current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 1bbu_A mol:protein length:504 PROTEIN (LYSYL-TRNA SYNTHETASE), from PDB1018

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500
# E-value Template Links and tools%idFirst SEQHAQGADAVVDLNNELKTRREKLANLREQGIAFPNDFRRDHTSDQLHAEFDGKENEELEALNIEVAVAGRMMTRRIMGKASFVTLQDVGGRIQLYVARDDLPEGVYNEQFKKWDLGDILGAKGKLFKTKTGELSIHCTELRLLTKALRPLPDKFHGLQDQEARYRQRYLDLISNDESRNTFKVRSQILSGIRQFMVNRGFMEVETPMMQVIPGGAAARPFITHHNALDLDMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYKDLIELTESLFRTLAQDILGKTEVTYGDVTLDFGKPFEKLTMREAIKKYRPETDMADLDNFDSAKAIAESIGIHVEKSWGLGRIVTEIFEEVAEAHLIQPTFITEYPAEVSPLARRNDVNPEITDRFEFFIGGREIGNGFSELNDAEDQAQRFLDQVAAKDAGDDEAMFYDEDYVTALEHGLPPTAGLGIGIDRMVMLFTNSHTIRDVILFPAMRPVKLast
1 0.000e+00UniRef50_Q2UKC4 Lysine--tRNA ligase n=7 Tax=Aspergillus TaxID=5052 RepID=Q2UKC4_ASPOR  ali  36  85...................................................................RLVGRIRTYRLAGKLIFFDIVQNGHKVQVMCNLRQLPPEAFKKLYRLLRRGDAFSVTGRPHRTGRGELTVVATELQLLSPCLHDVPLDA---KEHENSPYPRHVQFLADQTTTDIIKARSAIIQYLRQFFLDRSFMEVNTPIVNSIAGGAIARPFYTSATEFDRQLSLRIAPELWLKRLVVGGFDRVFEIGPSFRNEGIDKTHNPEFTTCEFYHAYANLEDLLSMTESLLSGMAQHIRDTNKDTLKPTEVDFSTPFRRIDFLTGIEEKIGLPDLTSPDAVAQVKQLFKDLSLEIPEAPTLPRLLDELCSIYVEPECVNPTFIINPPECLSPLSKIHPTGQRVAARGELFIEGKEVVNTYEEENSPSEQRRKFEDQVRYSKDAD-ESSEIDESYLEALEWGLPATGGWGCGIDRLCMLFTGAKRIADVLPFGTLR... 526
2 0.000e+00UniRef50_A0A1Y5MUF1 Lysine--tRNA ligase (Fragment) n=1 Tax=Campylobacter concisus TaxID=199 RepID=A0A1Y5MUF1_9PROT  ali  43  5..............NQHEIQRLQSIDELRNLGIPYPHFLRRDMNISKFRLKFNYIDTEEKKAEGQLVGLAGRIKLIRDAGKAVFANIEDEDGNLQIYFSNKTLDPEWFKIVKKYVEIGDIVYVRGYAFITRTGEFSMHVSELSLASKSISPLPEKYHGLVDVETRYRQRYLDMIMNPEVRADFKRRSVIISTIRRFFEEKGFLEVETPMLHPIAGGANAKPFITFHNALGVERYLRIAPELYLKRLIVGGFEAVYEMNRNFRNEGMDLTHNPEFTSIEFYWAYHNYHDLMGITEDLFNVILDKLDMEKVVNFDGMEIDFSKPFKRISYKKALVEIGGLDENIINDKDKILVKL-RADGLEANEKLDLGHLQAELFDNYVESKLIHPTFVIEYPISISPLSRR...................................................................................................... 393
3 0.000e+00UniRef50_A0A2J6KZW7 Uncharacterized protein n=1 Tax=Lactuca sativa TaxID=4236 RepID=A0A2J6KZW7_LACSA  ali  46  23..........................................................................................................................................................DAYVLKDQETRYRQRPLDLMVNSEVRFIFDTRAKIVEYITSFLKNLDFMEVETPMLNMVAGGAAARPFVTHHNDLDMRLFMRISPELYLKKLVVGGHDRVYEIGKQFRNEGIDLTHNPEFTTCEFYMAYADYYDLMEITEQLLS--------------DPIEIDFTPPFRRIDMIGELEKMANLNIPKDLASDEALADACAKFEIKCPPPQTTARLLDKLVGHFLEETCVDPCFIMDHPEIMSPLAKCHRSKPGLTERFELFINKHELANAYTELNDPVD-----------RQSGDEEAMALDEAFCTALEYGLPPTGGWGLGVDRLTMLLTDSLNIKEVILFPTMKPQ. 349
4 0.000e+00UniRef50_A0A126UZR9 Uncharacterized protein n=1 Tax=Halocynthiibacter arcticus TaxID=1579316 RepID=A0A126UZR9_9RHOB  ali  34  9..............DDDRQSRLANRQALEAMGIDFPAKYRPTHKVRDLEILYH--EHAELAETDRPVRVAGRLTALRHVGGIWFADLMQEHAIIQLRVKIDDVSL-VFWGMLPHLDVNDIVGIEGTLTRTSRGQTTISVKTLQVLCKALASDGTRHGARADRGALLRHRHVDLMTNSVLTENLRAHATVLSVFRRIMEQEGFLELQTSILGPYFGGAAATPFTTQAKGSGQELYLRVSPEPDLKRALAGGLEKVYEIGRNFRNEGIDHTHQPSFMAFECYAAWQDYEDMMELTERLVGAAVKEIWGQFRVRLNDALIDFERPWPRFRMLDLVARELNLAACDTLTALKDAWQERNPGADLAEQPSSWGELLTAIFEDHVEDSLVGPCFVIDHPVETSPLTKVHRDDRRLTERFEAYIGGMEIANAYSELNDPLEQRKRLEGQDLVR----DEPYGVDEYFLSAIDDGMPQAGGLGIGLDRIVMVITGTKRISDVVPFPL..... 500
5 0.000e+00UniRef50_Q6MUS9 Related to lysyl-tRNA synthetase (Lysine--tRNA ligase) n=8 Tax=Sordariales TaxID=5139 RepID=Q6MUS9_NEUCS  ali  36  52..........................................MRIPTFREKFKDVEMG--KHADEEVIIHGRVQSVRRAGKLMFLDLKGEFEHVQGLCNFNKVELGEFKALAKLLNRGDIVSITGRATKTPTGELSIEATRLELLTPALAPLPFK---LEDEEVRIQHRHIDMLVNRKTIDTLRLRSHLIKYLRDFFHERGFLEFQTPILAENASGATARPFTVTATSVNKNLAMRIAPELWLKRLVVGGVDKVFELGPAFRNEGIDQTHNPEFSMCEFYNAYANLDDLITLTEELICGAASHCRDLIATKLDSLPAIYQRPFQQLEFIPALESALGLPDLSASSSREDLLALLKQHKIEVPPDITLAKLLDNLASEFLEPYLTKPLFITHHPVCMSPLSKCPKTGQHVSARTELFINGKELANMYEEENDPASQRQKFVDQLNAAKREGESAMEVDESYVQALESGLPPTGGWGCGIERMVMLFSGTKRISDCLSFGNLR... 539
6 0.000e+00UniRef50_U4L8L8 Similar to Lysine--tRNA ligase, mitochondrial acc. no. O74858 n=1 Tax=Pyronema omphalodes (strain CBS 100304) TaxID=1076935 RepID=U4L  ali  33  60...............................GELYPRLEDDTSKIKNFHATYSSKIQSQDRDLRTTVTIRGRIRKCRDSPKLIFYDIIQDGIKVQAVFSHVAVGEEDFYVFNTALRNGDIIEVTGNPGRTKTGELSVYAVQLKLLSPCYHQVPD---ALANPEKIKQHRHLDLLVNEKSSQTLRLRSMILNQIRQTLSLQDFTEVQTPILSASAGGAIANPFLTAASAVHKPLALRIAPELWLKRLLVGGLDRVYEMGPVFRNEGIDNTHNPEFTTAEAYISFGNLEDVCRLTETVLRDVAKKFHELEPLDNDIQDAFLYPPYNRIEFIPTLEAKLGEPDLDAEDTEIKLRELCERHKIYVDKSANSAKILDKMAEKYLEPMCYLPTFITHHPQVMSPLAKGSRNGRKVSERVELFVRHMELVNAYEEENSPHEQRRKFQLQAKDEGREMEEGEGTDEDYCQTLEWGLPPTAGWGIGVDRVVMLMAGQDRIHDVIAFGGLR... 547
7 0.000e+00UniRef50_A0A0L0VE14 Uncharacterized protein n=3 Tax=Puccinia striiformis TaxID=27350 RepID=A0A0L0VE14_9BASI  ali  32  47....AASPEEELSPNQYYESRCQAIQALREANSPYPHKFHVSTSIPNIIKTFTDQNPGDRLDSQDQISLAGRIHNMRQAGT----KLSDSTE------------PDKFEAVHDIFRRGDIIGVTGFASRTKKGELSISPQRMILLSPNPHQLPRAETGFKDQEPRHRKRYLDLIMNKEVRDVFITRAKV----------------ETPMKNMIAGGATAKQFITHHNSLGLDFFLQIAPELYLKELVVGGLDRVYEIGRVFRNE------------------------SIDLTHALIKLNII-LKVRILLKLSTFELNFSTPWKRFNMIEELEAQLGKDFNDKVELTKFLDDLCVKHNVDCPAPRTNSRSLDKLAGEYIENQCISPRFIVGHPQFMSHSAKRDRSKPGLCERFEAFVATKEICNTYTELNDPFDQRERFEEQTRQKAAGDDKGL-MKLLLIDALEHGFPPTGGWGLGIDRLVMLLTDSNSLKEVLCFPANKPL. 522
8 0.000e+00UniRef50_X0SEF7 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X0SEF7_9ZZZZ  ali  44  1............................................................................................................................................ELILLAPCLHLMP---YVLKDPEVRFRKRHLDFLVNQENLRNLKLGSKINKYIRDFLDDKDFIEVETPMMNMIAGGAAAKPFQTYHNDMKMDLYMRIAPELYLKQLIVGGLERVYELGRQFRNETCDVTHNAEFTSLEFYMTHSDYQDLMNMVEELLSGLVFNLFKKYSLKYGKETINFEPPYKRVNIIPTLEKIMKKEIPTPDETREFLDKYCEDNNIECSNPKTTARLFDKLIGHYLEVNCQNPTFLVGHPAIMSPLAKENPDNPEITDRFELFAAGFEISNAFSELNDPVEQLRRFQLQTKDKNEGDDEIPDVDTDYCQALEYALPPTAGCGIGIDRLKMLLTNNQTIREILAFPMMKPL. 371
9 0.000e+00UniRef50_A0A0L8FN04 Uncharacterized protein (Fragment) n=1 Tax=Octopus bimaculoides TaxID=37653 RepID=A0A0L8FN04_OCTBM  ali  41  38SEKQNKTDDDDIDPNEYFRIRTKAVEQLKVSGNPYPHKFHVSLSLNTFIEKYSDVEPG-SVMEDVEVSVAGKV---------------------------YYRSEDEFLSTNEKVKRGDMVGVRGYPGKTKKGELSIIPIEMVLLSPCLHQLPHLYYGVKNQETRYRQRYLDLIINNEVKQKFVTRTKIISFIRNFLDQNGFLEVETPMMSMIPGGATAKPFVTHHNELKLDLFMRIAPELYLKMLVVGGMDRVYEMGRQFRNEGIDMTHNPEFTTCEFYMAYADYKDLMKLTETMLSKSRQ----------------------------------------------FFDDLCKKKNVECPTPRTTARLLDKLVGEFLEETCLNPTFIIDHPEIMSPLAKWHRSVKGLTERFELFVMKKEICNAYTELNDPVVQRERFMQQAQ............................................................ 411
10 0.000e+00UniRef50_Q6ZTI3 cDNA FLJ44621 fis, clone BRACE2016896, highly similar to Lysyl-tRNA synthetase n=3 Tax=Amniota TaxID=32524 RepID=Q6ZTI3_HUMAN  ali  50  87...........................................................................................................................................................HFGLKDKETRYRQRYLDLILNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPEGAVAKPFITYHNELDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKMVSGMV--------------------------------KLPETNLFETEETRKILDDICVAKAVECPPPRTTARLLDKLVGEFLEVTCINPTFICDHPQIMSPLAKWHRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKAKAAGDDEAMFIDENFCTALEYGLPPTAGWGMGIDRVAMFLTDSNNIKEVLLFPAMKPE. 402
11 0.000e+00UniRef50_M3S0K8 Lysine--tRNA ligase, putative n=2 Tax=Entamoeba histolytica HM-1:IMSS TaxID=294381 RepID=M3S0K8_ENTHI  ali  37  4...............QLFLNRCKDVEEYQKAGNPWPHKFNVSITVPEFIAKYSGLEKSQVS--DDIVSVAGRVLSKRSSSSLMFIDLHDSQTKLQIMLNKSYENKEDFVSLTKMIYRGDICGFTGHPTRTKTGELSLIPISGMILSPCLHMLPSMHYGLGDQETRFRKRYLDLIVNPESVKNFVLRTKVVKAVRKYLDDKGFLEVETPILNTIPGGATARPFITHHNQLDIQMYMRIAPELYLKELVVGGINRVYEIGRLFRNEGIDQTHNPEFYMAEPIPRPFNSAECSKVIEKHCTELNYYYDGNNEVTEKKMVLDFTAPFKRISYVHALEEKFGEKIPRPLDGPEFLKKQAIRFNAICAEPQTTARVMDKLFGDLIEVDLVQPTFVCDQPQLMSPLAKYHRSEPELTERFELFILKREIANAYTELNNPIVQRSNFEQQAKDKAAGDDEAQLEDGDL............................................ 519
