tax=Eukaryota TaxID=2759 RepID=F1NE72_CHICK  ali  24  116...........DHLTDITVSVAGRIHAKRASGKLIFYDLRGEGVKLQVMANSRKSEEEYFRINNKLRRGDIIGVVGNPGKTKKGELS--IIPYEITLLSPCLHMLPHLHFGLK--DKETRYRQRYLDLINDYVRQKFITRAKIVTYIRSFLDELGFLEIETPMMNIIPGGAMAKPFITYHNDMKLYMRIAPELYHKMLVVGGLDRVYEIGRQFRNEGIDLT-HNPEFTTCEFYMAY-ADYCDLMEITEKLLSGMVKHITGSYKITYHPDGQDEIDFTPPFRRISMVDELEKLCAVRNVECPPPRTTARLLDKLVGEFLEVTCINPTFICDHPQIMSPLAKW-HRIHRGLTERFELFVMKKEVCNAYTELNDPFQQRQLFEDQGDDEAMFENFCTALEYGLPPTAGWGMGIDRFTMFLTDSSNIKEVLLFPAMKP.... 572
265 0.000e+00UniRef50_A0A1X9SSN0 Lysine--tRNA ligase n=54 Tax=Campylobacterales TaxID=213849 RepID=A0A1X9SSN0_9PROT  ali  27  45.....YIKELGERKAQEEVVISGRIKLKRVAGKSTFANIEDESDNIQIYYSLASIGEEDYKFKKNLEVGDIILVKGYAFITQTGEFS--LHASHITLATKAISPLPEKFHGLT--DIETRYRQRYLDMMDRDVRSDFLKRSIIISTIRRFFEERGFLEVETPMMHPIAGGANAKPFITHHNGVDRYLKIAPELYLKRLIVGGMEAVFEMNRCFRNEGMDLT-HNPEFTSIEFYWAWH-DYFEVMDLTEELFATLLDKLNLDKIIEFDGQN---IDFSKPFKRIKYLDALAKLKEDKFEANDKLDL-GHLQAELFDNYVESKLINPTFITDFPISISPLS-RRSDENPEIAERFELFIAGRELANAFNELNDPVDQYERFKAQGNDEEMDEDYCRALGYGMAPTVGWGLGVDRLVMLLLNKKSIRDVILFPAMKPK... 495
266 0.000e+00UniRef50_M2W205 Beta-carotene 15,15-dioxygenase, putative isoform 2 n=1 Tax=Galdieria sulphuraria TaxID=130081 RepID=M2W205_GALSU  ali  35  92.....SVSSLDKEKVGKQVWIRARVDTIRPKGRSAFLVLRQSQYTLQAVVSESEVSRQMIKWMKEVGEECLVDIYGSVVAAECSQHDVELHVWKLYIVNKVKARLPIRVEDAGRPDRDTRLDNRVLDLRVPSQQAIFRIQSGVCQLFREILLRESFIEIHSPKIIAGASEGGAEVFKLNYFGQNACLAQSPQLYKQMAICGDLERVFEIGPVFRAENSYTHRHLCEFIGLDIEMAIREHYFEVLDVLERLFIGIFEGICQRFASEIELIQQKFQISPITYPRLHFPEAVQLLRDNGYVLEDLEDLSTENEKALGKIIKEKYGTDFYTLASFPAAVRPFYTMPKADDSRYSNSFDMFLRGEEIVSGAQRIHDSELLETQVKARNIPLSSIEDYINAFKYGTPPHGGAGIGLERVVMLYLGIP................. 526
267 0.000e+00UniRef50_A0A0G1W360 Lysine--tRNA ligase n=8 Tax=Microgenomates group TaxID=1794810 RepID=A0A0G1W360_9BACT  ali  24  46..............EGQTLSVAGRLWRWRQHGQVIFADLKDSTGQIQLLFQSKKL-ADKFDVLKLFDVGDFLAVSGEVIKTSAGEIT--IDVDKFELLSKSLRPLPDDWHGLKDV--EDRFRKRYLDLVNPEVKSRLEVRTKIISSIREFLDNKGFLEVETPTLQPIYGGGFAKPFVTHHNDCDFYLRISDEMYLKRLIVGGFEKVYEITKVFRNEGVDYD-HNPEFTMFEAMIAF-EDYEYGMDLIEEIFEHSAKKVLGKTKINFQGKELDV---KRPWNRYKYVEAIQKFCQINPKGLEKTSKIGEVIAFVFEEVVEEKLIEPTIIYDYPIEISPLAKKCS--DPRFTQRFEMFAFGSELGNNYTELNDPVDLYQRFVEEKKREKADYDYLEAIEHGFPPTCGIAIGIDRMVMLFTNAPSIKEVILFPTLRP.... 487
268 0.000e+00UniRef50_A0A0V8QDB2 Aspartate--tRNA(Asp/Asn) ligase n=6 Tax=Bacteria TaxID=2 RepID=A0A0V8QDB2_9FIRM  ali  38  2........EFMKKAFGEIVTVNGAIHNVRDMGEVIFVILRRREGLVQCVLKHS----DMEAVEKQIREGACVTVEGVLIEEQRAPQGAEIQVQRITFLSPAEAMPVPIGKWRLNTSLETKLSLRPVTLRNIRERAKFKIQEGIVRGFRDFLYQEGFTEIRTPKLGARGAEGGSNLFRLDYFGKKAVLAQSPQFYKQM-MVGVYDRVFETGPVFRAEKHNTKRHLNEYTSLDFEMGYISGFEDIMTMETGFLKYTMELLQKEYAKELNILGIALPEI-REIPRVRFDDAKRLVSEKNRPIRNPYDLEPEEEHLIGCYFKEEYASDFVFVTHYPSKKRPFYAMDDPEDTTFTLSFDLLFKGMEITTGGQRIHDYKMLMEKIEKRDMTSEGMETYLMAFKYGMPPHGGLGIGLERFTMQLLGEDNVREATMFPRDLNRLEP 427
269 0.000e+00UniRef50_A0A2E3G5G3 Lysine--tRNA ligase n=7 Tax=Bacteria TaxID=2 RepID=A0A2E3G5G3_9BACT  ali  20  53...........DKLQDKVVSIAGRIISLRSMGKASFMNIQDETGKIQLYVKNDLIGLDNYDIAKVLDIGDIIGVQGQLFRTKTDQLS--LRVSSLTLLSKNIRPLPDDHNFFAFEDKENRYRYRHLDLINPKNKDLFKARSKIIYKIREILNNXGFMEVETPTLQNIHGGASAKPXITXHNGQDFYLRIAEEXYLKRLLIGGFEKIYEIGKNFRNEGID-RTHNPEFTMLELYESY-SDVSGMMSLCENLIKDVSKSL----DIEVVEFMGNKINLNQKFSKISMSDLVKKLCKKYNLDVEKKMNFGQLFDKLFSSLIEPKLIQPTFVFDYPKSISPLAKV-HRENSELAERFELFIAGMEFANAFSELNDPIDQRKRFEDQSGDEEADIDFIESMEVGMPPTGGIGIGIDRLIMLLLEKDSIKDVILFPSLRNK... 500
270 0.000e+00UniRef50_A0A1V8T4A5 Uncharacterized protein n=7 Tax=leotiomyceta TaxID=716546 RepID=A0A1V8T4A5_9PEZI  ali  33  210......VKLLTPEHVGKMVTFRARIHNLRKLSKLMFLELRQQTATVQGILSEGAVSAHFLYWAEHLHVETIVLVRGVVQEPKAKQGEVEIHIHEMHVEGTPEESLPFTVHEAEVSKVDVQRDTRHVDLRTTAAQSIFKIQSGICEAFRTHLSSLGFIEIHTPKLQGAASESGASVFKVDYFGRPAFLAQSPQLGKQMAIASDLRRVFEVGPVFRAENSNTHRHLTEFTGLDLEMEIDEHYHEILRTLDSTFKAIFSHLYTNFRHEIDVVKHHFPHEDLVWPIIPFAEAIRMLNEHGKVLPEDEDLGTRDEIQLGRVIKEKLGTDYYVLDKFPASARPFYAMPDPHNPGLTNSFDIFCRGQEILSGGQRIHDAAELIKKMEALKMDPKSMEEYLSGFEWAAPPHGGGGIGLERILMLILQLGDIRHATLFQRDPRSL.. 673
271 0.000e+00UniRef50_K0P993 Aspartate--tRNA ligase n=3 Tax=Candidatus Cardinium TaxID=273135 RepID=K0P993_9BACT  ali  34  1MYQRSELKNLSILNHQEVVRVRGRVFSKRDCGRILFLIVRDGIDTLQAVLVKNKLSIEDYNLLRKIENESFIELIGTIYVSACSQQSIELAIIGYTILSRSVLDLPITKEDQKTESQDFRLNNRILDLRTDLAQAIFRVNDGMLFYIQSYLRNHGFIEIKTPKLIGGASEGGADVFKVDYFGKPACLAQSPQLYKQMAIMGDFKRVFEIGPVFRAENSDTNRHLTEFIGVDLEMVIDQSYMEVVHLVYQLLLDLFDTLSKKYHREIAIIRSCFNLLPLTFVVIPFPDAVSFLKAYGKERGDFDDLSKEDEKQLGVIVKEKYHTDLYVITHYPSSVRPFYTMVDPNDGRYTHAYDFMLRGVEILSGAQRIHDYVSLSQRVAQLGIAPTTLDHYLNAFKYGVPPHAGVGMGLERMLKCFLGLPDVRYSSLFPRDPKRLYP 466