12 0.000e+00UniRef50_A0A1G2HL44 Lysine--tRNA ligase (Fragment) n=3 Tax=Parcubacteria group TaxID=1794811 RepID=A0A1G2HL44_9BACT  ali  42  1..................................................................................................................................................................ELRYRTREVDLLMNPEVKEIFKKRSLLINSIREFLDENDFMEVEVPILQLTPGGASATPFVTHLNAWNLDVALRIAPEIYLKRLLVGGFDKVYEMGRNFRNEGVDYTHNPEFTMLEFYWAYSDYKEGMKFTEKLLQYIVKKVSGKLVIEYEGKKVDFSKSFQRIEFNELLRKYANIKYEDYD--FEGLLKKAKELGVKIDKKFSKEEVADSIHKKICQPKLVQPTFVIHHPIEMKPLAKPLETNPAYAANVQLIVAGLELVNAYSELNDPVVQKENFGQQMQLRKKGNKEAQPFDKEFLEALEYGMPPAFGFGMGIDRLTVLLTNSHSLREVILFPTMKP.. 339
13 0.000e+00UniRef50_A0A287N0V6 Lysine--tRNA ligase n=6 Tax=Mesangiospermae TaxID=1437183 RepID=A0A287N0V6_HORVV  ali  39  2........................LDSLRSAGDPYPHKFEVAISVADYVAKYSNLGAGEHLLTVTE-SLAGRVMSKRSSSKLFFYDLYGDGVKVQVMVSSSEVAETEFYKCHSVVKRGDIVGIVGYPGRSGRGELSIFARNLILLSPCLHMLPNQRTGLKDQETRYRQRYLDLMVNHQVRHIFRTRSKIISFIRKFLDERNFLEVETPMMNLIPGGASAKPFVTHHNELNMDLYMRIAPELHLKELVVGGLDRVYEIGKQFRNEGFDLTHSPEFTGCEFYMAYADYNDLMELTETILSGMVMELTGSTKIKYHPIEIDFTPPYRRIDMMHELKSVAGLDIPLDLSSDEALAATCEKYGIKCSPPQTTARLLDKITGHFLEATCVNPTFIINHPEIMSPLAKWHRTQSGLTERFELFINKHEVDSA............................................................................... 446
14 0.000e+00UniRef50_A0A1E9Q532 Lysine--tRNA ligase n=10 Tax=Corynebacterium TaxID=1716 RepID=A0A1E9Q532_9CORY  ali  34  576...........QTASEQAAVRIKKAMALRESGMPWPVADPIAVTVVRCAEVAEGQGNGSDAHRGGPLRVSGRIVAKRDFGGVTFFELRDASGTCQLLV---EAPGEQLAWKIRALDLGDLVAATGVRGESRTGEPSLLVDDITMEAKDLHPLQRRGAGIGEVNQRLR-----------------ARSVVNAAIRSTLDGLGYMEVETPILQRVHGGANARPFKTRSNAANQDLYLRIAPELYLKRLLTQGAEKVYELGRVFRNEGVDATHNPEFTTVEAYAAHGDYESMRLVAQKIIQAAATAYYGEPVVMDPGKLVSIAEDFPVKTVYGAISERLGQSI-TPETDFEQLLALCADRDIAVQPGWDAGEVVQEMYEQLVECTTTTTPTFYDFPTSVSPLTRQHRSQPGVAERWDLVAWGVELGTAYSELTDPLEQRDRLEAQSLKAAGGDPEAMEVDEAFLRALENGMPPTGGLGLGVDRLIMLLTG-RSIREVLSFPA..... 1048
15 0.000e+00UniRef50_A0A078BBS7 Lysine--tRNA ligase n=1 Tax=Stylonychia lemnae TaxID=5949 RepID=A0A078BBS7_STYLE  ali  35  4.................................PY---FALSHSIIEIQNQYSQIDLTNEHFKTVNIQTGGRIIGRRKSGNLLFLDLQSNGNNIQIMLDSSKMQEESFKDIAEACQRGAIVGIQGYPGRTNAGEFTIIAQKFNLLTPCNVNMPSHKKTLKDSEQRFQKRYLDLIANNELKQFFVTRARIVKFLRRYLEDLEFLEVETPILNAQAGGALAKPFETESQILRQKLELRIAPELFLKKLIIGGFERVYELGKVFRNEGIDATHNPEFTSLEFYMAYADYRDLITLTEDLLSKLSKELYGTDHVETKVLEINFKGPYKQFDVCS----ELGLDPALLGKSAQELRKFLLPKVYGIPDSLNEKQLIDKLIEYHIESKCLQPSFITNHPMIMSPLAKTHDSAQYLSERFELFINKKEIINSYSEQNDSEMQRKGFSLQTTMGDEGDEELHRSDEDFLEALSYGMPPTAGWGCGIDRLCMLMCGISHIREIILFPMFR... 514
16 0.000e+00UniRef50_UPI0007AD7FAC lysine--tRNA ligase isoform X4 n=3 Tax=Eukaryota TaxID=2759 RepID=UPI0007AD7FAC  ali  39  65SEDNIGTDEESLDPNQYYKIRSHAVQQLKSSEDPYPHKFHVDLSLSDFIDKYSHLQPGD-HLTNITVRVAGRIHAKRAAGKLIFYDLRGEGVKLQVMANSSYKSEEEYLRVNSKLRRGDIIGVEGNPGKTRKGELSIIPYEITLLSPCLHMLPHLHFGLKDKETRYRQRYLDLILNDYVRQKFITRAKIITYLRSFLDELGFLEVETPMMNVIPGGAVAKPFITYHNELDMNLYMRIAPELYHKMLVVGGLDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKLLSGMVKHITGSYKITYHPDEIDFTPPFRRISMVYDLEKVLGVKFFETEETRRFFDNLCVERNVECPPPRTTARLLDKLVGEFLEFTCINPTFCFCFPS.............................................................................................................. 473
17 0.000e+00UniRef50_A0A2T9ZG49 Lysine--tRNA ligase n=2 Tax=Smittium TaxID=4888 RepID=A0A2T9ZG49_9FUNG  ali  35  30.....KSTISTDDKRKIKQIRLNEIQT--NNLVPFPYRKPKSIDIPELIEKFQHLEPGE-KLENQLFYIEGRIKAKRSSSKLYFYTLYKNGNVFQIVANLRELQAKEFKKVNRFLQVGDIIRVTGYIGKTNTGELSIFATQLELLSTCFATIPYS-SGLEVHETRYRNRHVDFLTNPEARRSIVARAQVLSVIRNFFDSRGFLEVETPILWPSLGGANAKPFTTKAVALDAKMFLRIAPELFLKRLVIGGFDRVYEIGKVFRNEGIDRNHNPEFTSCEFYQAYTNVEEMMDNTELLIREIVAKLNNDSLIKDTPLVIDFSLPFKRINVVEFLSEKLDFDFLAFDEFNENLLKIFEKHNISHSNPKTPTKLFDNLISIYIEPLTSMPTFLTDHPFVMSPLAKSK--NSLSAARFELFINKQEIVNAYEELNNPDEQRFRFYGQLSDIKKGDPEAVLPDLDYCNALEFALPPTAGWGMGIDRLVSLLTNLPHLKESISFPIVK... 606
18 0.000e+00UniRef50_J9IEN6 LysyltRNA synthetase putative n=1 Tax=Oxytricha trifallax TaxID=1172189 RepID=J9IEN6_9SPIT  ali  33  55.................................PY---FAISDSITQIKQQYQTQDLTSEHFKTLKIQTGGRIIGRRKASKLIFLDIQSNGQNIQIMLDKNQMPEYEFKDIVDACQRGAIVGIQGYPGRTAAGEFTIIATSFSLLAPCNINMPSHKKTLKDSESRFQKRYLDLMANNDLKTFFFKRSQIIKFMRNYLEERGFLEVETPILNGQAGGALAKPFETESQVLRQKLELRIAPELFLKKLIIGGFDRVYELGKVFRNEGIDGTHNPEFTSLEFYMAYADYRDLITMTEDMLREGA----GQEVHDVKTLEMNFKGPYKQYDVCD----ELGIDPLNLPTLRKHLIPKVFQLNEKDPLKLNDKQLIDKLIEHHIESKCIQPSFITNHPMIMSPLAKTHPGAEFLSERFELFVNKKEVINSYSEQNDTDMQRKGFSFQTTMGQEGDEELHRSDEDFLEALSYGMPPTAGWGCGIDRLCMLMLGLNQIREVILFPMFR... 546
19 0.000e+00UniRef50_A0A2V8SNM3 Uncharacterized protein n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8SNM3_9BACT  ali  53  3......................................................................................................................................................PMPDKMHGIADPEIRQRQRYADLIASSTTREVFETRARVISSLRRCLEDKGYIEVETPMLTPKATGAAAKPFETHHNALDMTLYARIAPELYLKRLVVGGFEKVYELNRNFRNEGISYKHNPEFTMLEFYCAYMDVNGMMDFCEELLRESVRNATGHSKVMYEGNKIDFST-FEKITMREAILKY--------------------KPDAQIDDSTMIG-----LFDEFVEHNLIQPTFIIDFPKSISPLSKASPENPNIAERFELFINGMEVANGFSELNDPKEQYERFVDQMSERERGDEEAMVLDEDYIRALSYGMPPAAGIGIGIDRLVMLLTNKHSIRDVILFPHLRPER 338
20 0.000e+00UniRef50_A0A093VA37 Lysine--tRNA ligase n=6 Tax=Eurotiales TaxID=5042 RepID=A0A093VA37_TALMA  ali  35  61.................FDSRVKEIQA--AVPNPYPESNANRLSIEEFRARYDYLEPNQVVEEDEV-VVQGRIRTARLAGKLIFFDLVQNDHKIQGMWMSADVTPEKFKVIYRLLRRGDALSITGKPHRTGRGELTIKVTEIPILSPSLHDIPTKEHGISG-----YPRHVQFLADKRTSDIMRIRSAIIQYIRQFFVERAFMEVNTPIMASEAGGATARPFVTTANEFDKSLYLRIAPELWLKRLVIGGFDKVFEIGASFRNEGIDKSHNPEFTTCEFYMAYANLEDVMSMTESLFSGLAEHVTQHKESEIPTPNTNFSAPFRRIDFIPGIEQAIPLPDLSSPTAEEDVKQLFADLSIPLPDLPTLPRLMDKLCSTYLEPQCIEPTFITHPPECLSPLSKSLQNNQRVAARCELFIEGREYVNAYEEENSPWEQRQKFEQQ-KIFNQHTNESTGVDESYLQAMEWGLPPTGGWGCGIDRLVMLFTDSKRIGDVLPF....... 547
21 0.000e+00UniRef50_V7AF28 Lysine--tRNA ligase n=5 Tax=Mesangiospermae TaxID=1437183 RepID=V7AF28_PHAVU  ali  40  59..........TSDRDAIRAIRLKKVEELRSKGDPYAYEWDKTHGASQLQDIYKDLANGEEKNSEDHVSVAGRIVAWRDFGKLAFLTLIDDYGSIQLYFDKERLINDQFEQLKAYVDTGDILGVKGTIKRTKKGELSVCVLSFAILTKSLLPLPDKYHGLTDKDKRYRQRYLDMTANPEVKDVLRKRGKVESEIRRTMDSLGFLEVKTPVLQGAAGGAEARSFITYHNSLGRDLYLRIATELHLKRMLVGGFEKVYEMGPIFRNEGISTRHNPEFTTIEMYEAYSDYQSMMSLAEEIVTRCALAVHGKLTVDYQGVEICLEKPWRRETMHNLVKEIAWVDFSEFGDDLEVAKRVTQKDKASIEACRSIGHLLNEVFEIFVEPKLIQPTFVLDYPIEISPLAKPHRRGDAW............................................................................................... 468
22 0.000e+00UniRef50_A0A2V1B806 Lysyl-tRNA synthetase n=1 Tax=Cadophora sp. DSE1049 TaxID=1485229 RepID=A0A2V1B806_9HELO  ali  32  39STRKKSQEEARLKKNKVVQGRIEELQNATRLEWPRITSNPHAMTLLDYTVKYRDLKPSELRKS-VYVMLRGRVLSCRASSALVFLDIVQDGTTVQMVADLSRIDKRSFKAFYRLIRRGDIISVYGHPYVTQRGELSLNAIEIQILSPSLASLPR---TLEDRETRVRNRHVDMLVNSSVAETLRLRSHIIQNIRDFLLKNNFLEVQTPLIADKAGGAIAKPFTTVATEFDKQLALRIAPEIWLKRLVIGGMDRVFEIGPAFRNEGLDATHNPEFTTCEFYRAFTDLEELMRMTESMLSSIATRVDELRKSTLGPPLEDFLKPFQRLEFIPTIEAALSLPNLSSPTAEADLTALFEKHSLPLPHSPTLPRLLDKLSSIYIEPSCTTPTFITHHPSCMAPLSKSFPTSQSISARAELFIAHREIANMYEEENSPLSQREKFTQQLQWKD--DENRAGVDESYIEALEYALPPTGGWGAGIDRIVMLFAGARRISDVLAFGSLRNV. 559
23 0.000e+00UniRef50_L0B0U6 Uncharacterized protein n=1 Tax=Theileria equi strain WA TaxID=1537102 RepID=L0B0U6_THEEQ  ali  36  15................................NAYPHSTAYTDTFDSILNSNEHLKPGE--ETSKEFACHGRITSVRFNGH--FLHIVDNNGKLQVMFRNTNNDGEGFEDKQKALDLWDIIAVKGTVKKTNTGEITLVAKQAMLLAKCILPPPDLWHGLKDVETRYRQRHLDILVNKDVHNKLLIRSECIHLIRTYLHKRGHIEVETPILQRFPSGALANPFSTKHNAMDMEMFLRIAPELYLKRLIASGFDKVFEIGKCFRNEGISACHSPEFTMVEIYEKLANMDDMIVLVENLVQYLVDEMG----ITIDGKKQI---KWKQITMRDLVLEYARIDVYSSSLP--DLESFCISQNIEVPKNASWGTLVNALFKNKVEPHLILPTHVSYLPLDISPFVYSNDDSPKTARRFESYWMGMEIANGCTEECDPKKVLKNIKENFQ------------DKDFINALEYGMPPTAGVGIGIDRLVMVLANAQNIKDVQTFPLLR... 491