272 0.000e+00UniRef50_A0A2E1ZVX0 Lysine--tRNA ligase n=3 Tax=Chloroflexi TaxID=200795 RepID=A0A2E1ZVX0_9CHLR  ali  23  32...SNSINKIKKDYDESIYYINGRITAKRKMGKIAFLDVQNESGRMQIQLSKEKLNEK-YEILSMIDLGDFVSANGSLFTTKTDEIT--IAVEEINIISKALRPPPEKWHGV--VDPEIRYRSRHLDLINKRSKELAIAFSNTIFALRHFFHKDGFIEVQTPVLQESAGGAAAKPFITHHNDQDLFLRISLELHLKRLLVGGFEKVFEIGKVFRNEGI-SYRHNPEFTLLESYQAY-ADYKDVADMVKRLITFCAKEVAGSL---IIMNEEHEINLSDNWQELTYVEALDKFAGINYDEIDTNLSHDVMLDEIMKKFVEPQLIQPTFIFDYPTEISPLAK-KIEGNERFVERFELFILGYEFANAYSELNDPVDQKERMIEQGEDEIEDEDFVEALEYGMPPAGGLGLGIERLAMLLTGEHSIREMILFPAMKSK... 483
273 0.000e+00UniRef50_A0A1W9SB19 Aspartate--tRNA ligase n=5 Tax=root TaxID=1 RepID=A0A1W9SB19_9BACT  ali  36  1MEK-IYLKDL-AKYFNKEIVISGFVDKIRDLQYVQFVIIRDSSAKVQVTIEKNEENKKLNEVVSNLTKESTVSIKGIIYEQPKVKLGMEFIPSSIEVTSKSEEELPIDLLDYNNKSQDLRLDNRFLDLRIERNYLIFKAQTIAEMAMREYWVNHNFIEIHSPKILGTASESGAEVFSLDYFGKKVYLAQSPQFYKQMAMAAGFNNVFEIGPVFRAENSHTAYHATEFTSVDCEISWIKNHHDVMDLEEAVLVYTMKKLKKEIGETYKIYKKEIKIPETTFPRITFKEAKKIIQENYKYVGEKSYDFDRKEEELIGLYSRKKLNDFVFITEYPFEARPFYHMLDETG--LTKSFDLLYKGIEITTGAQREHRIDILMKQAKEKGLSEESLEFYFKFFRYGMPPHGGYGFGLNRFLMQLFEIDNIRDVTFLYRGPNRVNP 438
274 0.000e+00UniRef50_F6I4L4 Lysine--tRNA ligase n=2 Tax=Vitis vinifera TaxID=29760 RepID=F6I4L4_VITVI  ali  24 1079...........DHLEDITVSLAGRIMSKRSSSKLFFYDLHGDGAKVQVMADADMDEAEFSRFHSGVKRGDIVGVTGFPGKTKRGELS--IFPKSFVVLSHCLHMMPRQPETYILKDQETRYRQRYLDLMNMEVRQIFKTRAKIISYIRSFLDNLDFLEVETPMMNMIPGGAAARPFVTHHNDMKLYMRIAPELYLKELVVGGLDRVYEIGKQFRNEGIDLT-HNPEFTTCEFYMAF-ADYNDVMELTEKMLSGMVKELTGGYKIKYHANGLDEIDFTPPFRRIDMIEDLEKMADLSIPKDPPPQTTARLLDKLVGHFLEEACVNPTFIINHPEIMSPLAKW-HRSKQSLTERFELFVNKHELCNAYTELNDPVVQRQRFAEQGDDEAMDETFCMALEYGLPPTGGWGLGIDRLTMMLTDSQNIKEVLLFPAMKPQDEP 1564
275 0.000e+00UniRef50_A0A1G2MSA2 Lysine--tRNA ligase n=18 Tax=Parcubacteria group TaxID=1794811 RepID=A0A1G2MSA2_9BACT  ali  26  31.KRDYELKEVIEKFEKGSLSLVGRVMSLRPQGGLVFLNFSDGTGTFQALLRTGDTDEKLLTLFETVDIGDFLGFEGTLMKTKRGEPS--ILVSSWTMLAKSLRPLPEKWHGLQDVDE--RFRHRYLDLMNEGVRGRFLVRSRIISEVRRFYDSHGYIEVETPMLQPIAGGATARPFVTHHNDTDFYLTIAQELYLKQLLVGGVDKVYEIGRKFRNEGIDVT-HNPEFTMLESNESY-ADANSQMEFIETLMRSVAKALTATSEVTY---GADIIDFTKPFPRLKFYDLIERAKELGITFPPTEGDY-KLLDSIYKRTVRPKLIQPTFIVDYPVAFNPFAK-RKPEDSKLIDRFQLVAGGIELVNAFSELNNPLDQKERYEEQGDISPSDKNYLEAMEYGMPPNGGIGIGIDRLAMLFTDSKNIREVILFPTLRPK... 487
276 0.000e+00UniRef50_A0A0K1P4Q9 Lysine--tRNA ligase n=1 Tax=Spiroplasma turonicum TaxID=216946 RepID=A0A0K1P4Q9_9MOLU  ali  24  38..RTHMILNIIEEFDGNIISTAGRIRLFREAGKAIFANIQDQDALIQLYVREDEIGEENFIHFKDLDLGDIIGVKGIMMKTDHGELT--IRVKEYTLLTKALKPLPDKYAGIT--DIEEKYRRRYVDLINPETKEVFKKRSKVIRTIQSVLDEKGYMEVETPILHLIKAGGDAKPFVTHYNDTNFYLRIATELHLKRCIVGGFEGVYEIGRLFRNEGMST-RHNPEFTSIEIYVAYKE-LNFLMNICEEIFRTCALKVNGTTKVNYAGIDFDFSKPFKRWKKMTYDEAKKLADTHKLKYEKYHFSVGHIINLFFEHYVEDKIIEPTFIIGHPKEISPLSKLNKDDN-RFTDRFELFINKREYANAFAELNNPIDQYERFLDQAGDEEADIDFIEALEYGMPPTAGIGIGIDRLVMLLTNSDSIKDVLLFPQLRPR... 502
277 0.000e+00UniRef50_A0A2D6Q3S7 Lysine--tRNA ligase n=2 Tax=Bacteria candidate phyla TaxID=1783234 RepID=A0A2D6Q3S7_9BACT  ali  25  35...THKAQDIKKNL-GKKVVVAGRVWGWRKHGAFVFADIRDSSGQVQLWFQKEKLGKK-FDLLKLFDIGDFIDAKGHVVKTKAGE--VTVDVADVTLLSKGVRPLPSTWHSLEDV--EERYRRRYLDLMNPRVKEVFEKRSQIINSVRKFLEEKDYIEVETPVLQTIYGGGRARPFKTHHNDIDIYLRISTELYLKRLIAGGLEKVFEIAKVFRNEGMD-RSHNPEFTMLETMEAY-ADYMDNMDLIEEMFEYVVLKVFGKTKITYQGL---VLDFKRPWERIKLEDLFKEHTGVGIHEIDDFMTDGEILLEIFEKKCTDQLVQPTFVYDYPADFYPLAK-RKADNPKLVESFDIYVAGMEMGTNWSEQNDSQVLXXXXXXXXXXXXXDTDFLDMLEYGMPPTSGIGPGLDRWVMILTDSPSIRDVILFPTLRP.... 482
278 0.000e+00UniRef50_A0A2E5SUH2 Asparagine--tRNA ligase n=62 Tax=cellular organisms TaxID=131567 RepID=A0A2E5SUH2_9FLAO  ali  34  2..KTQWIGDVLSSLNQKEVHLKGWIHRSRGSNAIRFVVLRDSTGTLQCVVKRDKVGDASFEEVASALIESSLEIKGTAIPTDR-EHGYEIQVTEAKVVGPVDPPFPITESAMEEADTEFLLDNRHLYLRTGRMTTMLKIRSSVFGAIHSFFRDRDFIEYQAPNFVAGAVEGGSTLFEVPYFGRKAYLTQSWQLYAEAAMPA-LERLYTIAPSFRAEKSRTRRHLTEFWHAEMEIAWADN-NDVMDHGEALVRHIARTLLTERPAELESLGRDLEVIDSDYPRIRYDEAVERLKSKGVEIEWGQDLDYSKEKILTADFDV-----PHFLTHYPKVAKPFYHRQDPDNQDYVLCHDLLAPYGEIIGGGERTWSESEILKRIDDEGTPRDPYEFYIDIRRYGGVPHGGFGLGVDRVCAWLAGADHIRETIPFPRDSRRVTP 441
279 0.000e+00UniRef50_A0A2H6GZV7 Aspartate--tRNA(Asp/Asn) ligase n=25 Tax=Archaea TaxID=2157 RepID=A0A2H6GZV7_9ARCH  ali  43  1MENRILVKDAFKKK-GK-VDVAGWVHNTRDLNKIKFILLRDVSGIIQITGVKGKTPDKVFKDMSGITRESVIYVSGTIKDSKQAPGGKEINPDKIEIISKAE-DLPIDVSDYSKTELPKRLDYRFLDLHRQKTQAIFKIQSEICNSFREFFYKKSFIEMQPPCIISSASEGGTDLFPVKYFEKDAYLAQSPQLYKQM-VACSMGNTFMITPIWRAEKHNTTRHINEIRQMDIEIAF-ANQEIAMKEHEDVVKYIVGQVIKKCKDELKLLKVDLKIPKVKY--LSYDETVKSLK-----MKYGEDLSPEDERKLSN----KYPDTIVFVHSWPTKLKPFYIMPKKADAKLSEGFDAIYGGVEICSGGQRIHLPDLLEKMLKSKGLNPKNFKEYVDSFRYGAPHHAGWSLGLERLTEIICGLDNIREATMFPRDRDRLSP 424
280 0.000e+00UniRef50_A0A2M7UIH8 Aspartate--tRNA(Asp/Asn) ligase n=11 Tax=Bacteria candidate phyla TaxID=1783234 RepID=A0A2M7UIH8_9BACT  ali  39  1MLRT-LSSELN-KYFDQPVLLKGRVYNLRKMGAISFLVLQDRAGLAQVVFEKPV----------EVNIGAIIYIEGQAKKEERAPGGVEVRGEKLTVAADVAGEMPIDLSKKENVGLKTLLDNRPITLRHESVKAIFKIFSTVIRVYGEAMRQRDFMEIKTPKILGAASEGGANFFQIDYFGKKAFLAQSPQFYKQI-TCGVFERVFEVDPVFRAEPHFTTRHVNEYISLDAEMGFIDGYDDVLAMLGQVVSAIFKEIAENHEAELKIYNAVCPKVPDKIPQIKLADIKKIIKEKGYQIPADTDIDPKGERLAGQYAKEEYDSDFIALTHYPTNMRPFYTMPDEDNPEETKSFDLIFRGTEMVTGSQRIHQYDKLVANIKKFGLDPKDFSFYLQAFKYAMPPHGGWGMGLERIVYKLLGLKSIKEAVLFPRDVKRLTP 427
281 0.000e+00UniRef50_A0A067CT49 Lysine--tRNA ligase n=5 Tax=Saprolegniaceae TaxID=4764 RepID=A0A067CT49_SAPPC  ali  25  57...TMTVKDFIAKYDDVPVSLAGRITSIRASKKLIFLDICNDGHEVQVYANADDTSDKAFEHVHDLRRGDIIGVHGFPGKSGKGELS--IIPQHVSVLSPCLAPFPNSKYGLKE--IDIRFRQKYLDLLTNKVRGIFTTRAKVIQYIRRYLEDRDFIEVETPILCTAAGGAAANPFTTTALHTDLFLRIAPELYLKQLVIGGMDRVFEIGKVFRNEGVDQS-HNPEFTMCEFYQAY-ADYNTFMTTAEDMLSGLVQSVNGSYNVEW---NGQSIDFSPPFKRISILEGLEELGEPLPAMDDPEHTPARVIDCLIGEYLEPQCVNPTFLIHHPALLSPLAKA-HRDDPLVTERFELFVGGKELCNAYTELNDPDEQRERFATQTKDREKDEAFCHALEFGLPPTAGFGIGIDRLVMMLTGMPHIREVILFPTMKP.... 525
282 0.000e+00UniRef50_A0A1A7ZVP2 Lysine--tRNA ligase n=48 Tax=Bilateria TaxID=33213 RepID=A0A1A7ZVP2_NOTFU  ali  24  150....................VSGRVHAKRASGKLLFYDLRGEGVKLQVMANSRKTEKDFVAINNKLRRGDIIGVRGNPGKTKKGELS--IIPIEMTLLSPCLHMMPHLHFGLK--DKETRFRQRYLDLINDYVRQKFLTRSKIITYLRSFLDQLGFLEIETPMMNIIPGGAVAKPFVTYHNGMNLYMRIAPELYHKMLVVGGLDRVYEIGRQFRNEGIDLT-HNPEFTTCEFYMAY-ADYHDLMEITEKLLAGMVKHITGGYKVTYHPDGPEEIDFTPPFRRVSMTHDLEKIMGVKFPPTDPPRTTARLLDKLVGDFLEVTCISPTFICDHPQIMSPLAKW-HRSEKGLTERFELFVMKKEICNAYTELNDPIRQRELFEQQGDDEAMFETFCTALEYGLPPTAGWGMGIDRLTMFLTNSNNIKEVLLFPAMKP.... 597
283 0.000e+00UniRef50_A0A1M3BGJ5 Lysine--tRNA ligase n=4 Tax=Actinobacteria TaxID=201174 RepID=A0A1M3BGJ5_9ACTN  ali  24  43......IAAVRAEHEGSRHRVAGRITARRGHGKNAFIDLRDGSGQIQLHAREDLLGPEAYGLLVDLDIGDIVGVEGTALATRRG-GELSLALDHWRLLAKSLRPPPDKVHGLQ--DTETRFRRRELDLMNEESRRLFQARARTITEIRRWLDEHGYIEVETPVLQPLYGGALARPFTTHHNDRDFYLRIATELYLKRLIVGGIDRVYELGKDFRNEGV-SHKHNPEFTMLEWYEAY-ADYEKTAHDLERMVAEVVERTLGTTKVQ---RGDVEIDFAPPWRRITLRQAI--LERSGIDIADPKEGWGKLVDGLLSRDVEPGLIQPTFVLDYPVELSPFAKA-HRSEPGVVERWEAFVGGIEIANSFSELNDPDEQRRRFEQQGDDEAQDEAFVEALEQGMPPTGGVGLGIDRLVMMLTGAQSLREVLLFPAMRS.... 494
284 0.000e+00UniRef50_A0A1F5YFZ7 Lysine--tRNA ligase n=2 Tax=Candidatus Gottesmanbacteria TaxID=1752720 RepID=A0A1F5YFZ7_9BACT  ali  23  31.ERKDKIADAR-NRIGKEAKVIGRIIAYRHQGKIAFLDIIDGSGKIQTVLKADILDINLINLIPLIDIGDFIAVQGKVDKTASGEIS--VFAYNFQIIAKSVRPLPDKWYGLK--DIEERYRKRYLDMINADVSKRLEVRSKTVQAFRDFFNNKNYLEVETPTLQPVYGGGFARPFITHHNDADFYLRISDEMYLKRLIVGGFEKVYEITKVFRNEGVD-HEHNPEFTMFEAQIAY-EDYHYGMDIVEELLEYVTQNVLGKLKVIYQ---DKVLNFARPWKRYRLVEAVKKYAVLGNKISDEMRSLGEVMAFAFEVFVEKQLIQPTIIYDYPIEVSPLAKKC--EDPRFTQRFEMFVNGLEIGNNYTELNNPVDLKQRFIEEKKREEADYDYLEAIEHGFPPACGLGIGMDRVVMLLTNTPSIKEVIPFPTLKP.... 485
285 0.000e+00UniRef50_A0A1J5WM82 Asparaginyl-tRNA synthetase n=1 Tax=Amphiamblys sp. WSBS2006 TaxID=1866961 RepID=A0A1J5WM82_9MICR  ali  30  104......IRDLREE-ESSVVAVTGWVHRLRRQKNFVFVILRDGTGYLQCIFQGDICKT---REMGELMVESAITVYGAVKKVPEAPGGHELVGKYWQVVGMAPSEEAFETQLNEHASVDTAFSHRHLVHRGERTAAIMKTRAEALHAFRMHYRARGYVEMTPPCLVQTQCEGGSTLFHVKYFGEDAYLTQSSQLYLET-VCPAHGDVFCIQPSFRAEGSRTRRHVAEYTHVEGECVFI-DFEELLLRAEDLVCDTVERILGPGRAEVLKLNPEFTAPSRPFQRMDYSDAISWLRERDIKKEDGDFVFGDDIPEKPERVIVDTIGAPLFLTRFPAKMKAFYMSRDPKNPLVAEAFDLLPNVGEVIGGSMREPDYDALLERFREEGLPEERYYWYLDQRKYGTFPHGGYGLGFERFITWILGLHHIRETCMYPRYVGRCEP 536
286 0.000e+00UniRef50_W0RI37 Lysine--tRNA ligase n=44 Tax=Bacteria TaxID=2 RepID=W0RI37_9BACT  ali  25  47.ERTHTSADAITAFEGPTARLAGRLTAWRSQGKTAFAHLGDADGRVQLYFRRDVLGDDAFAMLQQLDIGDVVGVEGPMFRTRAGEAT--LRAERVQLLAKSLRPLPFAKEQIVDKDPEQRYRQRYADLVHPEVRRTFVARARMIAAIRQYLDGLGYLEVETPVLQPLYGGAAARPFTTHHNDMPLFLRIADELYLKRLIVGGFDRVYEIGHDFRNEGID-RTHNPEFTMLEFYEAY-ADYGVMMDRVERLIAA-----AAAAVRAVPGFAERVPELVPPFPRIQWDEALRNAAKRIGVERVETLSRPKVLDEMFQALVERHIDRPTFVLDYPVELSPLAK-PKRGNPALTERFELFAGGRELANAFSELNDPIDQRRRFEAQAGDEEADEDYLRAMEYGMPPTGGVGIGVDRLFMYLTDTAHIRDAILFPLMRP.... 520