24 0.000e+00UniRef50_W5WS15 Lysyl-tRNA synthetase n=1 Tax=Corynebacterium falsenii DSM 44353 TaxID=1451189 RepID=W5WS15_9CORY  ali  37  580...RRAAAGQKKRDSEQTVVRVTKARAMQREGDPWPEAVRPTHTCAGVLE----------CDEGTPARVAGRVVARRCFGGVTFVDVRDASGMLQLIL-----------EDRMAVDLGDLIAASGTVGYSRTGHKSLLITDWTTEAKSLHPLVRRGAGIVDLNAK-----------------LHARSAVLHAFRLELVDRGYAEVETPVLQAVHGGANARPFVTHINAYNQDLYLRIAPELYLKRLLAGGAERIFEMGRVFRNEGVDATHNPEFTVLEAYDAHGDYDSMRLVTQKLIQRAARAVNGEEAVPPDGSMVSIAGDWPVKTVHGAVSEKASEALHRDVTPKDSLSELCVELGIEIKPGWDAGEIVLEMYEHLVEATTQEPTFYTNFPTSVSPLTRKHRSISGVTERWDLVAWGVELGTAYSELTDPLEQRARLEAQSLKAAGGDPEAMEVDEAFLRALENGMPPTGGLGIGVDRVIMLVTG-KTIRDVVAFPL..... 1043
25 0.000e+00UniRef50_A0A1F8NZ42 Lysine--tRNA ligase (Fragment) n=1 Tax=Chloroflexi bacterium RBG_16_48_8 TaxID=1797641 RepID=A0A1F8NZ42_9CHLR  ali  39  1..........MTELNELEQVRFEKMQRMREAGMPYPPRVTRTHTTREALLAYEAVTEDE----GVAATLVGRIRSIRSMGKVVFTHIEDEAGKLQLFLRADDVGTERLELFKDAFDLGDFIQASGTMFHTRSGEVSLHVKDFSVIAKAISPLPVVHSAFSNPEARYRERYADLAVNPDTRGTFWVRSRIISALRRFLNERGFLEVETPILQPIYGGAAAKPFITHHNQLHQDLYLRISFELYLKRLLVGGFERVYEIGRDFRNEGVSFKHNPEFTQLEFYMAYADYMQVMELTEQMIAYSAEKAIGSTVIQYQGARIDLSPPWKRVDLRSILEDETGIDIGQH-TNAESLREAMIARGHEPSPQSTRGKLIESLLSKYVEHGCIQPTFIYDYPRDISPLAKSKPGDPNTVERF........................................................................................... 410
26 0.000e+00UniRef50_UPI0002D9F4BA bifunctional lysylphosphatidylglycerol synthetase/lysine--tRNA ligase LysX n=3 Tax=Nocardia TaxID=1817 RepID=UPI0002D9F4BA  ali  33  610TTAEADPAPAHDLRPEQVRVRTDKLDRLVGAHIPYPPPFPPTHTVAAAR----------RVPRGTTVRISGRLLRLRDCGGVQFAVIRDWTSDIQLLLDRERLGAARCAEFGELFDLGDLISVSGQLGYSRRGELSLLVADWRMLAKCLHPLPDKWHGLTDSEARMRRGYLDLMIDREARELLARRSAVLRALRDALHDGGFLEVGSPVLQPGPGTGTARSMRTHIDADNTDLHLRLGPESALKRLCVGGVEKIFELGPSFRNARASARLLPEFTLLEAYEAHSDHQRMMTLCRQLVQQAALAVAMRPRLDGSLEALDLSGEWRVRSLYEALGQETGIEI-TPDTGLPELRDLCEKADISYRPGWDHGRTVYALYQRLVAETTREPTFYTDLPSTVAPLARPHRRRAGVAERWDLVAGGIELGTGRSELTDPMELRRRFTAQARSAD-GGPAITGLDEELLCALEHGMPPTGGLSLGVERVLMLLTG-RTIRETQTFPLVR... 1103
27 0.000e+00UniRef50_A0A0C1X3L8 Lysine--tRNA ligase (Fragment) n=3 Tax=Bacteria TaxID=2 RepID=A0A0C1X3L8_9CYAN  ali  45  3....................RRENMEKLRELGIPFPPEFDVTAYAKEIQEEFND---EGDKPNFQDVSLAGRLMGSRVMGKASFAELQDSTGRIQVYIARDEICPGEDKDFKKLLDIGDYIGVKGHVFRTRMGEITVHVTELKVLGKTLSPLPNVYDAFTDPEQRYRQRYLDLTVNPHVKEIFLKRSRLVSAMRRFFDDRGWLEVETPILQPIHGGAAARPFKTHHNTLDMPLYMRIANELYLKRLIVGGFEGVYEIGKMFRNEGMDRTHNPEFTSMEIYVAYKDYNWMMEMVEKLLEYIAIEVTGHTKVEYEGNLIDYAGPYRRLSMYESIEEYTGIDISGMDE--AELRATCKKLHVEVDESMGRGKLIDEIFGEKVEANLIQPTYITDYPIEMTPLAKKHRSK.................................................................................................. 398
28 0.000e+00UniRef50_A0A0J9XAZ4 Lysine--tRNA ligase n=2 Tax=Saccharomycetales TaxID=4892 RepID=A0A0J9XAZ4_GEOCN  ali  34  31SKKRRQAAPLTPEAEALFANRKEHLNSGREL---YPNGQPPAIRVPEFRAQWESKATHET-PADTSYTIQGRVKTIRKSGKLIFIDLVQDFTKLQIVVNRDKAGQEIFDSEHAFLRRGDIVSTTGRPWRTKSGELSLLADTVKLMTPCLHPLPL---NLTNATTRAHNRVVDLAANAHSRDVLRARSTVMAYIREFFGARGFMEVQTPMLADRASGATATPFTTRSRALDVELALRIAPELWLKRLVVSGFDKVFEVGQCFRNEGIDATHNPEFTSCEFYQSFATLEDLMDITQQLLRGVVQRVRDTHGAELDKLAEDFAPNFKVLDFVPEIEKCTGVPLPTDLSDVPALLKYFTAAGVEANGALTAPKLLDKLAGIYLEPQCDQPTFIVNHPTEMAPLAKSAIVNGRSSRRFELFIHGREYANAYEEENSPFAQARKFAVQLRDREELHDEESPLDDSFVRALEWGLPPTGGWGLGIDRLVMLLTGATRIEQVLAFGGVK... 563
29 0.000e+00UniRef50_A0A0T8G5D3 Lysine--tRNA ligase n=6 Tax=Bacteria TaxID=2 RepID=A0A0T8G5D3_STREE  ali  54  1................................................................................................................................................................................................MRRYLDNHGYLEVETPMMHSIAGGAAARPFVTHHNALDMELYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGVSTRHNPEFTMIELYEAYADYKDIMALTENLIAHIAQEVLGTTKIQYGDQEVDLTPEWTRLHMVDAIKQYTGVDFW-GETSVEEARALAKEHGVEITEHMQYGHIVNEFFEQKVEEQLIQPTFIYGHPVEISPLAKKNAEDPRFTDRFELFIVAREHANAFTELNDPIDQRERFEAQLREKEQGNDEAHEMDDDFIEALEYGMPPTGGLGIGIDRLVMLLTNAPSIRDVLLFPHMR... 308
30 0.000e+00UniRef50_D4YLB6 Lysine--tRNA ligase n=2 Tax=Brevibacterium TaxID=1696 RepID=D4YLB6_9MICO  ali  34  626....IRPPSPQYTWSSQQRHRIDHKLALESAGITYPVEGPTSTTSVWELNMQNRPVPAPGTLTAAEVTVRGRVRSRRRFGRLVFMDIEQDGAFVQTVWDRSKVSD----WHVSLFDVGDFVSVTGHVGTTDHGELSVFVEQFTLLAKAIRPTPALGHPVGEEERRT-NRSLDLLTDVSARDILVARSSAIRSLRDTLHAQSYMEVETPMLHTVHGGAAARPFTTHINAYDMDLSLRIAPELYLKRLMVGGMDRIFEIGRNFRNEGVDATHNPEFTSLEAYASGLTYHDMERLTIALIENAARAVNSEPVAKYRDQELYLPGSWRSMTIHEAVSHAVGREL-TLDTAPEVYRAECARAGIEVPTDASQAYMLMELYDELVEKQTVEPTFYYDFPAEKSPLARPGRNDSRVSEQWDLVAFGMEVGTAYSELIDPMIQRERLTEQSLAAAAGDPEAMEVDEAFLTALEMGAPPMGGLGLGVDRVVMMLT-ATTIRQTLTFPFLKP.. 1122
31 0.000e+00UniRef50_A0A0L0ST03 Lysine-tRNA ligase n=1 Tax=Allomyces macrogynus ATCC 38327 TaxID=578462 RepID=A0A0L0ST03_ALLMA  ali  38  9.......................................................................................................DEGGWDRLKHEVQVGDIAYFRGFPGKTGTGELSLFVRASDHLTPSLHEIPFK-HRIKDQEKRTRNRVLDLLVNVDLRRRLRTRTTVIQHVRDFLASRDFLEVDTPVLSTQAGGANARPFTTTAHAYGLDMALRVAPELWLKKLVVAGFDRVFELGKQFRNEGFDATHNPEFVTCEFYMAYANLSDLMGMTEQMLGEIAVKVHGEEVDDVTSHEVDFTGPYRVIDVVPFLEAKLGLPRLDSPTMEADLEAYCVKHHVPLPAPRTAPRLLDAIISHVIEPECVQPTFVRGHPRIMSPLAKSMQENPLLAARIELFVAGKELVNAYEELNDPVEQRDRFMQQQRDKDSGDVEAQPLNDEFCRALEYGLPPTAGWGLGIDRLCMMLTGAHHIREVMPFPTVRPL. 417
32 0.000e+00UniRef50_A0A2K3PM36 Lysine--tRNA ligase n=5 Tax=Pentapetalae TaxID=1437201 RepID=A0A2K3PM36_TRIPR  ali  42  2........................VEELRSKGNPYAYEWNKTHSANQLQDIYRDLGNEETNNENDHVSIAGRIVARRAFGKLAFLTLRDDSGTIQLYCEKERLIDDQFEQLKAHVDIGDILGARGTIKRTEKGELSVCVLSFAILTKSLLPLPDKYHGLTDIDKRYRQRYVDMIANPEVADVFRKRAKVVSEIRRTMDSLGFVEVETPVLQGAAGGAEARPFVTHHNSLGRDLYLRIATELHLKRMLVGGFEKVYEIGRIFRNEGISTRHNPEFTTIEMYEAYSDYQSMMNLAEEIVTQCALAVHGKLTVDYQGVEICLERPWRRETMHNLVKEISGINFNELGNDLEVAKDLEYKDKASIEACQSVGHLLNEVFEIFVEPKLIQPTFVLDYPIEISPLAKPHR.................................................................................................... 392
33 0.000e+00UniRef50_A0A292PVF1 Lysine--tRNA ligase n=1 Tax=Tuber aestivum TaxID=59557 RepID=A0A292PVF1_9PEZI  ali  32  33......................ARRKNLQDSNVPYPCIDSQGMSVAEIRREYGRIVADESVSIEQLVTVRGRIRNYRDSSKLIFYDLVQDGEKLQVVVNCARVGGEEFRRISMLTRIGDVVSVTGYPGRTKAGELSIFATHLQLLAPSLHAPP---QAILDPETRFQNRHVDLMIRPEAGQILRLRSHIIQHIRDFFISRDFVEVQTPILSDTFGGAVAKPFLTTSTYRGKQLTLRVAPELWLKRLVIGGLDRVFEIGAQFRNEGIDNTHNPEFTTCEFYQAYMGLEDIISTTEQLLSGMARRVLELKATKLKDLPEDFTAPFQRLEFIPTLEAAMGHKLPILHGSTEELLSLFKILSLPPPPILTIPRLLGKLSSAYLEPQCMAPTFITNHPEALSPLSKTSLHNQRVSLRVELFVGGKELVNAYEEENSPTEQRRKFVMQAGWKDEGEDGKGVVDEAYCQALEWGLPPTGGWGIGIDRLVMIFAGAERITEVLAFGGLR... 536
34 0.000e+00UniRef50_A0A0T9WB94 Lysine--tRNA ligase n=1 Tax=Salmonella enterica subsp. enterica serovar Typhimurium str. DT104 TaxID=85569 RepID=A0A0T9WB94_SALTM  ali  44  1....................................................................................................................................................MHPLPDQYYGIENPDEKYRKRYLDLLVNSESAKTFRLRSKIISLIRTFFDSQGFLEVDTPVLHPVLGGASAKPFITYYNSLSQNFYLRIATELPLKKLLVAGFDRVYEIGKIFRNEGFDSTHNPEFTSIEFYQAYANLEKIMDQTENLFRFLFEKLNLDPNFDFSNKKINFLEKFARYDMIEITSKLMNFDLKSA--NFADLVEKAKEEGLKIEPFFKKGHLINKFFEKFVEPTLINPTFIIGHPIEISPLAKSNPNNPNFTLRAELFICGKEFANMFDELNDPIDQLSRFQAQIIEKNQGNQEASEIDNEFVQALEYGMPPAGGCGIGIDRLTMLLTKNESIREVILFPQLKPKK 355
35 0.000e+00UniRef50_A0A0G0DSU2 Lysine--tRNA ligase n=2 Tax=root TaxID=1 RepID=A0A0G0DSU2_9BACT  ali  45  1.........................................................................................................................................MVEKYTFLSKALRPLSDKWHGLKDVELKYRKRYLDLIMNEETKERFVFRSNFVRELRNFYHQNGFFEVDTPVLCNTASGALAKPFSTHHNALDIDVSLRIAPEIYLKEVIVGGFEKVFEIARVFRNEGIDPSHLQDFTMIEHYAAYWDYKMNMDFTEKMLVTIIEKLKGTLKLDIMDRQIDMSPPWKVISMRDVILKDSGIDIDKYETADELRNKIKEDIKIDEMENLGLGNLIDALYKEVSRKKIINPTFLINHPTSLSPLARKNDDNPQITDRFQLLINGWEVLNAYSELIDPIDQKERFNEQAEAKAGGDEEALNKDLDYVEAMEYGMPPVSGWGMGLERILALLTNQLNLRDVVLFPLMRPE. 372