287 0.000e+00UniRef50_A0A0K9P8U2 Lysine--tRNA ligase n=14 Tax=Tracheophyta TaxID=58023 RepID=A0A0K9P8U2_ZOSMR  ali  24  147.KKYASLKD-GEHLNDVEVKIAGRIMNKRNSSKLYFYDIYGDGVKLQVMARDSVLGEEFGDFHSSVKRGDIVGICGYPGKSKRGELS--IFPRTFIVLSHCLHMMPRQPEKYVLKDQETRYRQRYLDLLNNEVRHIFKTRAKIVSYIRRFLDNLNFLEVETPMMNMIAGGATAKPFVTHHNDMKLFMRIAPELYLKELVVGGLDRVYEIGKQFRNEGIDLT-HNPEFTTCEFYMAF-ADYNDLMDLTEQMLSGMVKELTGGYKIKYHANGVDEIDFTPPFRRIDMIEGLEALANLSIPKDPPPQTTARLLDKLVGHFLEETCVNPAFIINHPVIMSPLAKW-HRSKAFLTERFELFVNKHEVCNAYTELNDPLTQRERFTDQGDDEAMDESFCTALEYGLPPTGGWGMGIDRFAMMLTDSQNIKEVLLFPAMRP.... 640
288 0.000e+00UniRef50_A0A2H6A7K1 Lysine--tRNA ligase n=1 Tax=bacterium HR34 TaxID=2035429 RepID=A0A2H6A7K1_9BACT  ali  25  32....IRIREVLDNFEGEKIKIAGRILSRRWHGKIIFLTIDDNTDEIQVVLREDILGEENYNFLDNIEKDDIVEFLGEVMITKRGQKS--LLASSWRILTKAILPIPDRWYGLKDV--EERYRKRYLDLLNREVKENFILRSKIIKEIRKYLDEQGFIEVETPVLQPIYGGASARPFITDLFKMKLYLRISPELYLKRLIVGGFDKVYELGRVFRNEGID-RTHNPEFTSLEFYIAYC-DYKKLMDFTEQFIREVVKRSIGRTKIIYE---DKEIDFEKKWERLDYCELFEKAKELGVEIKKED-TEIEIIDELFKEVCLPKLQNPTFLINHPKGTFPLAKSRDDNGEYLA-SFQVFAGGMQLITAFSELNDPIEQEERLKEQGLDIAHDEDFIEALSYGMPPTAGFGLGIDRFVSLLTNSHAIKDVILFPFLRPR... 485
289 0.000e+00UniRef50_A0A2W1A7K5 Lysyl-tRNA synthetase, class 2 n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2W1A7K5_9CHLR  ali  24  30.KKHTKITEIRSNFINNQYVINGRVIAKRKMGKIAFIDIQDGSDVMQIQLSKEKLGT-IFEIINLIDLGDFISVNGSLFKTKTEELT--IGVEDIEIISKALRPPPEKWHGV--VDPEIRYRSRHLDLINKRSRQIAIAFSKTIQSIRNYLHSKDFIELQTPILQENAGGAAAKPFITHHNNQDLFLRISLELHLKRLLIGGFEKIFEIGKVFRNEGI-SYKHNPEFTLLESYEAY-ADYNDVAKMLKELIQFCAQEVVGNLEIK---NGDHIINLAGEWEKLTYIDAINKAKDLGIHISKNP-SRSIILDEIMKKFVEPKLIQPTFIFDYPTEISPLAK-KIDGNENFVERFELFILGYEFANAYSELNDPIDQRERMTEQAIDEEIDEDFVEALEYGMPPAGGLGVGIERLAMLLMGEHSIREIILFPAMRTK... 484
290 0.000e+00UniRef50_A0A1V5RTW6 Aspartate--tRNA(Asp/Asn) ligase n=163 Tax=root TaxID=1 RepID=A0A1V5RTW6_9CHLR  ali  36  1MQRIYTTE--VAAHVGEHVRVAGWLHALRRLGGINFLVLRDARGIVQAVLD----TPEALAALEGLLPETVLSVSGAAVAEPQAPGGVEIHGPTFEILSPVRDALPFPNKPEVKATLPIFLDHAVIGHRHPARRSVMRLQAGAMAGFRATLAGLGFTEIQTPKLVGSATEGGANVFTVDYFGRPAYLAQSPQFYKQI-MVGVFERVFEVGPVFRAEPHDTVRHINEYVSMDVEMGFIRDHRDVMAVLTQVVRGILGHLEAHYAPELAAVNAVLPAAPETFPAIYFPEAQELIHRHGEDCRGEPDLAPQHERWLGEWARQEYGSDFLFVTGYPMAKRPFYTHPNPADPAYSNSFDLLFRGTELVTGGQRLHLYQAYLDSAAARGYDLAPFETYFETFKYGMPPHGGFAIGLERFIMQLLGLDNVRLATLFPRDINRLAP 434
291 0.000e+00UniRef50_L0HJV4 Lysine--tRNA ligase n=1 Tax=Aciduliprofundum sp. (strain MAR08-339) TaxID=673860 RepID=L0HJV4_ACIS0  ali  24  31...TNYIEEISDKFMGKEVAVEGRLYALRFHGKLAFGDLRDNGEKIQGFFRQDVLGEEQYIFLKRVDRGDFLWIRGEVMRTKRGELS--ILAKEIRIAAKALYDLPHEWFGIGDV--EKRYRQRYLDLMNRQAFETFRKRSEIVKEIRRFLWDRGFLEMETPILQPVYGGANAKPFKTHVNDRDYYLRISDELYLKRLIVGGYNRVFEIGKDFRNEDIDTT-HNPEFTMIEIYQAYV-DYNDMMDLTEGMIKHVARHM----SVDKINFGGHEIDLTKPFRRERMDEDIKALLE-KYKIKMPQYNRGLALGKLFERVCEEDLIEPVFVIDHPKETTPLCKL-HRGNKNLIERFELYIGGVELANGYTELNDPQLQEHFFRDELGDEEADEDFIEALRWGMPPMGGVGIGIDRLAMILTGNTSIKEVILFPILAPK... 479
292 0.000e+00UniRef50_A0A1Z9IQC1 Lysine--tRNA ligase n=5 Tax=Bacteria TaxID=2 RepID=A0A1Z9IQC1_9BACT  ali  23  36...TKSIKEIKDNKDNETLSACGRIVSIRQLGKILFINIQSDFDRLQCYISNKNLDEEQYKLINNIDIGDIVGIKGQMFYTKTNE--YTLKCXVFTLLSKSIRPLPNLKQKEGESDKELRYRNRHLDFINPENKEIFVLRHQIINSFRDFLNKKSFIEAETPVLQPIYGGANARPFTTHHLNEKLYLRIAVELYLKRLIIGGFDKVYEISKNFRNEGMD-RSHNPEFTMLEFYQSY-SDVYGVMDLTENMIRSVANTISTSTI----SYDGNTIDFSKPFRQITLNELFEKLLSNEIKLRDEGYDMGKIIDKIFSLKIEPKLIQPTFVLDYPKILSPLSKIKRDQENDIVERFELFIGGMEIANAFSXLNDPIDQRERFTAQKGDEEADENFLEAIESGMPPTGGVGIGIDRVVMILTGNTSIKDVILFPAMRN.... 496
293 0.000e+00UniRef50_A0A1V6BW56 Lysine--tRNA ligase n=1 Tax=Spirochaetes bacterium ADurb.Bin133 TaxID=1852909 RepID=A0A1V6BW56_9SPIR  ali  25  30.ERTCNIAEARKLNVGNNINLAGRLVLKRSFGKLIFATIQDFYDRIQISLNKKNLDEENFKFFEKIDVGDFISVYGEIYRTEKGELT--LRVDKYELLSKSIRPLPEKFHGIT--DLESRSRQRYLDLMNPETRSRFLKRTKLINVIRKFLNDNDFVEVETPMLQVKPSGALAKPFKTHHNDIDMYLRIAPETYLKRLIAGGFDRVYDMGRCFRNEGID-PSHLQEFTMVEYYAAY-WNYIDNMNFTEKLIKQILLEVHGGLQLDYMGTK---IDFDGEWPRTSFRDLILRHADIDIDVDFNRIGRGNLIDQLYKKVARPKMINPQFLIHHPIDLSPLA-RRNDNEPLIADRFQLVVNGWEVVNAYSELIDPIDQRERLEREKGDEEAMEDFIICMEYGMPPISGFGMGIDRFVALLTNQENLREVVLFPLMRP.... 486