36 0.000e+00UniRef50_A0A0P4YN67 Lysine--tRNA ligase n=13 Tax=Eukaryota TaxID=2759 RepID=A0A0P4YN67_9CRUS  ali  41  38.............................................................................NLGLNLFYVLQSEGVKLQIMANQSYESSELFYDDVDKIKRGDIIGVKGYPTRTKTGELSIVPRKMELLSPCLHAMPH-YYGLKDKETRFRQRYLDLIVNTDVRKKFYIRSQIISYVRRFLDNMGFLEVETPMMNMIAGGAAAKPFVTHHNDLNMQLFMRIAPELYLKMLVVGGVDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYNDLMDVTESMISGMVKEIHGTYKIPYHPEEIDFTPPFRRLRMFPDLEKATGTKLPHPPESRKQLDDLCVKHQVDCSAPRTASRLLDKLVGHFLEEQCINPTFICDHPQVMSPLAKGHRSEPGLTERFELFVMKKEVCNSYTELNDPFIQRERFEQQAQVK.......................................................... 418
37 0.000e+00UniRef50_A0A2J6PQS8 Class II aaRS and biotin synthetase n=2 Tax=Helotiales TaxID=5178 RepID=A0A2J6PQS8_9HELO  ali  32  65................QVQERIAELKDAGALEWPRIKSDKEAMRVGEYIEKYMPILGRGELREQTYVKVRGRVRSFRVAGKLVFLDIAQDGKSVQIVLNRARLEGKEFIEFYHLVRRGDIISVYGNPYNTARGEVSVNAVELTLLSPSLASLPLE---LDDRETRIRHRHVDLLINKKVADTIRVRSLIIQYLREFLLKDNFLEVQTPLIADKAGGAIAKPFTTVATEFEKTLALRIAPEIWLKRLVIGGMDRVFEIGPAFRNEGLDATHNPEFTTCEFYKAFADLEDLISMTESLFAGIAKLVADLRTSPLKADLERFTAPFNRIEFIPAVEAGLKLPDISADDAEERLISLFKERDLPLPSSPTLPRLLDKLSSIYIEPDCVAPTFITHHPSCMAPLSKCPKTKQLVSARAELFVDKRELANMYEEENSPFAQREKFLQQAKWRD--DENRAVVDESYLEALEYALPPTGGWGCGIDRLVMVFSGANRISDVLAFGSLRNV. 564
38 0.000e+00UniRef50_A0A256WP33 Lysine--tRNA ligase (Fragment) n=5 Tax=Bacteroidetes TaxID=976 RepID=A0A256WP33_9BACT  ali  45  1...........MALSEQEQIRRNSLTELRKLGIPYPAEYKVNATAAEIKEEY-----PKDDSLFQDISLAGRIMGRRIMGAASFVELKDSTGRIQVYLKRDEICEGDDKTFKRLLDIGDIVGVKGRVFITKMGEISIHVKELQLLSKALKPLPVSYDAFTDPELRYRQRYVDLIVNDKVKDVFVKRSQIIKTMRNFFDSKGYLEVETPILQSIPGGAAARPFKTHHNSLDIPMYLRIANELYLKRLIVGGYEGVYEFAKDFRNEGMDRTHNPEFTVMEIYVAYKDYKWMMEFTEQMLEKVALAVHESPLVTFGENEINFKAPYARVPILEAIRIHTGFDLSGKSE--EEVRKAAKELGLPVNETMGKGKMIDEIFGEKCEHHYIQPTFITDYPVEMSPLCKRHREDPELTERFELMVNGK.................................................................................... 416
39 0.000e+00UniRef50_A0A1D9MMV4 Lysine--tRNA ligase n=2 Tax=Actinomyces sp. VUL4_3 TaxID=1912795 RepID=A0A1D9MMV4_9ACTO  ali  33  576.ETSLEEAMARFTLSEQEQGRRTKAELLASRGDPYPAAQEEGLELQTIELLAQTLQPGEVAK--QPVLSSGRIRSCRRHGGVVFCDLYHRSEKLQIIFSRDRLSEADWDDLKLLDLGD-LVTVAGEPARSRTGQISLAASKWKLNAKCLRPLPAVGTRLEAQ-TSARFRTLQLLQTPDALDNFYRRCQVLASIRRTLSEAAFTEVETPMLHAVKGGANARPFITRMNAYSTDVYLRIAPELYLKRLLVAGMQAIFEMGRSFRNEGADATHNPEFTSLEAYRVGADYHDMRMLTETLIKRAAREICLRPVTDLPAAEVDLSGPWPVIPVLTAISQAVGQEI-TTETSAEELLRICTAHDLPVPPLPQWGELIGVLYDELVEANTIAPTFYIDFPVSTSPLTRRSRSNPDLAERWDLVAFGMELGTAYTELTDPRDQRLRFTAQSLAAAAGDAEAMSIDEDFLRSLDLGMPPTGGLGLGVDRLVMLLTGT-NIRQTLAFPFVRN.. 1093
40 0.000e+00UniRef50_A0A1R1Y2Z1 Lysine-tRNA ligase n=2 Tax=Smittium culicis TaxID=133412 RepID=A0A1R1Y2Z1_9FUNG  ali  37  41....................RPIKLERLKENITPFPLYKKPSIPNEAIKAEYSHLQNGEKSLDGI-FFLEGRIMAKRSSGKLYFYTILQNNITFQLVVNYNNINSDTFTSINKYFQAGDFLRGVGCIGKTKSGELSIFAQQIELLSTCYKTIPF-LSKLENTETRFRNRHVDFLVNQEARNTIIVRSKVLKLMRKFFDDNGFVEVETPILWPSLGGANAKPFVTSSSALGNDLFLRISPELFLKQLVIGGFDKVYEIGKLFRNEGIDKSHNPEFTSCEFYQAYANLSDLIKTTEDLISSLVLNLNDNSLISNHSLNIDFTPPFNRINIVEFLEKKLDTKFDNSDFITDKLVAIYKEKNIPLGSPITPSKLMDNLISIFIEPLCINPTFLVGHPIFMSPLAKSNSNNPIVSNRFELFINGLEFANAYEELNDPDEQRSRFKLQMIDRKRNDSEALLPNVEFCDALEFGLPPTAGWGLGIDRLVSLLSKSKNLREVISFPIIKP.. 596
41 0.000e+00UniRef50_A0A1E5A8N2 Lysine--tRNA ligase n=1 Tax=Rickettsiales bacterium (ex Bugula neritina AB1) TaxID=1868285 RepID=A0A1E5A8N2_9RICK  ali  36  8.....................KNKLEILKSYDNAYQGSFEINYPLDEILK----------LEIGTFVKTAGRVISKRKFGSITFININNFKGKIQILIINSNFEKTLGEEIVNLIDIGDFIGVQGELSLSKTSEKTINCEYITILTKSLKQIPEKYHGLKDEEIKIRERYIDLINNDELKIIFKNRHLLINNIRNFLQNDAFIEVETPMLHTTPSGASAKPFKTFYEALNSDFYLRVAPELFLKRLLVAGFEKVFEINRNFRNEGIDTTHLQEFTMIEIYIAYMDYENLQKFTINFLQNIIKNTLGTLKIPLKESILDFEN-IERLSYNEFLVKYAGFDITKMS--NEEITDKAKVIGLDTKIYRSIDAIKDAIYKKLCVQKVHNPILVYDYPS--TPLSMPHPKKPGYNQQFQIIVKGCELIRACLELTDPYKQEKNFDDQNLQKNTKEDEIVRKDIDFIKALKYGMPPAAGIGLGLDRLMMVLFDT-SIRNVILFP...... 470
42 0.000e+00UniRef50_A0A1E3PPF6 Lysine--tRNA ligase n=2 Tax=Saccharomycetales TaxID=4892 RepID=A0A1E3PPF6_9ASCO  ali  33  49.................FANRKLKLLEI---GKPYPETDAPAMMVQDFIEKYSSLEYGEPCED--FLTVHGRVMTIRRASKLIFLDVYQNFRKVQVVVRRQELTPANFEQDHSLLRRGDIILARGNPGRTKAGELSLLAQSIQLLAPSLHPLPE---NLTNVVKRSHNRVVDILMHDEARERIQLRWTVMSYIREFFNQRHFTEVHTPILSSSAGGASATPFSTVSEAEDKRLSMRIAPELWLKRFIISGFDRVYEIGPCFRNEGIDATHNPEFTTCEFYQSFASLSDLMTITQELLVGLVTRVGERHPFPISELQRQLIQPIKVLDFVSEIEAQSGAKLPVDLACQTSLVAFYKSLNLALPSPESPAKLLDHLAGIYIEPHCIEPTFVINHPAVLSPLAKSHISQASIARRFELFIKGKEFANAYEEENSPEVQSTKFRDQLKDKVFKDSEAPLPDDNYVRAMEWGMPPTGGWGLGIDRLCMLLTGATRIEQVLPFGSLR... 550
43 0.000e+00UniRef50_D4API8 Lysine--tRNA ligase n=90 Tax=leotiomyceta TaxID=716546 RepID=D4API8_ARTBC  ali  33  24.......EQQAASPTQQTQARVSDIQ--KTWSSPYPRRSSLSLTCAEFRSKYDVIQPDETVEED-TVVLHGRIRSQRTAGKLVFFDLVHNGHKVQVLCNQRVVGEEKFKEFYHLLRRGDSFSVTGKPHRTGRGELTVKTTELKLISPCLHDVPVHQKEL---EISPYERHVELLSSPSAANILRARSLITHSMRNFFANREFMEVNTPILASKSGGAIAQPFVTSATEFDRPLSLRIAPELWLKRLVVGGFDRVFEIGPSFRNEGLDKTHNPEFTTCEFYQAFADLESLIETTESLLSTLALEVQQLNKKSLSPTTVSFTGPYRRVDFIPAIEEAIGLPDLQSDNALSQVKEIFANLSLPLPAHETLPRLLDKLCSTYVESQLIEPTFIMNHPECMSPLYRHPESGQIVSARAELFVEGKEIMNMYEEENSPFEQRRKFQQQLSFRD--PENAGELDEGYLQTLEWGLPPTGGWGCGIDRLCMLFTGARRISDVLSFGNLR... 528
44 0.000e+00UniRef50_D5G9V0 Lysine--tRNA ligase n=6 Tax=Pezizomycotina TaxID=147538 RepID=D5G9V0_TUBMM  ali  33  5...........................................SVVEICREYEHIVAGESVSIDKLVTIRGRIKNYRESSKLIFYDLVQDGEKIQVVVNCARVGGEEFRRISMLTRIGDVVSVTGYPGRTKAGELTIFATHLQILAPSLHVPP---QTILDLETRLRNRHVDLMVRPVAGQILRLRSHIIQHIRDFFISRDFVEVQTPILSDTFGGAVAKPFLTEATSRGKQLALRIAPELWLKRLVIGGLDRVFEIGTQFRNEGVDNTHNPEFTTCEFYQAYAGLEDIINTTEELLSGMARKVSELKARKLKDIETDFTAPFQRLEFIPALEASMGHKLPVLHGNTEELLSLFKTLSLPTPPMTTIPRLLQKLSSEYLEPQCMKPTFITNHPETLSPLSKTSLHGQRVSSRVELFVDGKELVNAYEEENSPTEQRRKFVMQAGWKERGEDGEGVVDEAYCQALEWGLPPTGGWGIGIDRLVMVFAGAERIADVLAFGGLR... 483
45 0.000e+00UniRef50_UPI000D34D855 lysine--tRNA ligase n=1 Tax=Candidatus Similichlamydia epinepheli TaxID=1903953 RepID=UPI000D34D855  ali  37  8............DPPPDYSVRLKKLEQLRAMGDPYPHASNPTYKLKQLHKIFNLDSLPHVTQIDKPIVLTGRILLHRHMGRLLFIQIQEESIRFQIIFTKGECTEQSFELLKKLIDLGDWLEVTGHLCQTQKGEPSLFAINFRLLAKALLPLPDKHNKLNNKEIILRKRWLDLIASQESFRRFELRFKIIRSIRTFFEKEEFLEVETPILQSHYGGAEARPFVTEIALLKQRVFLRISLELSLKKLLVGGMRRVFELNKVFRNEGLDRSHNPEFTLLEAYAAYWDYEKMMDLVERLFLEVAIENLGASVFIVEGKEIDLAKPWKRMTMKESINLYGGFDVDQMETS--DLIKEIKTFGVEPESSV-RGPLIAQLFELSVEKHLIEPHHIIDHPIETTPLCKPKPNNPQYVERFESFIGGAEICNSYSELNDPILQTQLLNRQQET----QEEKHDIDLEFLESIYQGMPPAGGIGIGIDRMILLMTGASHIKDVLFFPMMK... 503
46 0.000e+00UniRef50_K2SMZ9 Lysine--tRNA ligase n=5 Tax=leotiomyceta TaxID=716546 RepID=K2SMZ9_MACPH  ali  34  37..QTISKSLDSTNVTHDYEKRVKQLEQAADLAACYPRKADRT-TPQRINELFANLKNDEI-RTDLTVTVLGRVTSRRSSGKLVFIDLYDRGHTVQGVCNKHGTPKEDFKRFSKLARKGDIYAVTGHPTRTTTGELSVLATEVPMLAPSLHQIPEK---VESAETLARQPHVDFLVHQRRAATQRVRSGIIGSMREFFDNDGFLEVNTPILTAGAGGASARPFETSANEFDDPLTLRIAPELFLKRLVIGSGERVYEIGTVFRNEGIDATHNPEFTICEFYEPYANLEDLIQRTEKLFKSTVQQLAEENRIVRDNIKVSFEAPFKRLEFVPTIQEAIDLPDFSGPSAFQDTVDLYKDLNIPLPENPTLPRLLDELAALYIEPLCTSPTFITHHPEVMSPLAKSFKDGQVLSRRVELFIQGREYVNAYEEENSPFEQRRKFEQQLLHKDPSERTERGVDESYIEALEWGLPPTGGWGCGIDRMVMLFSGTNRIADVQPFGTLRNV. 556
47 0.000e+00UniRef50_A0A136J2T4 Lysine--tRNA ligase n=4 Tax=Fungi TaxID=4751 RepID=A0A136J2T4_9PEZI  ali  34  68..KQSASDIDEADLGSIIEKRIKKLQEHDAVQYPRIARHDNCMRIPDFVAKYG---TDDAAHDGKVVVLQGRVVSRRAQGKLVYLDIVGEYQKVQVLAELRDVTGEDFKRCFHPILRGDIVEVSGIATRSSTGELTLQASKLTVLTPSLAPLPRK---VQNDETRVLNRHVDLLVNKESVNVLRVRSHVVRTMRDFLHERNFLEVQTPIMADYAGGATARPFLTTANEFSKDLALRIAPELWLKRLVVGGMDRVFEIGPSFRNEGLDNTHNPEFTTCEFYWAYANLAQLTTVTEHFIRSLFTSAKALHERLGRDTVLPTLPAFPQFAFIPTLERILDIKFPDLDTAFDELVALLERIPPAVRQERSLSRLLDHLAGTYIEPSMTTPIFITHHPACMSPLAKSFTSDQAISARAELFIGGREIANMYEEENSPFEQRRKFEAQVAARQHSGLDAQEVDESYVQALEYGLPPTGGWGCGVDRLVMLLAGTQRIGDTLTFGSLRNV. 583
48 0.000e+00UniRef50_A0A2G9YDJ7 Lysine--tRNA ligase n=3 Tax=Parcubacteria group TaxID=1794811 RepID=A0A2G9YDJ7_9BACT  ali  45  2................IREFRLKKLKKIQE---PYPAK--------------------------TTMPYYGRIRSIRQHGGSIFAHI----DKQQIYLKKDILGKK-FEEFKNIFDIGDIIEVKGKTFKTRTGENTIEVRGFNMLAKSIRPLPEKWYGLKDKEIRFRKRYLDLLMNEEAIKIFEKRSEIIRKIRAFLDKNNFIEVETPILQTIPGGTLAKPFKTHLNALDLDLYLRIAPELYLKRLLVGGFERVYEIGRCFRNEGMDKNHNPDFTMLEFYVSYWDFEKLMDFTEKLMQ-----------------EFGFPEKWTRAEYSKIVRN----------------------------------------SEKEAFQKIKKPTFVWGHPLEISPLAKKI--DSKRAARFQGIINGIEIINAYSELNNPIEQKERFKEQETMRKKGDQEAHRMDKDFIEALEYGMPPAAGFGMGIDRLTMLLTNAKTLREVILFPTMRPKK 396
49 0.000e+00UniRef50_A0A1Q5PN86 Lysine--tRNA ligase n=3 Tax=Actinomyces liubingyangii TaxID=1921764 RepID=A0A1Q5PN86_9ACTO  ali  34  583.........PPVKLTQQEQVRRQKAADLEARGEAYPPGIPAGDPLASVRAEAEKSAPG--MFTTETLTTAGRISAIRNHGGVIFLDLYQGRTRLQLVADRRVLSGRDFIDL-KTLDRGDQLQVTGQPGRTKRGEPSLQLTTWKLRAKALRPLPVPGTVL-DPQTRVRQRALHLLVDPGALDLLRARGTVFRSVREYLTKDGYLEVETPVLQAVQGGANARPFVTHLNAYDSDVFLRIAPELYLKRLAVAGLDRIFEMGRSFRNEGADATHNPEFTSLEAYRAGADYHDMQRLTEALIKAAATALFARQELGEEAGFVDLSAPWPVITVLDAISQAVGSEI-TLDTPIEELKAHCQAHGLALPATINTGELIGVLYDELVEAKTELPTFYTDFPVETSPLTRQSRKDPRLAERWDLVAFGMELGTAYTELTDPRIQRERLTRQSLAAAAGDPEAMSLDEDFLRGLGIGM----------DRLVMFLTGT-NIRQTLSFPFVKPQE 1101
50 0.000e+00UniRef50_A0A0U5G5W0 Lysine--tRNA ligase n=3 Tax=Eurotiomycetes TaxID=147545 RepID=A0A0U5G5W0_9EURO  ali  33  47.......STTAASSQKALERRLQEVKE--SSPDPYPRKSSTSIDCSEFHSRYSHVAINETVEED-SVSVTGRIRTYRLAGKLIFFDIVQDGQKVQIMCNLDGVTTGDFKRFYRLLRRGDAFSVTGKPHRTGRGELTVLATELQLLSPCLHDVPLDAHE---HENSPYDRHVQFLADPAMVDVIKARSAITQYLRQFFLDRSFMEVNTPILNSIAGGAVARPFYTTATEFDRQLSLRIAPELWLKRLVVGGFDRVFEIGPSFRNEGLDKTHNPEFTTCEFYNAYSNLDELMSITEKLLSGIAQHIFNSKAGTLKPTAVDFTAPFRQLDFISGIEAAVGLPNLTSPDATEQTLSIFNDLSLEIPSNPTLPRLLDELSSIYLESQCTNPTFIINPPECLSPLSKTHPSKQIVAARAELFIEGKEIVNMYEEENSPSDQRRKFEDQLRY-SRDAKEPGEIDEEYLKALEWGLPPTGGWGCGIDRLVMLFTGRKRITDVLPFGNLR... 548
51 0.000e+00UniRef50_A0A0Q6V7L2 Uncharacterized protein n=2 Tax=Aeromicrobium TaxID=2040 RepID=A0A0Q6V7L2_9ACTN  ali  36  585.ETARAQADPLPPVRS--RTRHAKLDALTTYGMPYPAADSP-HPVAGAIE------------APGQVTVSGRIVHLRDHGGVVFVDLRDWTGDVQVVLARDGMPVEALSAFRRSCDTGDLVDFTCCPRTTDTGHRSLFASSWRMSAKSLHP--------ADPGDRSK--------DADACDVLRTRSAVIRSLRGVMERRDFTEVETPVLQPVHGGANARPFATHLNAYDLDLTLRIAPELYLKRLSVAGMERVFEIGRVFRNEGIDRRHHPEFTSLEAYQAHADYADMRTLCRSLILDAAVAAHGDAVALHPHGRCDLTGDWPVVTVHEAVSAALQETV-DLDTPAALLTKLCQVHDVAVPDTDDPGSLVVALYEALVEPATTMPTFYADFPTTVCPLTRSKDTEPAIAERWDLVAFGMEIATAYSELTDPVEQRRRLRAQSLLAAGGDVEAMQLDEEFLASLERGMPPTGGLGLGVDRLLMMLTGRP-IRDVIAFPLTR... 1053
52 0.000e+00UniRef50_A0A1J9S8D9 Lysyl-trna synthetase n=2 Tax=Dothideomycetes TaxID=147541 RepID=A0A1J9S8D9_9PEZI  ali  36  37.QTTTKPADAENVTNDYEK-RVEQLKQAGDLATYYPHKADRT-TARRVHEVFARLKNDE-VRTDVTVTVFGRVTSRRSSGKLVFLDVYDGGYTIQGVLERHGVPKEDFKRFSKLARKGDIFAITGHPTRTTSGELSILATEVPCLAPSLHQIPD---AVENPETLARQPHVDFLVHQRRAAIQRIRSGIVSSMRNFFDGDGFVEVSTPILTAGVGGASARPFETNANEFDDPLTLRIAPELFLKRLVIGSGERVYEIGTVFRNEGIDATHNPEFTICEFYEPYANLEDLIERTETLFKTTVDKLAQENSVVRDPLALDLQAPFKRLEFIPTIEAAINLPDLSAPTAFDDLTALFKDLDVPVPKDATLPRLLDELASLYIEPLCAAPTFITHHPAAMAPLAKSAVDGQAVSRRVELFVGGREYVNAYEEENSPFEQRRKLEAQLRLRDERLLNERGVDEGYVEALEWGLPPTGGWGCGVDRLVMLFSGASRIADVQPFGTLRNV. 557
53 0.000e+00UniRef50_UPI0009F29B9F bifunctional lysylphosphatidylglycerol synthetase/lysine--tRNA ligase LysX n=1 Tax=Actinomyces vulturis TaxID=1857645 RepID=UP  ali  36  608..DHVRALMPSRRLSDEDKRRRTALETLLDQGIAYPVGVEPGVTPQVARDRIA-LWAQTDHDEPMMLRVEGRVRVIRDHGGLMFVDISGSHDRLQLVLAEDMPGS-RMSEWRSSVGRGDIVVVDGLAMVTNTGELSVNVTSWRILSKALSAPPRARRNLTVEVPASASRTVQLLADPDALDLIRQRSHIVTTMRHTLSRLGYTEVETPILQSVHGGANARPFITHLNAYDADVFLRIAPELFLKRLAVAGMSHVFEIGRNFRNEGVDATHNPEFTSLEAYVAHGDYMTMRALTEVLIKDAAVAIHGEAIALRPAGTVDIAGEWPVVSVHDAISRAVGRDI-SVDTPLDELRDLAAALDINLPPAAGVGECIDAFYDEFVESRTTLPTFYKDFPVETSPLTRHHRHDSRLAERWDLVAWGTELGTAYTELTDPGEQRDRFTAQSLRAAAGDPEAMSLDEDFLRSLELGLIPTGGLGIGVDRIAMLVTGAPTIRDVIAFPYSRPVR 1130
54 0.000e+00UniRef50_A0A177WRQ6 Uncharacterized protein n=3 Tax=Fungi incertae sedis TaxID=112252 RepID=A0A177WRQ6_BATDE  ali  37  11....................................................................IVGRIVLRRDASKLIFLVIERDGIQVQAVMNKQHWGENHFQILSGAIGLGDIIYVKGVPGRTKSGQLSIRATCLKMLSPCLHIYPKKHVLLEDENIRYRQRYLDMLVHRSTVDLFLKRSKIIRTIRSFFDTREFVEIETPVLSLMAGGANAKPFTTRMDVMNLDLQMRIAPELYLKQLVIGGIDRVYEIGKQFRNEDVATKVNGS-TIVEWETADGQIHQ----------------------------IDFSQPFKRIEIIPELEKALGVTLPNVNDQMETLLQLCNERNIVVQKPFTLPRILDKLISELIEPKCIDPTFVVGHPVCMSPLAK-SGENPELADRFELFVGTKELANAYMELNDPAEQRRRFASQRMARDQGDVEAQPMDESFCLALEYALPPTVGWGLGIDRFCMLMTGTKRIKELIAFPILKPLE 423
55 0.000e+00UniRef50_A0A134BNU7 Lysine--tRNA ligase n=6 Tax=Varibaculum TaxID=184869 RepID=A0A134BNU7_9ACTO  ali  34  606......AAKLQVKLSEQQRSRRAKAEKLSAAGISFPAGFDLGIPLSQAKA---CLDAGEN---GKTLRTLGRIVARRNHGGVVFWDLYYQGTYLQVVLERGNLSPEQFAHLRLLDLGDLLV-VNGKCGASRTGTPSLIAESWTLAAKALRPIPHPAARL-DSTTRTRERTMTLLNDAAAMRRLQARSRALSAVRQELINRGYLEVETPMLQAVQGGANARPFVTHSNAYQVNMFLRIAPELYLKRLAIAGMGAIFEMGRSFRNEGADATHNPEFTSLEVYKAGSDYREMMTLTRELYQAAARAIHGKEIALRPFEEVDISGQWRVISVFDAVSQAVGTTV-TPDTGEDDLRSLCAQHHLTPPPGANCGTLLGTLYDELVEARTVKPTFYCDFPVESSPLTRRHRSDPRLAERWDLVAFGMELGTAYSELTDPRDQRERFTQQSLAAAAGDPEAMSLDEDFLNCLELGMTPLGGLGLGMDRMAMMLMGCD-IRQVLAFPFVKP.. 1106
56 0.000e+00UniRef50_A0A2M8E3B9 Lysine--tRNA ligase (Fragment) n=2 Tax=unclassified Comamonadaceae TaxID=83494 RepID=A0A2M8E3B9_9BURK  ali  58  1........................................................................................................................................IHASAIRLLTKSLRPMPDKFHGMADQEVKYRQRYVDLMTDEDTKKRFIARSKAVSAVRDFMVTHDFLEVETPMLHPIPGGANAKPFTTHHNALDQQMFLRIAPELYLKRLIVGGFDRVFEINRSFRNEGISVRHNPEFTMMEFYAAYWDYQDLMAFTEALIRDAAQRACGSLQLSYAGKPVDLSQPFERLTIHQAICKYTEAGQMQDDDSAEWLRSVLPKLGITEAKHHSLPSLQVLYFEETVEEKLWQPTFIMEHPTEISPLARANDARPEVTERFELYITGREFGNGFSELNDAEEQAARFAAQVAAKDSGDDEAMYFDADFIRALEYGMPPTGGCGVGLDRLMMLLTDSSSIRDVILFPALRRE. 377
57 0.000e+00UniRef50_A0A2E0PAH3 Lysine--tRNA ligase n=3 Tax=Verrucomicrobia TaxID=74201 RepID=A0A2E0PAH3_9BACT  ali  44  2.......................................................................................................................................TLKAKTITIVGKALRPLPAKWHGLSNIETRYRQRYLDLIANDNVKQVFYKRSAIIREIRDFMHERDFIEVETPTMQAIPGGAAAQPFITRHNALGCDFYLRIALELYLKRLLVGGIDRVFEIGRNYRNEGISPRHNPEFTMLEAYQAFGDYETMMELLETMIIRVAEKVIGTLVIEHKDAEIDLSRPWRRVKYKDLIREKGGDDWFEIS--PEKRRQRALDLGADISPDCEDFEVTNGLFEKLIEPTLIQPTFVTHLPKELIPLAKLSPEDPTTIEVFECCINGQEIAPAYTEQNDPIAQREALANQA------GEEQQKLDEDFLVALEHGMPPAGGIGIGIDRLIMMLLGQESIRDVLLFPQLKPK. 367
58 0.000e+00UniRef50_Q4JUZ3 Lysyl-tRNA synthetase n=7 Tax=Corynebacterium TaxID=1716 RepID=Q4JUZ3_CORJK  ali  35  612..............SEQTAVRIKKALALREAGVPWPVAARGAGERSDVVVQCVEIAEGSDATTSGPLRVSGRIVAKREFGAVSFIDLRDASGKCQVLV---EAPKEELASRLRALDLGDLIAVVGTRGHSRTGEPSLLAEAIELEAKDLHPLTRRGAGIGEVNARLR-----------------ARSVVNAAIRRTLGDLGFMEVETPILQRVHGGANARPFKTRSNAANQDLYLRIAPELYLKRLLTQGAEKVYELGRVFRNEGVDATHNPEFTTVEAYEAHGDYESMRWVAQRIIQAAATAYHGEPVLDPEGNLVSIAENFPVKTVYGAISEKVGQSI-TPETNFETLLELCAVHGIATQPGWDSGEVVQEMYEALVECTTTMPTFYTDFPTSVSPLTRQHRSQPGVAERWDLVAWGVELGTAYSELTDPLEQRDRLEAQSLKAAGGDPEAMEVDEAFLRALEDGMPPTGGLGLGVDRLIMLLTG-RSIREVLSFPA..... 1077
59 0.000e+00UniRef50_O74858 Lysine--tRNA ligase, mitochondrial n=3 Tax=Schizosaccharomyces TaxID=4895 RepID=SYKM_SCHPO  ali  35  36.................IEERRKALGRL---GISYPSVTSDTTTIPVIIEKWRNKIT-KSEIAMVRYTVCGRISSIRYSGKLAFFDVLYGNKKLQVVFNKKNIGTEEFIPRLKALQKGDCIQCSGNVGRSGSGELSIYATELKLLSPCLHPIPVK---LTNYEKRFEKRFVDMMSNTKSLELLEKRYRIIESIRKFFSERGFLEVETPILSHHFGGATARPFITSDI-HKLPLTLRCAPELWLKQLVIGGMNRVFELGKNFRNEGIDATHNPEFTSCEAYCAYLNLEGMKKLTEELIRFICLTINGNLQIS--GQTVDLEKGFEVIEFIPALQKELNVPLDNSENCRKQLISIFKRCEIMLPKTCTVAHLLDKLFDSLVLKNTSSPKFVINHPEVMSPLAKSDAVEQRISKRFELYIGGYEICNAYEEENDPVAQYHKFQAQKYDRQLGDDETPAPDSDFVHALEYGLPPTAGWGMGVDRLVMLMTGQSKISEILPFGSLR... 529
60 0.000e+00UniRef50_G9PDQ6 Uncharacterized protein n=6 Tax=Actinomyces TaxID=1654 RepID=G9PDQ6_9ACTO  ali  35  620.ERHIQAQIPTRRLSAEERERAVALERLDAKIDPYPTGVKHGMPPAHALVQFRQLAAGEESIV--QLRVEGRVGLERDHGGLIFVDLVEGYKHIQLLFDASENG-AHLEMWRSLINRGDIVVVSGLAMRTRTGEPSILVQGWQLLAKALTALPRARRGITIPLGANATRTQQLLADANAIELIAQRSAIVTSIRHTLGEQGYVEVETPILQPVHGGANARPFITRMNAYSTDVYLRIAPELFLKRLAVAGMGAIFEIGRSFRNEGVDATHNPEFTSLEAYVAHGDYNTMRLLTQRIFQEAAIKVHGAPVVLVDYVAVDISGDWPVVSVHEAISKALGQEV-TVDTPLERLLELAEANDIEVPVAAGSGDVIGALYDELVEATTTKPTFYIDFPVETSPLTRQNRHDPRLAERWDLVAWGMELGTAYTELTDPGEQRKRFTAQSLRAAAGDPEAMSLDEDFLRTLELGLVPTGGLGLGVDRAVMLITGATSIRDVIAFPYARP.. 1142