294 0.000e+00UniRef50_A0A0G2K7D7 Asparaginyl-tRNA synthetase 2, mitochondrial n=14 Tax=Euteleostomi TaxID=117571 RepID=A0A0G2K7D7_RAT  ali  28  41...............GECVTVQGWIRSVRSQKEVLFLHVNDGSSLLQVVADSSFDSRE-------LAFGSSVQVQGQLVKSQSKRQNVELKAEKIEVVGTCEAK-AFPIKYKERHPLEYLRQYPHLRCRTNALGSILRVRSEATAAIHSYFKDNGFMHIHTPVLTSNDCEGAGELFQVNFFDVPAFLTVSGQLHLEV-MSGAFTQVFTFGPTFRAENSQSRRHLAEFYMVEAEVSFVESLQDLMQVMEGLFKATTEMVLSHCPEDVELCHQF--------------------------IASGQKWGVDLQTEHEKYLVRHCGNIPVFVINYPSELKPFYMRENEDDPNTVAAVDLLVPGGELFGGSLREERYHVLEQRLARSGL-TKAYQWYLDLRKFGSVPHGGFGMGFERYLQCILGVDNIKDVIPFPRFTHSC.. 440
295 0.000e+00UniRef50_A6R6S0 Aspartyl-tRNA synthetase n=1 Tax=Ajellomyces capsulatus (strain NAm1 / WU24) TaxID=339724 RepID=A6R6S0_AJECN  ali  33  291........DLSEELCEKDVTVVARVDNARVQSKLAFLMLRQQGKKMQAVVSADEISRPMVKWIGGINVNSIVKVTAVVKKTSATVKHLELHIRKVYLVAQASHMLPMQVKDAERVTLKTRLDNRVLDLQTEASQAITWISSGVAQLFMEYMLKSGSRWISTPKLTANASEGGAGVFEVTYFKRKAYLAQSPQLYKQMCIAGDMESVFEIGPVFRAEESNTHRHLTEFVGLDFEKTFQSHYHEVLEFAEDLLVFVLSELKIRFKKEIEVIQRSYPK-AGDFRRLKYMEGVALLKEAGVDVRFENDLSTAMEKQLGRIIREKYDTDFYVLDKFPMAVRPFYTKPCPDDPTFSNSYDFFMRGEEIMSGAQRINEAKELEAAMSAKGLDPEGFEDYIGAFRQGCPPHAGGGLGLNRIVMFFLGLPNIRLATLFPRDPQRLRP 756
296 0.000e+00UniRef50_A0A1F4WQ27 Lysine--tRNA ligase n=2 Tax=candidate division WWE3 TaxID=422282 RepID=A0A1F4WQ27_9BACT  ali  24  33..RQHTISQVRKAKIGTKAVVAGRIMAWRGHGKIAFADLADQSAKIQILFQSDKLSAPNLKLLALLDIGDFIGVIGKTIKTQAGELTVE--AEDLVLLTKSIRPLPGKSGLD---NIEERYRKRYLDLINPEIRERFDRVSAILQSMRGFLLKEGYLEVVTPSLQPLYGGTLARPFVTHFNDADFYLRIANELYLKRLIVGGYEKIFEFSVDFRNEGIDTT-HNPEFLQMETMWAY-ANYRDNMAFAERMVSSIAKEVLGKTKIIYQG---QTIDLTPPWKRVRIVEAVEKAKKVGVNAA-GKKLKGEILEEIFDQRVKDKLFQPTIIHDYPRDISPLAK-PVKDNPDYTERFEVFIGGGELANSYSEANDPLLLRENFEEQTKLREADEDFLEAMEYGMPPTSGFGIGMERLFMLLTDTTSIREVMFFPALRPR... 482
297 0.000e+00UniRef50_A0A1J5J147 Lysine--tRNA ligase n=1 Tax=Candidatus Wirthbacteria bacterium CG2_30_54_11 TaxID=1817892 RepID=A0A1J5J147_9BACT  ali  23  36...THLIRDAVADFDEARITVAGRIRSLRSHGKSTFLHVEDFTGRMQAYLKEDILGKEMYSLLPLIDLSDFLEITGTLFVTKTGEKT--ILATSIRMLAKTIRPLPDEWYGLK--DKEVRFRKRYIDLQNPEVKKRFIIRAKVIQLIRDFLNEREFVEVETPVLQVLYGGTNAKPFNTHINDMPMYLRIATELYLKRLVVGGFDRVYEIGKDFRNEGVDQG-HNPEFTMIEWYQAY-ADYHVMMDTAEAMYKYIAKKLYGT---ESIPKDGETIDISGKWQRIPLDDQIDDLIEKHHIDVKGQRSRGQKIFGLFDKLVSPTLIDPVWIIDYPRDVSPLSKE-HRDDPTLVERFECYIGGREVGDGWSEITSAAEQLERFEEQNGDEDADHDFLEALDYGMPPLGGIGIGIDRLVMTYTDTDSIREIILFPTMKPQEAP 492
298 0.000e+00UniRef50_A0A163DM98 Aspartate-tRNA ligase n=1 Tax=Didymella rabiei TaxID=5454 RepID=A0A163DM98_DIDRA  ali  36  90...........ADHVEKEITFRCWVENARVQSKLAFLNLRQNLSTIQAVIAADKLSKQMVKFCGTVSTESTIVVTGLVKKAPESIQDFEIHIKKLFIEVKAEVPLPLQVDDAERASLNTRLNNRTLDLRAKINQSIFVVKSGVCAIFQEFLSKKGFTLVQTPKILGAASEGGANVFELKYFDRQAYLAQSPQFYKQMLIASRFQKVMEIGPVFRAENSNTARHLTEFTGLDLEMEFQEHYHEVMGVLEDLMLFIFKELNVRYKRETDLIRGHVDEFKLPVPRIPFTEGIKMLRDAGEELGDYDDLTTPQEKHLGRLVLEKYNSDFYVLDQFPLAIRPAYTMPSPHDPKLSNSYDMFMRGQEICSGAQRIHNSELLSKQMREHDIDPAGTKDYVDCFRYGCPPHAGGGFGLERIVQFWLGLPNIRMCSLFPRDPQRVVP 554
299 0.000e+00UniRef50_A0A0G1TQC9 Lysine--tRNA ligase n=2 Tax=Parcubacteria group TaxID=1794811 RepID=A0A0G1TQC9_9BACT  ali  22  29.KRSHSIKEVREQFGEETITVCGRIMAIRKHGGSTFFTVRDDAHNLQVYCKRDVIGQDAYTSLETLDGGDFLEITGTLFVTHAGEQTV-LAKIAPRIIAKALRPLPEKWHGLSDV--ETRYRKRYLDLMNESVRVVHERRTEISSLIRKFLEERGFTEVETPILQQIPGGATAQPFMTHLNDLDLYLRIAPELYLKRLLVGGFTKIFEIARCFRNEGID-HAHNPEFTNVELYQAYI-DYRDLMRLVEELMADLVSKLTGSLEFNFEKYHLDFEILGETIEHMT-DDSLRLLIEHGVELETADGYGAMLDKA-YKKLVRPNIIQPTFLIDHPIRLSPLAK-RHKDKPNRAERFQLVLGGGELVNGFSELNDPLDQRSRFDEQAGDKEADEDFLECLEYGMPPAAGLGLGLDRLAALLTNNHSLKEVILFPTLRPK... 486
300 0.000e+00UniRef50_A0A293NLE7 Lysine--tRNA ligase n=2 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A293NLE7_9GAMM  ali  24  62...................SVAGRIIRNRG----AFVVLQDSSAIIQLYVTK-----HAREFVKSLDLGDIIGAIGSLQRSNKG--DLFIQMDEWRLLTKSLRPLPDKFHGL--ADQELRYRQRYVDLINPKVRDTFRLRSEIITFLRGYLNAKSFLEVETPMLQVIPGGAVARPFVTHHNDIDMYLRVAPELYLKRLVVGGFERVYEINRNFRNEGLST-RHNPEFTMLEFYQAY-ADYLDAMNLTEDMLRNLTQSVLGSTQEETGGYRELVIDFGKPFARFSMFDSIVYYNSINPENLDDTWGLGKLQLEIFEKTVESQLEQPTFITQYPAEVSPLS-RRNDSDPSLTDRFELFIGGREIANGFSELNDAEDQADRFKQQRGDEEAMEDYIRALEYGMPPTVGEGIGIDRLVMILTDSSSIRDVLLFPHMRP.... 496