61 0.000e+00UniRef50_UPI000376D691 bifunctional lysylphosphatidylglycerol synthetase/lysine--tRNA ligase LysX n=1 Tax=Dehalobacter sp. FTH1 TaxID=1035308 RepID=U  ali  33  598....TPTPPQVSSRTHEFDRRLAHSRTLRALG------FGPTRPAE--RCEADVTAGDEHLVIGEHIRLDGRVRVVRDHGGVVFVELAAPAAPIQLLFDAGALGRDQLDVFRHNVDKGDLMDVHGVVGASRNGTRSLLVQGWRVEAKALHPIPFPRR--TGEEKALRSRTLDLIVHPDHARVLRTRARVLAAVRELLDQRGYLEVETPVLQPLHGGAAARPFLTRSNAYGEDVYLRIAPELYLKRLVVAGMGKVYEIGRDFRNEGADGTHNPEFTALEAYEPGGDYRTMQTLTQDLVVRAAAAAHPPDSVQVGAGRDAITDPWPVVPVLRALSQAVGEPVG-LDTPIDRLLHLGARHGLAVPGRPEPGALIEALYGHLVEATTTTPTFYVDFPKSTSPLVATHRDGGGLVERWDLVVDGLELATGYSELVDPIDQRERLTRQSLLAAGGDLEAMELDEDFLTALELGMPPTGGLGIGIDRLLMLLTGL-SIRSVLAFP...... 1082
62 0.000e+00UniRef50_UPI000DC2DE5A lysine--tRNA ligase n=1 Tax=Mycoplasma wenyonii TaxID=65123 RepID=UPI000DC2DE5A  ali  36  2..DQEKEQNTKRKLNDQEEVRRKKLLGLKELGDAYSSKLVPSHSVKEVTSYPDRY-------LEQQLVLGGRVITVRGP----FFVIKENNSKLQAYIDLKEETLKYIHNFEKYVDIGDYVCVAGPLFRTHKGTLSIRAQQLKIISKALKPLPEKWAGIQSPELAVRNRVGNLLLNEELFHNLSLRSQIISELRRYLGELGYLEFETPILHKIPGGASARPFKTHHNTLKEDLYLRIAPELYLKRLIVSGWTKVYEIGKSFRNEGIDNFHNPEFSSIEIYSTYFGLEETIDLTEKLIINLFEKF-------LPPERKNSLQKFERKPMWELVKEKTGLDFYNNSPSLPIAVKKALGLELTEEEKQSLARVYEKFFEELISGELERPTFVYGFSSECSPLAKEDSANNFFAQRFELYIGGKEIANGFSEQNDPFRQEEQFKKQIS---SETEFELKLDQDYLSALEYGLPPTGGVGIGLDRLIMFLLDSKSIKEVISFPYLK... 484
63 0.000e+00UniRef50_A0A2A2QEQ6 Lysine--tRNA ligase n=3 Tax=Verrucomicrobia TaxID=74201 RepID=A0A2A2QEQ6_9BACT  ali  43  1...................................................................................................MKDLPEDQLAVF-KCLERGDWLGIEGETFLTRTGEPTVKVSKFTVLSKSLRPMPDKWHGVADREIKYRKRHLDLMSNEESAAIFVTRSQMVAEIRSFFHQRGYLEVETPMLQDIPGGAAARPFETYHNALGMPLTMRIAPELFLKRLLVGGFTKVFELNRNFRNEGISRRHNPEFTMLEAYQAFADFEIMADLVEELVCGLAEKFCGGLRIEHKDEEINLERPWKRANYHDLIAEAAGADFFTL--TAEQRRQRCEELGVQISENMEDHEVVQQVFEKKVEEHSFDPCFVTRVSSELVPLAKVTHGGK-TVEVYELIINGQEISPGYSELNDPDVQRDRLEHQ-----AGGEEEQKVDYDFIETLEHGMPPAGGIGIGIDRLIMMLTGAPTIRDVILFPLLKRKE 402
64 0.000e+00UniRef50_A0A1F5REG2 Lysine--tRNA ligase (Fragment) n=3 Tax=root TaxID=1 RepID=A0A1F5REG2_9BACT  ali  45  1.................................................................................................................................................SKSLLPLPEKFHGLQDVELRYRKRYLDLIANPEVKQLFIKRTRFVKALRDFMDAKGFMEVETPCLELIPGGADAQPFTTHHNTLDIDMFLRISLELHLKRLIVGGYDKVYEMGRVFRNEGMSPQHLQEFTMMEFYWAYADYNQLMPLVEEMYITLLEKTFGSLEITFEDKVLNFKGPWPRYDYRQLLIDKSGVDLDQYPT-TESLIPKLKEMGIKPDPKLGRGRLIDQLYKKFVRPELTQPCFLIDHPLDVSPLAKKHPTRQGYVQRFQVLFAGAEVGNGFSELNDPLDQRARFEEQARLREKGDTEAQMYDRDFVEALEHGMPPCGGFGVGMDRFFAIVSNSTSVREIVFFPTMKPE. 357
65 0.000e+00UniRef50_A0A1U7LKS3 Lysine--tRNA ligase n=1 Tax=Neolecta irregularis DAH-3 TaxID=1198029 RepID=A0A1U7LKS3_9ASCO  ali  31  92...................VRRATFQDLNIDAYPFICRDSKYAEIHKVLEDYGK-TFENGTRGTQEITVRGRISSVRKSSKLAFYDICHQASKIQIVCSAKSYIPKSFFEITRLLHRGDYVEITGLPGRTKTGQLSIFANSISLLAPCLHAIP---ASLKDPEKRFSNRHVDFLVNPQSMNSIRIRSLVLNYIRHYLLQKGFVEVETPVLAESSGGANALPFETSSRAVDVPLHLRISPELWLKRLVIGGFDKVFEIGKSFRNEGIDATHNPEFTTCEFYQSFAGLDELMDMTEELLIGINNTVNESGILK---SQVEIKGSFNRLNFIPALEEAMPLPDLTSPTIVEELVSLFQDLHIPLPRLSTAPRLLDKLSSKYLEPQCQDPTFIYNIPALLSPLAKSSPTN-TIARRFELYIHAQELCNAYEEENNPLLQRHKFQMQQHDRETHDLETQTVDESFITALEWGLPPTAGWGLGIDRLCMLITAQLRINEVLPFGGLK... 574
66 0.000e+00UniRef50_UPI0009ED65D9 bifunctional lysylphosphatidylglycerol synthetase/lysine--tRNA ligase LysX n=1 Tax=Plantibacter sp. H53 TaxID=1827323 RepID=UP  ali  36  979..................................YPAEVPRTHSVADVVS---------GVLPPRAVSIAGRVLRRRDHGGVLFLDVSEDHTAIQVLATADRT--ARFNALRAS-QPGDVVSFSGTIGSSRTGTPSLIAVDWTLAAKSLHELPGR-NGLNDPETRIRQRHLDLAVNAEAAAMVRARSHAIQALRSGLLEDGYLEVETPILQTVHGGANARPFRTRINAYRTDLTLRIAPELALKRLIVAGFPQVFEIGRNFRNEGADATHNPEFTAVEAYRAYADYTVMRHLAQRLITRMAVAVSGTALISGPDGSIDLTQDWPVITVSDAVSAAVGTTV-TIDTDRATLERITREHGIEPRSADDTGHLLERLYEELVEPATTVPTFYIDFPASTSPLTRGHRRTPGLAERWDLVAFGMELGTAYTELADPFEQRARLTAQSLLAAGGDPEAMEVDESFLTALELGMPPTGGLGLGVDRIVMLLTGA-TIRESIAFPFVRP.. 1432
67 0.000e+00UniRef50_A0A086YJM7 Lysine--tRNA ligase (Fragment) n=7 Tax=root TaxID=1 RepID=A0A086YJM7_9FIRM  ali  49  3.....KENDPARAISDLTLPQNDKLKELQEKGVKYGGRYIRTHPATQLIENY-------PVLEGQKVNVAGRIMAIRGHGKASFANLQDSSGKIQIYLRLKDVGAESYQIF-NLLDIGDIIGAEGNLFKTRSGEVTVAVEKFTLLAKSLRPLPEKWHGLRDIELRYRQRYLDLLVNPPVREVFVLRSKIIQTMRKFLEQRGFLEVETPMMHLIPGGANARPFTTHHNALDLDLYLRIAPELYLKRLIIGGLEKIYEINRNFRNEGISTKHNPEFTMLELYQAYADYHDMLKITEELIYTVTQEVLGASDVIYEDVTLNLAPPYKKISMLEAVKQYTGIDFSGLDEPYEA-RATAKALNITVEKDDSWGVILNKVFEEKVEANLIQPTFVLDYPIEISPLAQKKED................................................................................................... 394
68 0.000e+00UniRef50_Q4WJX6 Lysine--tRNA ligase n=45 Tax=Eurotiomycetidae TaxID=451871 RepID=Q4WJX6_ASPFU  ali  34  62.................FRHRLEEVKN--ACADPYPPSDNRSLSCATFRERYSHLTSNQTVEDD-TVVVNGRIRAYRLAGKLIFFDIFQDGHKVQVMCNIRKLDPDAFKRFYRLLRRGDTFSVTGNPHRTGTGELTVLATELRLLAPCLHDVPVDA---EEHETSPYPRHVQFLADQKAADIIRARSAIIQFLRQFFLDRSFMEVSTPIIGSIAGGAIARPFQTSATEFDRQLSLRIAPELWLKRLVVGGFDKVFEIGPSFRNEGLDKTHNPEFTTCEFYHAYANLEDLMSITENLLSGMAAHIQEFNKASLKPPEVDFSAPFRRVDFTTGIEGKIGLPDLTTPDALDQVSQLFRDLSLPIPKEPTLPRLLDELCGTYLEPECINPTFIINPPECLSPLSKIHPANQRVAARAELFIDGREIVNTYEEENSPFEQRRKFEDQVRYTKGTDEPA-EIDESYLEALEWGLPSTGGWGCGIDRLCMLFTGTKRIGDVLPFGNLR... 552
69 0.000e+00UniRef50_L8G2P0 Lysine--tRNA ligase n=17 Tax=Leotiomycetes TaxID=147548 RepID=L8G2P0_PSED2  ali  33  74..............SDDFQQRLKELQNAHALKYPRIQPDRNAVSCAEFKKRYAVLNPEESRDSD-NVTLRGRLYSSRIAGKLAFLDVVQDGNRVQGLVNEDDVQAEQFKDFYHLARRGDIVEITGVPTRTKRGELSINATKLVILTPALASLP---STLDDPETRIRNRHADILVNQKVADTLKLRSHIVQYLRNFLISDDFLEVQTPIIAEDAGGAIARPFNTVATEFSTKLSLRIAPEIWLKRLILGGMDRVFEIGPAFRNEGLDATHNPEFTTCEFYKSFADLVELIKMTEDLFSGLASHVNELISSKLPLNTNLFTTPFQRIEFIPDLEQRIGLPDLEADNAAESVASLFSELSQPLPLSPTLPRMLDKLASIYLEPSCDSPTFIIHHPACMAPLAKSFRDNQLVSARVELFVQHKELANMYEEENSPFEQRRKFVQQVQWKDEENEAV--IDESYLEALEWGLPPTGGWGCGIDRLCMLMSGATRISDVLAFGSLKNV. 574
70 0.000e+00UniRef50_UPI000CF4B127 lysine--tRNA ligase n=1 Tax=Candidatus Saccharibacteria bacterium YM_S32_TM7_50_20 TaxID=2056494 RepID=UPI000CF4B127  ali  36  1..........MATLKDFRDERLRKLGELKELGIAYPATANRSHELIQVTREFDQLQ-------GREVSVVGRIINIRKFGKIAFIVIRDASGTVQLFLRENSEQSQLGIEQLSLLDSGDFVEASGPVIKTQTGEISIEVRRLRLLTKALRPLPNTQDGFTNKEERFRRRYIDTNVNHDVFERFLRRSIFWQATREFLLGEGFIEINIPVLEVTAGGADATPFVTHMDALDQDFYLRISHELPLKRLLVGGYEKVFDIGPRFRNENYSDEHLPEHIAMEWYWAYADWRKGMKLTQRLVRYIADQTWQTRYFSLTNGMKVDLGDWPRVSFVDIIREKYGLDVFNSTXXXXXXXXXXXXXXXXXXXXXSRG--IDKL-WKKVRTTIAGPAFLVDIPTFLQPLAKTQAGKPELTEQFNLLLGGTELCKAYSELNDPIDQLNRFKEQQAMRDAGDDEAMMLDIDYVEALEYAMPPACGFGLS-ERLFWYLEGV-TAREGVIFPHLR... 490
71 0.000e+00UniRef50_A0A2H9TN48 Lysine--tRNA ligase n=1 Tax=Paramicrosporidium saccamoebae TaxID=1246581 RepID=A0A2H9TN48_9FUNG  ali  35  55.............LPRLYHEREELLWEEKDSGPFYPEAFQSLFKPEKLQALYGNVSAAALAENPPFVSTAGRILSFREMGRLIFFDLYHDGEHVQVIISKDYYSANDFDKCINSLQRGDLVLVDGNVCRTRAGELSVKAKKVEISAPCITNVPDIKAPEMNPEHRSRTRHLDLLSRPANLRHFKTRSAIIKHLRQFLSDRDFVEVETPILSSKAGGAAARPFVTRMDALGLPVYLRIAPELFLKQLIIGGFDRVFEIGKVFRNEGIDATHNPEFTSLEMYQSFASCSDMMKLSEELLPHLSQLVADSESIEYQGQVIDFRGPYKRISVVPFLEEKLEFDLSNEQDTRRKLLSAVKLLGIRYDPNQTLSYLFDKLIGHLIEPLCIQPTFIVMHPLIQSPLSREHSENHLLSARFELFVAGKELMNGYSELNNPQQQAERFVSQLEERQNGNSEAHPSDAEYVEAMKAGMPPTAGCGIGVDRLVMLLTN................. 536
72 0.000e+00UniRef50_W5WME0 Lysyl-tRNA synthetase n=1 Tax=Corynebacterium falsenii DSM 44353 TaxID=1451189 RepID=W5WME0_9CORY  ali  34  588.EDAVQIDYEPAKLNEQQRVRRAKATRLEAAGMPYPPGQPQERPVA---------VSLVDSHDGEEIWVHARIQAKRNHGGLTFVDLYDGLSGTQALFGSHAASD---YALVRLLDVGDTIAVHGRVGTSNTGERTVFVDQWRMLAKSLRPVPPPSVAI-DRQTLARDRTLQFINQPRSMTLLHYRSRAGAALRRFLTDEGYSEVETPILNPVSGGANARPFFTHLNAYNATVSLRIAPELYLKRLAIGGMKAVFELGKSFRNEGVDATHNPEFISLEAYKAGSDYTDMREMTESLIRASIQAIHGKQVIPVELVEVDVSEPWPVVTVLEGISVATGQHV-DSDTSVEQLCALAEKHGVDVGIEPSWAHAVNELYEALVEPTTSYPTFYTDFPAEISPLTRGHRSDEKLAEKWDLVAFGMELGTAYTELTDPREQAKRFYEQSLAAAAGDPEAMSLDQDFLDAMELGLVPTGGMGMGFDRMVMLICGTD-IRQVITFPYVRPLE 1124
73 0.000e+00UniRef50_A0A1V5LJT3 Lysine--tRNA ligase n=4 Tax=root TaxID=1 RepID=A0A1V5LJT3_9BACT  ali  52  1.............................................................................................................................................................................MVNREVRQAFVTRSRIITAMRRYLDGRGYLEVETPVLQPLYGGAAARPFVTHHNALDMTLYLRIADELYLKRLIVGGFDGVYEISKDFRNEGIDRSHNPEFTMMELYVAYEDYTFMLNLVEEMVGAIAREVCGDAKISYQGQELDFTAPWPRVRMFEALQRYTGMDLYGKS--RDELYAAARELHCEVEPFMESGKILDEIVKEKVEPHLIQPTFLCDYPVELSPLAKRHRDDPRLVERFEAFVAGREICNAFSELNDPIDQRSRFEQQMKARAAGDEEAQLLDEDFLRALEHGMPPTAGLGLGIDRLVMLLTDSASIRDVILFPTMRPE. 328
74 0.000e+00UniRef50_A0A1V2M6X7 Lysine--tRNA ligase (Fragment) n=1 Tax=Epulopiscium sp. SCG-D08WGA-EpuloA1 TaxID=1712377 RepID=A0A1V2M6X7_9FIRM  ali  50  2.......ETPEVSLNELEKIRREKLENLRENGDPFNVKYEVTANSKDIINNFE-------EYEGKEVSIAGRIMTKRDMGKASFIHVQDTSGQIQSYVRKDELTEEAFVEFKKYDIGDIIGIKG-IVFKTQKGEVSIRAKEVLLLSKSLKILPEKYHGLKDTEVRYRQRYLD--------------------------ELGFIEVETPILHSIAGGAAARPFKTHHNTLDMDMYLRIAPELKLKRLIVGGFEKVYEIGRVFRNEGMSIRHNPEFTMIELYQAYADYEDMMNITEGIIKHVTNKVLDKGIVEYNDVEINIEKPFERISMIDLVKKYAEVDFKQIKT-LEEAIKLAKEHHLEVEKHHKKGDILNLFFEKYAEDKLIQPTFVIDYPVEISPLSKRKKDDLDYTERFELFIGGREYANAFSELNDPIDQRERFKRQEELRKAGDDEACEIDEDFLTALEY...................................... 427
75 0.000e+00UniRef50_A0A2U1IWI1 Lysine--tRNA ligase n=2 Tax=Harpellales TaxID=61421 RepID=A0A2U1IWI1_9FUNG  ali  35  42............DKRQLKEQRVKEISDL---GDPYPYTVPQTNTIDHLKETF--VLKDGEKLLQEFVAIEGRIISKRSSKKLIFYTILKNGKHIQVVCNYSNKDLESFKKIHNFLQTGDIVRSLGYIGKTNTGELSIFADQITLLSTCHRTIPF-LSKIENIETRFRNRHVDFLVNENARNTIITRARILKLIRKYFDDNGFIEVETPVLWPSLGGALAKPFVTKSSSLDTDLFLRISPELFLKQLVIGGIDRIYEIGKVFRNEGIDKSHSPEFTSCEFYQAYANFDDIINTTETLLSTIVADLNNGSKIVDDNKTLDFTPPFNRINITEYLSKKLDTNLEFLHTETEKLIEITLKNNINLSKPYTPTRLLDNLISNLIEPLCIQPTFLLGHPILMSPLSKAKS--KLESARFELFIDCSEYVNAYEELNDPDEQRSRFKLQLADRNSGDVESLVPNNDFCEALEYGLPPTSGWGMGVDRLVTLLTNSKSIREVISFPIVK... 543
76 0.000e+00UniRef50_A0A0G4IPN8 Lysine--tRNA ligase n=6 Tax=Plasmodiophoridae TaxID=37358 RepID=A0A0G4IPN8_PLABS  ali  35  1..........................................MTAAEFAASYGQCLSPGQHLEEQHLWQTGRVHRKRQSGGLLFVDLTGDGGRVQVKCSRAHLGDGAFDAALRS-TPGDYVAVQGFPSSSGTGQLLLCAHDLYVTAPCRKPIPP---ALASPEARQRQRHLDLLVNRDTVRRFRQRAAVVSCIRAFLDDRGFLEVETPVLWSTAGGANARPFETRGVALASALELRVAPELFLKQLIVGGLDRVYEIGKVFRNEGMDRTHHPEFTSCEFYMADANYEDLMPMTEALLAAVSSSLGSDAQVAF-------AGPFERLDVVGTIEKQLNLQPRSVLAILEELLDIASGAHLQIPAAPSSASLLEAMIAQRVEPLCVSPTFLVNHPTLLCPLAKQSNDNGVLADRFELFVKGQELCNAYSELADPDEQRRRFKEQERLGGRATPEIAASQAEYCDCLEYGLPPTAGWGMGIDRLVMLLTGADHIRDVVLFPALR... 460
77 0.000e+00UniRef50_A0A2M8KQZ4 Lysine--tRNA ligase n=1 Tax=Candidatus Roizmanbacteria bacterium CG10_big_fil_rev_8_21_14_0_10_39_6 TaxID=1974853 RepID=A0A2M8KQZ  ali  36  12................QRTRRIQKLEALRALGNPYPSESKKSFANKEILDNF-------NVYDNKQVIVAGRVMTWREHGALVFSDIRDMSGDLQLWIAKDALKKNLDKGFLKLLDTGDFVQAEGIVTKTSRGAISVSVKHVKLLSKSIRPIPQR---LTDQEELSRRRYVDLLLHSEKKELFLRKERFFEENRAFLKKNGFVEVSTPVLEHVTGGADARPFVTHHNDLHEDFYLRISTELYQKRLIGAGFEKIFTIGPNFRNEGISDEHLQEYHQIEWYWAYANYRDNMRLVRDCIRHVAQHVYGKTVFSTRGHTFDLAHEWKELDYKTVIQEHLGINIFVDSD--EKIQKAIIENGVHLKGIMNRSRLIDNA-WKVVRKTISGPAFLVNEPASMSPLAKARTDDPTLTERFHIILAGSELGNGYSEVNDPQYQLEQFLKQQKLRDAGDDEAQMLDIDYVEMLEYGMPPVSGYGQS-ER-VFWFLEDISAREGTLFPQL.... 486
78 0.000e+00UniRef50_A0A255M949 Lysine--tRNA ligase n=3 Tax=Micrococcales TaxID=85006 RepID=A0A255M949_KOCVA  ali  33  610.HEPAPMRVLAPRRSQQTRHRMRHARALARDGNPYPVGLAPAETVA--HTQAARLRGDAASSS--EVRTSGRVRRFRDFGGVGFVDLTDGGVTVQVLVDRARVDST-WSTIRRNLDVGDLLVVDGRWGNSRTGTESILARRVTVAAKALQPVP--YSGFENPEQRLRRRSLDLLVHPHGMDLLRQRSQAVDTVRRLLQEEGYREVETPVLNTVHGGASARPFRTFINAYGMDLTLRIAPELYLKRLLVAGSGPIFEVARNFRNEGADATHNPEFTALEAYHPYADYTVMRQLTERLVKAVATALHGAPVLPLEPTPTDVSGPWPVVTVTDAVSRAVGREI-SIRTDFEVLLQAAAAHDVEIGPGMGPGAVLEALYEELVEPLTVFPTFYCDFPEETSPLTAPHRSEPGLVERWDLVVNGMELGTAYSELTDPVVQRHRLTEQSLKATAGDPEAMEVDDDFLDALEVGMPPAGGLGIGLDRLVMLMT-ATSIREVLGFPFVKPQK 1112
79 0.000e+00UniRef50_UPI000A003EF4 bifunctional lysylphosphatidylglycerol synthetase/lysine--tRNA ligase LysX n=1 Tax=Pseudonocardia acaciae TaxID=551276 RepID=U  ali  35  607..EDVTPQPAAPPRADQVRVRMAKLAGMREAGDPYPAWSSPPARLADVRRRFAGLSPD--VRTGQRVSVTGRVRAHRVFGSLCFAVLADPDTGLQLMVERATLGADRLADWKRLVDLGDHVWATGEVVTSRTGELSVLVDEWTHTAKCLRPSPA-------------------AVSPEAAGLVRARGAVLGAVRRTLTDLGYLEVETPMLHAVHGGANARPFQTHRGSDRRPLYLRIAPELYLKRLCVAGLDKVFELGRNFRNEGADATHNPEFTMLEAYRAYADYAAMRLLTEELVRAAAVAAHGRRPERFGGGEHDLSGPWPVVGVYDAVSEALGVRVDPGI-PLATLRQACQRAGVAAGVDSGHGRLVLAAYDQLVEPRTVAPTFYVDFPESVAPLARGHRRDPRLAERWDLVAFGVEIATAHTELTDPVEQRRRLEIQSLHASGGDPEAMELDEDFLAALEHGMPPTAGLGIGIDRLVAMLTGV-SVRQTLLFPFVR... 1088
80 0.000e+00UniRef50_A0A288GV63 Lysine--tRNA ligase n=9 Tax=root TaxID=1 RepID=A0A288GV63_9BACT  ali  38  23........ESMNRLTEY-DVRKAKLKTLRELGIPFAQQWSQNSHINTLLIDQSSLRPIEDILSGPQVSLAGRLMLKRVSGKLSFAQLKDETGTLQLMFEHQHMGETDYRFVDKMLDVGDYIGVRGELFVTHKGELTLFVSEYQLLSKAIRPLGDKFHGIGNAETAYRQRYLDMIFNDESLERMKLRSQFIKTMREFYRSQGFMELDTPILGNSASGAAAAPFVTHHNDFDTDMYLRIAPEIALKMATVGGLEKIFEIGKNFRNEGSSPSHIQEFLVVEHYAAYRNYEHNMAFTEQLFNYLFDNIPQLKRTNGEIKEVSFGQTWERIDYVKRIREDSGIDVGQYPENEDELRALIKGFHRVGIEKQGTATMIDYLYKKVTRPKIVGPAFIYNYPKTMQPLARTSDANPMIVEQFQAIVNGWEILKAYSELVDPVELQANFDAQGAALERGDDEATKGDDEFVLAMEYGMPPQSGRGMGIDRILAMLTEQANIRDVILFPLVKAEQ 550
81 0.000e+00UniRef50_A0A0C1H8Y4 Lysine--tRNA ligase n=5 Tax=root TaxID=1 RepID=A0A0C1H8Y4_9BACT  ali  45  3...............................................................................................................RKKIDLGDIIGVEGYLFHTQKGELTVFVKQLTLLCKTLLPLADKHGGLADKELRYRKRWLDLISHLDVAKVFRTRSHILKEIRSYFDQYQFLEVETPILQSIYGGAEARPFITKLNALDQEMFLRISLEIPLKKLIVGGMHKVYEMARVFRNEGIDRNHNPEFTLLEAYASYWDYFDMMKFVENLFEKLALDLYGTTKVPYTAHEVDMKAPWIRLTMKESIKKYANLDPDVLS--NEEMRHLLLESAHCDPKGLSRGLLIAALFEFFVEPHLIQPHHIYDHPIETTPLCKPHRDEEGLVERFESFILTQEVCNSYSELNDPEIQRHLLELQSDRREAGDEEASPLDEEFIEAICQGMPPTGGIGIGIDRLVMILTNSHSIRDVLYFPWMK... 403
82 0.000e+00UniRef50_A0A2E8NFV0 Lysine--tRNA ligase (Fragment) n=1 Tax=Gammaproteobacteria bacterium TaxID=1913989 RepID=A0A2E8NFV0_9GAMM  ali  50  1..........MTEERDIRINRQRKMEEWLDSSEGYTNSFRRDNSAVELHEKYEGIDKSKLENLSHEASVCGRVMFKRVMGKASFISIQDISGQIQCYLTKEKLGEQKYANTLSLLDVGDIVGVEGTVMRTNKGELTISASDFVLLNKTLQPLPEKYHGLVDQEVKYRQRYLDLIMSSETRTRFRARSDLIQKIRTFFVDLGYLEVETPMMHPIPGGATARPFSTFHNALDRELYLRVAPELYLKKLVVGGFERVFELNRNFRNEGLSTRHNPEFTMLECYQAYSDYRDLIEMTDQLLSELVHSVSGSSKIVYQGREYDFSKGAQQITMSESICSHTAIEENRIND-EDYLRHVLGDIGXRCEXAWGIGKLQLELFEAQVEDKLEDPTYVTEYPAEVSPLARXKDGNPEVTDRFELFIGGREYANGFSELN.......................................................................... 419
83 0.000e+00UniRef50_A0A0K9QRP3 Lysine--tRNA ligase n=1 Tax=Spinacia oleracea TaxID=3562 RepID=A0A0K9QRP3_SPIOL  ali  35  1..........................................MTIPEFMEKYGGLNNGDC-LEDVPVSLAGRIMNKHSSSNLIFYDLQSGDVKVQVVADAKELGETEFSKFHSSVKCYDIVGVIGFPGKTKGGELIIFPKSFVVLSHCLRSMPLQKVGLNDVQTRYSMRFLDLIMNGEVREVFKTRSKAITSIRRFLDNLGFLEVETPIMNSIPGGE--RSFKTYHNDLNMKQYMRQTPDLYLKQLVVGGLSRVYEIGKQFSNEAIDLRHNPEFTTCKFYMAYSDYNDLMELTETMLSDMVKELTGSFIIKCHSNEIDFTPPFRRINLIEELEKVTHLSIPQDLSTEEALMEACAKYNVKCPSPQTTACLLNKLVEHFLEETCVNPTFIIDYPEIMSPLAKCHRSNPGLTEYFKLFVNKHVLCNGCTELNDPMEQRR----QSGSRDG----AIVLDKKTSLALEYGLPPSSSWELSVDYLAMLVTDSQNIQEVLLFPAMKPQ. 469
84 0.000e+00UniRef50_A0A2R5GQI0 Lysine--tRNA ligase n=1 Tax=Aurantiochytrium sp. FCC1311 TaxID=2023137 RepID=A0A2R5GQI0_9STRA  ali  37  1..........................................MSVAEYRKKFADIAHGSRLDEEDEVVLCGRVASREASKKLFFTHIQAQGQRVQVLVAFYEADKDAFASLHRSLRQGDAVAVRGFPGSSKKGELSIVPRAIKVLAPCLEDIPDGKFGLRDKGVRYRNRHLDLLANQAVAAPFQVRAQVMRFLRDYFHQRNFLEVETPTLVPSAGGALARPFKTRAVALDNEVSLRIAPELYLKQLVVGGIDRVFELGKVFRNEGVSAVHNPEFTTLELYQAFADYEDLMAMTEDLFANLDIQIGDDARAALGLSSEDLRGPFARLPVLEGLEDHYNLPRGSFPDVNDELLDLLRRDDAGLTDVQSNCKLVDTLIGRHLEPKCHRPTFLCDHPIAMSPLAKAHPDRPGLSQRFELFVRGKEIVNAYTELNDPAEQLRRFQLQTQGRDAQDRPVMPVDAAYCKALEYGLPPTAGWGLGVDRLVMMLTGRSSIRDVIAFPMLAP.. 517