301 0.000e+00UniRef50_A0A0G0MEF6 Lysine--tRNA ligase n=4 Tax=Parcubacteria group TaxID=1794811 RepID=A0A0G0MEF6_9BACT  ali  23  31.KRTHSCEDALENFDKKEIVLTGRIISQRQHGGLVFCDIEDVSGKIQILLKKDGIGESSFQFFDNFDIGDFIEARGILFLTKKGEKTLE--TADYNMLTKSLLPLPEKWHGLQ--NIEERYRKRYLDLINPEVKKKFEVRSNIIKEIRYFLEYKGFLEVETPILQPIYGGASAKPFKTHLNDMDLYLRISPELYLKRLLVGGFEKIYEIGRCFRNEGVD-KAHNPDFSMLELYWAY-ADYKDLMKFIEEMIPCLVKKFFGGYKIKYEDKELDF---KPPFPRVEFGEIFKKYTGIDLDEINLEELKNEIADEIYKKYCRQKICQPTFIIHYPVSAFPLAKAL-DDNPRKSASFQLLAAGMELVKAFSELNNPIVQEERFREQGFEDAMDKDFIEALEYGMPSAAGLGMGVDRLVVLLTNSHSLREIILFPAMK..... 483
302 0.000e+00UniRef50_A0A256Z6P3 Lysine--tRNA ligase n=1 Tax=Desulfurococcales archaeon ex4484_42 TaxID=2012520 RepID=A0A256Z6P3_9CREN  ali  22  34......VKEVISNQVNSYVAVAGRIASIRRHGKLVFFDIIDDGYRIQAMINKATIGEERFEWFKYINLGDFINVFGELFYTKRGELT--INVRDYQLLTKALRSPPVKWGHRI-LDPEVRYRKRYLDLMTPQVRRILEIRFKTIEEIRKFMWDRGFIEVETPILQPVYGGAAARPFKTHILGEEWYLRISLELYLKRFIVAGFNKVFEIGKNFRNEDID-VLHNPEFTMMEAYEAY-ADYNKIMRLTEDLISTVAQKVLGTTKVRYKVNDEEVVDLSPPYKRIKLVEGLKEYAGIDVEVLSGGYDRGRAIVKLFDKLVREHLIKPTFVIDFPASSSPLTK-PHREDSRYAERFELYIAGIELANAYTELNDPVLQEEFFRKEEGDLEADWDFIEALEYGMPPTGGLGLGIDRLVMIFTGTNSIKEVIPFPMLKK.... 486
303 0.000e+00UniRef50_J7L7I8 Lysine--tRNA ligase n=26 Tax=Bacteria TaxID=2 RepID=J7L7I8_NOCAA  ali  24  40..RTASIGPVRDEHEGDKVAIAGRVMLYRTGGKLCFATLRDETGDVQIMLSLDQIGKERLDAWKDVDLGDHVGVEGEVITSRRGELS--ILVSSWTLTAKCLRPLPEKHKGLT--DPEARVRQRYVDLINPESQQMVRRRSAAIRAIREGLSDRDFIEVETPMLMRVHGGATARPFTTHINDMDLYLRIAPELSLKRLVVGGLEKVFEINRNFRNEGADST-HNPEFTMLEFYQAY-ADYNVMADVTRELIQNAALAAFGTTMVERDG---RTYDLGGEWPRITLIEEVRRLAEARDVEFDPAWGQGKLVEHIFEELVEHTLIQPTFVCDYPLETSPL-TRQHREDPLLTEKWDLIGFGMELGTGYSELVDPVEQRRRLTEQSLDPEAMEDFLRALEYGMPPTGGVGVGIDRLLMAFTG-KNIRETVLFPIVKPS... 498
304 0.000e+00UniRef50_A0A2H0EC23 Lysine--tRNA ligase n=14 Tax=Parcubacteria group TaxID=1794811 RepID=A0A2H0EC23_9BACT  ali  23  29.KRTILISEALKDFNKKQLFLTGRIKALRDQGNLIFIDLKDESGKIQAVLKADVLGKDNLNNFKNLDVGDFLSVSGPLFKTQKGEKSIE--VKTAEIITKSLRPLPTQWYGLKDV--EERYRKRYLDLINPEVKEKIISRSKIIETLRQDLAKEGFIEVETPMLQPLPGGALARPFITHHNNCDFYLRVAPELYLKRLLVAGFEKIYEIGRDFRNEGID-RDHNPEFTMFELYWAY-QDWEGLMKFTEKLLK---------------------KFIPGKWEKITFEAAL-----KKYAKKDIKKLRPEEIDEIFKKEVRPKIIKPTFVTHYPKFLSPFAK-PVEDNPDLTERFQLIVDGMEIVNGFSELNDPVDQRQRMEEQAGNQEADEDFLEALEYGMPPAAGWGVGIDRLAALVTKSHNVKEIIAFPTLKPR... 457
305 0.000e+00UniRef50_A0A1W4ZW38 asparagine--tRNA ligase, cytoplasmic n=24 Tax=Bilateria TaxID=33213 RepID=A0A1W4ZW38_9TELE  ali  30  131..........LEKYREQRVKVFGWVHRLRRQGKLLFIVLRDGTGFLQCVLTDKLC--QCYNGLV-LSTESTVALYGTVKPVPEGKQGHELQCDFWELVGLAPAGGAD-NLLNEESEVDVQLNNRHMMIRGENVSKILRVRSAVTQCFRDHFFSRGYCEITPPTLVQTQVEGGSTLFSLNYFGEQAYLTQSSQLYLETCIPA-LGDTFCIAQSYRAEQSRTRRHLAEYTHIEAECPFMT-FEDLLNRLEDLICDVVERVLKSPAPLLHDINPNFKPPKRPFKRMNYSEAIEWLKAHDIKKDDGYYEFGEDIPEAPERLMTDSINETILLCRFPANIKSFYMQRCPEDRRLTESVDVLMPVGEIVGGSMRIWDSKELLEGYQREGIDPTPYYWYTDQRIYGTCPHGGYGLGLERFLTWLLNRHHIRDVCLYPRFIQRCRP 559
306 0.000e+00UniRef50_A0A0G1NK93 Lysine--tRNA ligase n=33 Tax=Bacteria TaxID=2 RepID=A0A0G1NK93_9BACT  ali  25  44............KSPGKTVAVAGRLWRWREHGNVIFADLRDSSGQIQLLFQNKNL-ESQFDLLKLFDVGDFLAVSGTVIKTSAGEIT--IDVNKFELLSKSLRPLPDDWHGLKDV--EERYRKRYLDLLNPDIRRRFDVRTVVFKETRNYLDKLGFKEVETPVFHPLYGGANARPFTTHMLDTDFYLRIAFELYLKRLVAGGYDKVYEIGRDFRNEGID-HSHNPEFTMLEWYEAY-ADYHRVMDVTEGLFKHLAAKIFAKTQIQ---VGDKTVEIGHAWPRITMSDLLEFCQKHKLELVRGE-TKGQLIFEIFDKLVSKDLIKPTWVIDYPADVSPLSK-PHRTRPGWTERFEGYIGGREICDGWSELTDPQVQRQRFERKDKSEAQDEDFLEAMEYGMPPMGGIGIGMDRLVMFFTNTWSLKEVILFPTLRP.... 481
307 0.000e+00UniRef50_A0A0G0IR75 Lysine--tRNA ligase n=9 Tax=Bacteria candidate phyla TaxID=1783234 RepID=A0A0G0IR75_9BACT  ali  25  31..RKQTTAEAR-KMLGKKVAVAGRLRSLRPHGKITFADLEDATGKIQLFFSQNEL-PDKYDFLNNLDLGDFLQAEGEIFKTQAGEIT--IKVSSFQLLTKTLLPLPSSWYGLKDV--EERYRERYVDLINPEVKHVMEIRHKVIRFIRSFLENNGFVEVETPVLQPIYGGATAKPFLTKHNGANFYLRIADELYLKRLMVAGFEKIFEIAKDFRNEGID-RQHSPEFTMLEFYWAY-ADYEDLMRLTEEMISKLVKEIHGSYKFEYEKIDLDF---SPPFKRVTFNELIKKYCGIDLDIRDEDILRKEIEDELYKKMARSEVKQPTFIIDYPSEMKPLSK-RKEKDPGKSASFQLLSMDFELVNAYNELNDPLEQGARWKEEGLVEHQDADFIKALEYGMPPTAGFGMGIDRLVAILTDQHSLKDVILFPTLRPNLS. 483
308 0.000e+00UniRef50_A0A0G1GVF5 Lysine--tRNA ligase n=6 Tax=Parcubacteria group TaxID=1794811 RepID=A0A0G1GVF5_9BACT  ali  23  31.KRSHSIADALSSFDNKRMTLAGRVMAIRGQGALVFFNIQDGEATIQGFLKRDEMDETLFALFQDIDIGDFVECTGTLFMTKRKERT--MQVKEWKILSKSLRPLPDKWHGLQDV--EERFRKRYLDLMSEEVRARFKLRSKIITSLRTILNDADYMEVETPLLQSLAGGALAEPFKTHHNDIDLNLRIAPELYLKKLLVGGFPRVYEIGRNFRNEGIDMT-HNPEFTMLEFYASYETCASQ-MEFVEKLVKTLVKNVLKVSKIK---SGEDTIDVSKKFAVASFLDLFKRYASIGVKVEAHD-SIEKIMDNIYKKACRPKMIQPTFIINYPAGFSPFAKKQ-EKDPSLIDRFQLVIAGIEVVNAFSELNDPLEQKARYEEQDIKKKSDEDYLEAIEYGLPPAGGVGIGIDRVAMILSDTRNIREVVLFPTMRP.... 487
309 0.000e+00UniRef50_I0IP80 Lysine--tRNA ligase n=148 Tax=cellular organisms TaxID=131567 RepID=I0IP80_LEPFC  ali  25  71...................RIAGRVVLLRRFGKAFFATLQDNGDRFQIYVKKDRLPEGVFDIFDTLDMGDHLGIEGTFFKTKTGEPTLE--ASSLWFLGKSVHPLPEKWHGLS--DIETRYRQRYIDLINLPARQVFEDRSRILSLIRRFMDDRGFLEVETPMMHPSPGGALARPFVTHHNGTDLYLRIAPELYLKRLVVGGFTKVYEINRNFRNEG-FSPRHNPEFTMMEFYMAYH-SPEELMALTEALIPELCQKIRQKTTVQ---FGEHEIELMGPYRRISYTKLIECLKGAKIPIPPGKPYFADLQNALFEETIEKGLIQPTFVTGYPKAISPLA-RSSKDNPEITDRFELFIGGIEIANGFMELNDPDDQLARFERQAGDLEADLDYIRALEIGLPPTAGEGIGIDRLVMLLTEQTSIRDVLLFPQMKP.... 508
310 0.000e+00UniRef50_A0A2H9TEG7 Aspartate--tRNA ligase n=2 Tax=Archaea TaxID=2157 RepID=A0A2H9TEG7_9ARCH  ali  38  1MERT-LVKDLKS---GKEIILKGWVYEIRNLAKLGFILLRDRSGVVQCVLQNNLMDK-----LSDLSLESTVEIKGKTKEAKYARKELEVDVSSIEIISKAEQLPIHVNEKMTSTEFQNRLDYRFLDTRKFNISAIFKIRSSIYKNIVDFFDKEQFVIINTPKITTIGLESGAESFVVDYFGKKTVLAQSPQFYKQMFVNGGFERVMEIGQVYRAEKSHTTRHLTEFTGIDFEMGFIQDENDVMDVAEKMFKYSIEKIKYERKEELKLLNIDLKIPKK-IPRISMGELKEILTKKGKKLSEDDDLDAEAEKMIGEYVLEKYGEEFVFITRYPVKVRPFYHMRQDDNPKDTRSFDLLWRGVEVATGAQREHRLAILQKQAKEKGIKIPRI--YEDVFKFGVIPHGGVGLGLDRIAQRMLNLENIREGLLLTRDTGRVTP 430
311 0.000e+00UniRef50_A0A1X6MWJ4 Uncharacterized protein n=1 Tax=Postia placenta MAD-698-R-SB12 TaxID=670580 RepID=A0A1X6MWJ4_9APHY  ali  29  14....HTIRQLLDAHV--PVKIHGWVKSVRRQKNVAFAVVSDGSHDIQAVFPNAS-------QARSLTNGTSVRLEGRLLASPGKGQDKELRVDSVEVLGRSDPE--KYPIQKKELTVEYLREHCHLRPRTDAVASMLWLRHIVSNSIRGFFENNGFCYVHTPIITANDCEGAGETFRIEFFGHPAYLTVSSQLHLE-ALAASISRVYTLSPCFRAERSQTNRHLAEFWMLEAEWAFTQTVHDVCNVVEAAIKQVLDDAEGSNPWSERAAKLQAEIATRDWPRITYANAVEELQQATRAFHFEPAWGLPLQSEHERWLAENLAKGPVFVTDYPAELKPFYMRLNDDGKTVA-CFDLLMPGGELVGGSLREEREDHLSNAMRKHGLQTDQYDWYLDLRRYGSAPHGGFGLGFERLISWVGGIENIRECIAMPRWAGR... 465
312 0.000e+00UniRef50_A0A2H9MMY2 Aspartate--tRNA ligase n=10 Tax=Archaea TaxID=2157 RepID=A0A2H9MMY2_9ARCH  ali  40  5..............ENNQINLKGWVDTIRELGQIKFIIVRSQLEKYQVVIKKDS-SIDIREIVNNLNREDVVEIIGEKKGDERASGGFEIIPSKIKILAKSKDKLPIEFRDEIETEESKRFDWRFLDLRNPKKMAIFKIKQVFISTAREFLESEDFIEIHSPKIVGTGAEGGSEIFPIVYYSREAFLSQSPQLYKQLGLACGFEKVFEIGANYRAEKSHTTRHLTEYIGLDLELSFIESEDELMDLEEKMLKYCLEKVKEKCKKELKICEATIKIPKIPFPKIAISEAFKKLNISNTNKND---LSDSEEKELGKIIEKETGSQFVFVTKYPFSKRPFYTMKDEKDPTLTKSFDLLWKGLEITTGSQREHRHNILINQCKEKGVPTQSIATYLEAFKYGMPPEGGMGIGIERIIMQMLNLSNIREASFFPRTAERLEP 424
313 0.000e+00UniRef50_A0A2D6QDH4 Lysine--tRNA ligase n=7 Tax=cellular organisms TaxID=131567 RepID=A0A2D6QDH4_9ARCH  ali  25  42...THTSTQAVSAFEGVPVRIAGRVMSRRKMGKATFLHLQDRDGRIQAYCRKDAVGEEPYALMSLLDIGDFAGIAGTMFRTRTGEAT--VQVESWRFLAKAQRPLPEKWHGVR--DKEIRFRQRYLDLMNEEARVVFRARSRMISAMRRVLDAKDFLEVETPVLQPLYGGANARPFRTEHNGVTLYLRIADELYLKRCLVGGLDRVYEFGKDFRNEGMD-RTHQPEFTQLEAYQAY-GNYEDGMSLVEELVAAGAEAACGSTVVEW---GGRTLDFGRPWERVSYSEAIREACQAHGIEYEGDPTAAVMLDDLFSRIVQPELLDPTFVIDHPKLMSPLAKGK-PGSPHLVERYEPIVCGMEVGNGFSELNDPQEQRARFEDQLKDEDTMEPFLCALEHGMPPASGLGLGIDRLAMILSGADQIREVILFPQMRP.... 492
314 0.000e+00UniRef50_A0A2E0GK58 Lysine--tRNA ligase n=44 Tax=Bacteria TaxID=2 RepID=A0A2E0GK58_9ACTN  ali  24  10...TATTXEIRADYAGKSATIAGRLMLRRVQGKVAFGDLQDMSGRIQLFAPAKVTP--XFDSFTSLNIGDWIGVTGEIMKTKRGELS--VKVEQWXILASANRPXPDKWHGITX--PDLRYRQRYVDLVTEEARENFLXRSNMLSLTRRWLEAKNFXEVETPVFHPIPGGALARPFSTHHNDTELYLRIAPELYLKRLIVGGFERVFEIARVFRNEGI-SSXHNPEFTMLELYQAY-ADWNDIMELAESLIEHLAIELTGSALIXYDG---KEIDLTTPWRRATLXDLIEEHAGLDVSLDTPXWGAGKXLLEIXEXMVEPNXWGPCXVTEYPSEVSPLS-REXRXKPGYTERFXAIXAGREILNGFSELVDAQEQQKRFEEKAGDEEAMSDYVRALEYGLPPTGGIGIGIDRLVMLXADVQTIRDVILFPTLRP.... 464
315 0.000e+00UniRef50_M2XGA0 Lysine--tRNA ligase n=1 Tax=Galdieria sulphuraria TaxID=130081 RepID=M2XGA0_GALSU  ali  24  59..KTHNALELQTTYDGEQVTFAGRIKSKRTFGKLMFLTVEDDSGSIQLYVEQQTLKDSFRYIKSLVDIGDIVGVQGCIKRTDKGELS--IVVEDWQMLAKSLLSLPDKFHGL--MDVEKRYRLRHLDMIHPSVRQILKQRAQIVSTIREFLERKQFMEVETPALHCIAGGADASPFVTYHLDLQLTLRIATELFLKRCIVGGFEKVYEIGRVFRNEGIST-RHNPEFTSLELYEAYK-DYQDMMNLTEELIKTVANQVCGTTEI---VYMEERIQLGAPFRRVTMNELVKELGLDILSFPDIETAKSAVEKKMFEHYCEKLLIQPTFVLDYPIEISPLAK-QHRKDPRLTERFELYIAGRELANAFSELNDPIEQRERFMKQQVGKELDEDFLLALEQGMPPTGGMGMGIDRLVMLLTNSSSIRQVIAFPLLKP.... 518
316 0.000e+00UniRef50_A0A1C5U9G4 Aspartate--tRNA(Asp/Asn) ligase n=350 Tax=Bacteria TaxID=2 RepID=A0A1C5U9G4_9FIRM  ali  37  19.........LSESMKDQEATVEGAIHSIRNMGDVAFVILRKKEGLFQTVYENDKTNVSIHDLKEAM----CVRLTGTLHEEERAPHGRELRISHVEILSSPAEPLPLAIDKWKNTSLEAKLNYRPIALRNVQERAKFKIQEALVRAFRDYLYEKGFTEIHTPKIGARGAEGGANLFKLSYFHKPAVLAQSPQFYKQM-MVGIFDRVFETGPVFRAEKHNTKRHLNEYTSLDFEMGYINGFEDIMEMETGFLQYAVELLKKDYAHELSILKVELPKVDK-IPAVRFDKAKELVAEKKRKIRNPYDLEPEEEALIGRYFKEEYDADFVFVTHYPSKKRPFYAMDDPADEKFTLSFDLLFKGLEVTTGGQRIHDYQMLKDKIAARGMDEEGMEQYLDTFKHGMPPHGGLGIGLERLTMQILGEENVRETCLFPRDMNRLEP 443
317 0.000e+00UniRef50_A0A136M0K0 Aspartate--tRNA ligase n=1 Tax=candidate division WS6 bacterium OLB20 TaxID=1617426 RepID=A0A136M0K0_9BACT  ali  37  1MER-ILARDL-PAHTGEQVLVKGWLHTSRVLGKLAFLVLRDRSGLMQVVVE----DKALIDQLKTLQVGTVMTVAATVAANEKVQGGVELSAPAIEILSEVTEPMPLEIKEHIKAGLDTILDYRPLTLRHQQYQAIFRIQATLVQAYREFLISEGFTEFFGPNVIGASSEGGAELFEVNYFGERALLSQSAQLYKQM-MVGVYERVFALMKCFRAEKSNTRRHLTEATQFEFEMGFIENVSEVMDMLERVVKFMIARVAERHQDELKLLGAELVLAPGEFPRITFKEALQLFERTGVDERGENDLSPFAEKELCSFAREEYGTDFIFVSHFLRSKTAFYAHPNHEDPEVSNYFDLLCREIEIASGGQRIHEKEMLVESLELKGLNPDAFADYLSIFEFGMPPHGGFGMGMERFTMMALGLENIRMATLFPSDTKRI.. 433
318 0.000e+00UniRef50_A0A2E1X464 Lysine--tRNA ligase n=7 Tax=Bacteria TaxID=2 RepID=A0A2E1X464_9BACT  ali  23  30.QRSHTLEQAAVLEEGVTVRICGRIVSRRDFGKLSFFDLQDLNGRVQCSVQRDDLGKESYAAFSKLDIGDFVGVEGEMYRTRVGQLT--VRASSWQILGKTLRPMPEKFHAIS--DREILYRRRYLDLISPESRQRFRLRRDFISALRKGLDEAGFDEVETPVLQTKPSGALATPFETHHLDMPVYLRIAPETYLKRCVVAGFDRVYEFARVFRNEGMD-PSHLQDFTMLEYYAAY-WNYVDNMDFTEELLKRVIEKCTGSLQV---PHSAGEIDFSGPWPRLTLTELIEQYAKAGIEIDDADKLRGALIDLLYKKTVRPRITQPTFVTSHPVDLSPLA-RRNDDNSQISDRFQLVIHGWEVLNAYSELVDPIDQRARLEEQGDDEAMDEDYLLAMEHGMPPISGWGMGIDRMVALLSGAENLRDVVLFPLLKP.... 484
319 0.000e+00UniRef50_A0A2A3T9R3 Aspartate--tRNA(Asp/Asn) ligase n=1 Tax=Thaumarchaeota archaeon TaxID=2026795 RepID=A0A2A3T9R3_9ARCH  ali  43  9LRRSHYSNEITSSMDGTEVTVMGWVLTIRGHGNITFXTICDKNGEISIIAKKGDCXDEIREKISSLKAHSSIAVIGKVKSSEKAPNGFEIIPTELRVFSEVVKIPPFEPTVKTVKNIDTRLEVRPIDLRRKTLQNIFNARSSVLKSIRDYFTSQNFTEINTPKMIATATEGGAALFPIFYYNKEAFLAQSPQLYKEQLTMS-FEKVFEIAPIFRAEPSRTNRHLAEAISIDLEEAFI-DYNDVMNRIEEIIKISIKTVID-FAKDNSNVEFIIPEIPETIPRYSYDDLVDRMKKVGAKIEWGDDLYPSNLKKIG-------VDGFYFITDWPLGPKPFYVKDSKTNPKISESFDLMFGDLELSSGSTRIEKRDELVERMKNKGMKTDSFEYHLSAFDYGVPPHAGCGIGLERLMMALTGTENIRDVTFYPRDVDRLTP 436
320 0.000e+00UniRef50_A0A0M4EMA9 Aats-asn n=5 Tax=Holometabola TaxID=33392 RepID=A0A0M4EMA9_DROBS  ali  29  115....IRISD-GAEHRSKRVKINGWVHRLRRQGKLMFITLRDGSGFLQCVLNDQLC--QTYEAVV-LSTESSVTLFGTLQLVPDGPGGHELNVDYWELIGLA-PPGGADAILNEEAHPDVQLDNRHIMIRGENTSKVLKMRSVVMQAFRAHYFDRGYTEVTPPTLVQTQVEGGSTLFTLKYFGEDAYLTQSSQLYLETCLPA-LGDVFTIAQSYRAEQSRTRRHLAEYTHIEAECPFL-SFNDLLDRLEDLVTDVVDRVLKSFGHLVHELNPDFKPPKKPFRRMEYADAIKWLKEHNVTKEDGFYEFGEDIPEAPERKMTDTINEPILLIKFPLEIKSFYMSRCVEDQRLTESVDLLPNVGEIIGGSMRIFNNDELFKGYEREGIDPKPYYWYTDQRVYGTVPHGGYGLGLERFLCWLLNRYHIREVCLYPRFLERCKP 548
321 0.000e+00UniRef50_S6GLY8 Lysine--tRNA ligase n=6 Tax=Bacteria TaxID=2 RepID=S6GLY8_9GAMM  ali  24  37..RDSYAQDLFEEHGDKTVSIGGRVMLNRG----AFGVIQDMTGRIQFYVNK-----AARPFAKSLDLGDIIGVTGILHKS--GKGDLYVDLGEYQLLTKSLRPLPDKHKGLQ--DTEMRYRQRYVDLITNESRRVFEIRSKMVAGIRDFLVERRFVEAETPMLQVIPGGAAARPFITHHNGRDMYLRIAPELYLKRLVVGGIERVFEINRNFRNEGLST-RHNPEFTMLEFYQAY-ADYNDLMDLTEEMMRTLAQDVLGSTTVRYQEKDYD---LSQPFARISVFDSILHYKKLGVPLKNSYGL-GKIQIEIFEKTVEDNLDSPTFITEYPAEVSPLA-RRNDDNPFITDRFEFFVGGREVANGFSELNDSEDQAQRFKDQGDDEAMDEDYINALEYGLPPTAGEGIGIDRLGVFFSDCDSIRDVILFPAMRPK... 489
322 0.000e+00UniRef50_A0A182FQR6 Lysine--tRNA ligase n=1 Tax=Anopheles albimanus TaxID=7167 RepID=A0A182FQR6_ANOAL  ali  26  591...TISIGEFIEKYDGETLSVAGRVHAIRSSGKLIFYDLRGEGLKLQVMANAKQYESEFMEETAKIRRGDIIGVTGVPGKTKKGELS--VMPKRIKLLAPCLHMLPHLHYGLK--DKETRFRQRYLDLMNNNVRDIFIVRSKIISYVRRFFDQLGFLEVETPMMNMIAGGATAKPFITHHNDMDLFLRIAPELYLKMLTVGGLDRVYEIGRQFRNEGIDLT-HNPEFTTCEFYMAY-ADYNDIIEITQKLLSGMVYAIHGSYKIKYHPEGPEEIDFTPPFKRISMPEAVRFLDELCVKQEKPPRTAARLLDKLVGEYLEENCINPTFICDHPQIMSPLAKY-HRKLSGITERFELFVMKKEVCNAYTELNDPAVQRERFEQQGDDEAQDENFCTALEYGLPPTGGWGMGIDRFTMFLTDCNNIKEVLLFPAMKP.... 1064
323 0.000e+00UniRef50_A0A2P4N925 Aspartate--trna ligase, cytoplasmic n=3 Tax=Quercus suber TaxID=58331 RepID=A0A2P4N925_QUESU  ali  33  178.........LTPASIGQTIVFRARVHNLRKMSHLMFVELRQQTETIQILAENGGLSPHFLYWAEHLHVETVVRVKALVQEPKSKQGEIEVHVLELHVEAQPTEPLPFTVHEAEVSNEETRKENRIIDLRTTASQGIFRIQSGVCYAFRNNLSALGFIEIHTPKLQGAASESGASVFKVDYFGRPAFLAQSPQLGKQMAISGDMRRVFEIGPVFRAENSNTHRHLTEFTGLDLEMAIDEHYHEVLRVLDSTFKAIFKHIYDNYKSEIEVVKRQFPHEDLVWPIIPFAQGIRMLNEDGKPLPEDEDLGTRDEIALGRVIKEKLGTDYYVLDKFPASARPFYAMPDPSDPKLTNSFDIFLRGQEILSGGQRIHDAVMLEKKMESLKMNPKDMEEYMTGFEWGAPPHGGGGIGMERILMLLLKLGDIRHATMFPRDPRSL.. 638