85 0.000e+00UniRef50_A0A0G1YNY6 Lysine-tRNA ligase n=1 Tax=Parcubacteria group bacterium GW2011_GWB1_56_8 TaxID=1618888 RepID=A0A0G1YNY6_9BACT  ali  39  27.............REDLIEERRKKLARLKEAGIPYPARVRRIEAIGIILRGFDVL-----SRRKKEVVVAGRVMGVRDQGGVLFLDVRDESGSIQAVLKKD--SLADFNFLKSVLDRGDFVATSGPLFKTKKGERSVEVKEFRILAKSLRPLPDTWYGLEETETRLRQRYLDLLINQDVAGVFRKKAIFWQGFRDRLRQEGFLEVETPVLEPIPGGAEAEPFKTHHNALDMDLYLRISLELSLKKLLIGGFEKVFEIGRIFRNEGIDREHLQDYTQLEFYWAYRDYRDLMAFVEKMYKSVIKKVAGGFTTKHGGKSINWGKKWALVDYVAEFKKASGLDPLTAS--PDALERAASALDIEIEPHFGKGRLIDLIFKKAVRPRLIQPCFLIDPPVEVEPLAKRLAADPRRVERVQVMACGTELGKGFSELND---------------------------------EYGMPPAAGFGVS-ERLFSVLMDKP-IRETVVFPLVKPKR 475
86 0.000e+00UniRef50_A0A1F4UQZ1 Uncharacterized protein n=2 Tax=candidate division WWE3 TaxID=422282 RepID=A0A1F4UQZ1_9BACT  ali  32  2.....QEVTTQLPIEQLRQIRIDKLNKLRKLGDPYPAKSNRTNVISDVIDSFENFDS-------KKVIVAGRVLSIRHHGKLIFIDIKDQSGKLQVYLKESENSELSFSEVTELIDVSDFVEIKGIVTKTPRGEISIVPSYFRVLTKALRAIP---QELKDKEVRYRKRYLDTNIHQDVFDRFIRRAKFWEAHRDFFRQNGFLEMNIPVLESVIGGGDATPFITHMNAIDEDFYLRISQELPLKKLIGAGYEKIYEIGPRFRNEGLSDEHLPEHMAMEFYWAYADWEDGMKFIQDLINYVIGQVYPGKTDIRGFKDIKFNEKWEILDFKKVFKEKFDIEDVYNITQAEV-EEKVRKYIKNVDFKINIPRGVDNL-WKLVRKDVKGPAFLINHPKYLSPLQKPDKLNPLMVNRFQPIIAGSELGNGWSEITDAIDQYERFAEQEKLRKSGDKEAQMMDIDYVEMLEYGMPPTFGWGHS-ERLF-WFLENISAKEGVIFPTMK... 494
87 0.000e+00UniRef50_A0A2W5UH24 Lysine--tRNA ligase n=1 Tax=Archangium gephyra TaxID=48 RepID=A0A2W5UH24_9DELT  ali  47  11...............KLLDERKNKAKQLQELGNPYGNGFSPDSLAAELLAKFGEVEPAQLEADGRVVSVAAFVVLQDRSGSLQVHVLGDDTFKIWGTLFKSKTGETSLKFLGKALRGGDDVKVKLSPEQTRVKAAAARADAVAEQSKALKALPAESQALADVEERYRRRYVDLLSNASTRETFKKRTKLVQFIRDFLNRRDFLEVETPMMHSLVSGAAARPFVTHHNTYDIDLFMRIAPELYLKRLVVGGFDRVYEINRNFRNEGVSTRHNPEFTMLEFYQAYATYEDLMDLTEEMISEAAVAVTGSSVVKYGEHTIDFKKGWPRIPMTEAISQRVPELKAADFADVEKLRAVALRGAEEKDKTMNIGELITALFEMHVEGTLIQPTFITQFPVESSPLARRNDANPAVTDRFELFIVGREIANAFSELNDPVDQAGRFQAQLDAKTRGQQETMDFDHDYIRALEHGLPPTAGQGIGIDRLAMLLTDAPSIRDVILFPLLKPTK 574
88 0.000e+00UniRef50_A0A137NZT8 Lysine--tRNA ligase n=1 Tax=Conidiobolus coronatus (strain ATCC 28846 / CBS 209.66 / NRRL 28638) TaxID=796925 RepID=A0A137NZT8_CO  ali  33  49..................................YKHSDPPRTSIKQVIENYGEIQPGEKLEVDGDIVLTGRVKGIRQTSKLYFIDLHEESSKIQLIVKSSKD-----KELLNNISLWDNIEVRGIIGKSKVGELSLFVKEVKLLSPCLQKLPD-WKGVKEVSVKLRNRTLDLLSDQKSFSTLKTRFEVLQYLRQYLTTREFLEVETPILSAQSGGANATPFLTTSKALNQDLQLRISPELYLKQLICSGFPKVFELGKVFRNEGIDATHLPEFTSLEFYSIYWNLNDLIKFTENLINFIMKFNNGSNIIELEGTKLTFNENFDQIQVIPTLEEKLGEKLPDLYGPVDPFIDLCKRNNVPIKAPFTVNRLIDQMISHYIEPMCQNPTFLIGHPITMSPLAKHLPNKPLESARFELFINGAEFINAYEELNDPLVQKERFLQQLKDKELGDKEAQEIDTNFIESLMYGLPPTGGWGLGVDRLIGLVTQSKSIRDTVAFPMV.... 514
89 0.000e+00UniRef50_A0A1F7J6A8 Lysine--tRNA ligase n=5 Tax=Patescibacteria group TaxID=1783273 RepID=A0A1F7J6A8_9BACT  ali  38  10................QRQQRMDAVKKLRELGIPYPAKAKKDHPNQYIHAHFSQLE-------NKEITLTGRLMARREHGKLLFGDLVDQSGKIQICLRQDILQEDLGWSQLSYLDVGDFLQVTGKIGKTQAGEITLFVKHLKLLTKSLRPLPNSF---AEKDQRFRKRYLDFTLYSKHRALFARKAKFWQVSREFMKTHGFIELETPILELVTGGADAKPFTTHHNALDQDFYLRISSELFQKRLIGGGFEKIFVLGPNFRNEGIDDEHLQEYYQLEWYWAYADYRDNMMLVRDLFRHVAQEVYGKTKFTTRGHTFDLMADWQEIDYSQIIKQKFDIDIFQ--TSEEKMLETIKKQGIELVGAVNRNRIVDNL-WKIIRKSIAGPAYLIKHPKFNSPLAKSIENNPQLTERFQVLIAGSELGSGYSEINDPIDQLDRFLEQQKMRDAGDDEAQMLDIDFVEMLEYGMPPTSGYGHS-ERIF-WFLENITAREGTLFPQLKQE. 487
90 0.000e+00UniRef50_A0A2N6UPQ3 Bifunctional lysylphosphatidylglycerol synthetase/lysine--tRNA ligase LysX n=1 Tax=Actinomyces hominis TaxID=595468 RepID=A0A2N6U  ali  32  611..EATSVADVVPSQPEVQCVRAAKAQWLEERGDPYPPSLPVPSSVTAV-EQARVLKVDTISDVETQA--GGRVRYIRDHGGIVFVVLEQERVQIQAVF---ERSKAKYFDLLLGVQRGDVIRVEGYAMRTRTGELSVSVRKWAMAAKAIRPVPHVGDVI-DPSQRGRERVRYLLANPDAVYLLQLRSKAVKRIREFMAEQGYCEVETPMLHPVQGGANARPFVTHINAYDADVFMRIAPELYLKRLAVAGMGAIYEMGRSFRNEGADATHNPEFTSLEAYRAGGDYTTMRTLTEQLIKAMATEMFGKPVAHRPAHEFDLSKPWPVVRVYDAVSQAVGQRI-ETDTSVETLVELAKQHEVELPPVRDHANLIGALYDDLVEAHTVHPTFYCDFPAETSPLTRKDTHNPALAQRWDLVAFGMEIGTAYTELTDPRDQRERFTMQSLAAAAGDPEAMSIDEAFLSDLELGLVPTGGLGLGVDRLCMMLTGV-NIRPLLTFPFVKPK. 1121
91 0.000e+00UniRef50_V6LKV0 Lysine--tRNA ligase n=2 Tax=Hexamitinae TaxID=68460 RepID=V6LKV0_9EUKA  ali  36  70................YYESRIAEINELKKNNVPYPYKIHITRSIKSFRDEFSPLIIENNKSLDKNISISGRVLSFRKSGQLAFLVIEEEGFQIQVYCNKDECTASDYFKQLDSIKRGDIIAVTGIPMRTKTGELSIRPASINLLAPCLRMLPKQNQSISDIEYRYNNRSVDLFMNKKS-QTIVKRIKFIQYIKNFFINKYFLEVETPILHQVKGGANAKPFITFYNDLGQDVFLRIAPELYLKQLVIGGINRVFEMNRNFRNESIDNTHLPEFTMVESYCAYWDLYDQMEFVEDLLSSLAKYANITFNGEGKDYNIDFRPPFVRHDIMDIISKKIGEKPYGSDECNKYLQTLVFDKLHKPTAPFTTSRLIDFLVGEFLEKLTHNPMFLLHHPTIMSPLAKPHRDDPEITERFEVFCGMFELCNAYTELNDSQIQKENFESQLKDKTAGDDEACDVDDKFIKAMEHGMVCQSGLGIGIDRLMMLMCGEASIRECIAFPLLRQQK 638
92 0.000e+00UniRef50_A0A1W0E2W6 Lysine--tRNA ligase n=1 Tax=Enterocytozoon hepatopenaei TaxID=646526 RepID=A0A1W0E2W6_9MICR  ali  40  2....SKKEEKEIAPEKFFEQRTEQILEATKKGNVYPHKFEVKNTFEQIFEVAEKYENDNRST--EEMQAAGRISTIRDHSKFSFYTVVYNDESLQLVFSKDTEKKQETAVF---LRRGDQIGFRGFPGKTRTGEKSLFCEEISVLSPCLRVIPSVKNLLTNAETIYRNRHIDLLVNKESKKRFLDRSKIIRFIRNYFSDLQFVEVETPMMNIKAGGAAARPFITHHNELKMDLHLRVAPELFLKKLVVGGMERVFEIGKNFRNEGIDLTHNPEFTAIEFYMAYADYKDLMIIVEDLLSKMCVDLKGSTKFTYAPVKLDFTAPFKRLDILDELNKELKDDLETEKKVLEILKRIIKKREIQLSEPHTLNRILDAFIGEYIEPQCINPTFVTGFPTVMSPLAKDDRNREGITERFEMFVNGKELVNAYTELNIPDVQRERFRWQSEDAAAGDDEAMPDDEDFCQALEFGLPPTGGV.............................. 486
93 0.000e+00UniRef50_Q4Q7U2 Lysine--tRNA ligase n=12 Tax=Trypanosomatidae TaxID=5654 RepID=Q4Q7U2_LEIMA  ali  39  1..............................................................................MGGILFITIRSGEAQLQVLRQVNEFTKADLRAFASTLHTGDILGATGVPGRTAKGELSLYATEASILAPALCPDLKGFVPLADTGIKYRYRFVDMMSNPSVVQHFRKRHAITRALRDFLDARSFVEVETPVLHSVASGANAKPFVTHHNANDADLFLRVAPELHLKQCVVGGMERVYEIGRVFRNEDADRSHNPEFTTCEFYAAYHTYEDLMTMTEEILRHLALAANGTTKITVKPVEIDLAQPFRRVNAYDAVQEAAGVELPPPTELSAYMSAIMLRYNIPLPSVRTAAKMFDKLIDYFITDCVVEPTFVTDHPLFMSPLAMEQRARPGLSARFELFINGTEYCNAYSELNDPQEQYYRFQQQLLDRQTGDDEAMALDETFLKALQVGLPPTAGWGMGIDRVVMLLNGSSTIREDILFPLLR... 441
94 0.000e+00UniRef50_A0A1T5L605 Lysine--tRNA ligase n=7 Tax=Micrococcales TaxID=85006 RepID=A0A1T5L605_9MICO  ali  36  607...................ARVERALAMQMAGDLYPAAVRHTQRIVEVVSAPGASVSG---------SIAGRVLRRRDHGGVLFLDVSEDHTVLQVIATADRT--DRFDALRAS-QPGDIVSFTGTVGRSRSGTLSWIATDWQLAAKALHELPGRG-GLLDPETRVRQRHLDLLVNPQAAEMVRARSYAIQALRDGLLEDGYLEVETPILQSVHGGANARPFRTRINAYRTDLTLRIAPELALKRLVVAGFPQVFEIGRNFRNEGADATHNPEFTAVEAYRAYADYTDMRQLAQRLITRMAVAVSGTTLINGPGVVVDLAGAWPVLSVCDAVSAVTGVTVTIDSD-RAVLEAVSRDHGLDPRSSDDAGHLIERLYEELVEPATTAPTFYIDFPASTSPLTRGHRTTPGLAERWDLVAFGTEVGTAYTELADPFEQRARLTAQSLLAAGGDPEAMEVDESFLAALELGMPPTGGLGLGVDRIVMLITGA-TIRESIAFPFVRP.. 1076
95 0.000e+00UniRef50_A0A1Q5PP31 Lysine--tRNA ligase n=1 Tax=Actinomyces marimammalium TaxID=156892 RepID=A0A1Q5PP31_9ACTO  ali  34  598........ADSLRLSEQERVRRSKARRLERKGEIYPAGVEAGEPLSVVRELAIRCTTGQVSSA--QVVTSGRIRVIRNLGGIIFTEIYSDGEKLQLMIERDQLPEADFQDF-SCLDLGDMVRITGVPARSRRGEPSVQVKSWQLLAKSLRPWPATHQVL-DAATRMRERALHLAHTPDALELIKMRSRAVRAVRTELDAEGFLEVETPILQSVKGGANARPFVTYLRAYGSDVFLRIAPELYLKQLAVAGMGAIFELGRSFRNEGADATHNPEFTSLEAYRAGADYHDMRLLTQRLFQAAARAVHGQEICLRPRSEFDISGDWPVVPVLSAVSAACGYEITTEIS-AERLVEICREYQIEVPAVAEPGELITALYDELVEARTVAPTFYTDFPVSTSPLTRRSRRDPALAERWDLVAFGMELGTAYTELTDPRDQRERFVQQSLVAAAGDPEAMSVDEGFLSALELGMPPTGGLGLGIDRMIMLLTGT-NIRQTLAFPFVRP.. 1105
96 0.000e+00UniRef50_L0AN51 Lysine--tRNA ligase n=2 Tax=Natronobacterium gregoryi TaxID=44930 RepID=L0AN51_NATGS  ali  39  10...............HFETDRIEKTRRLREQGDPYVTDVDRDATIESVLDAFAADEYEDP--PSTTYQLAGRVLRVNDLGSVLFADLRDETGRIQLLFTEEQT--EAFDD-RQLVDIGDFLAVTGVPIRTDTGERSIHVADWQLATKALRSPPTR-TGF-NERNRVRDRVGAMVVDDDLRTGIETRFAVIATLRELLQERDFREVDTPILHHTAGGARATPFETYCEALEEEQALRIAPELYLKRLVMGGFERIFEIGSVFRNEDIDTTHNPEFTMLELYEAYADYEDVMELTESLVSQVVLEHTGSYDLEYGGATLDFEPPWDRLTLEQTLEEYGGIPVTDRST--DELRRLAREYDVAFDGSVTRGRVYEELYEAAAEDEIEGPLFVTDPPRASTPLCAPHPDDDARAERFEAVVQGVELANAYSELSDPLEQARTFEAQVSRRERGDDEAHEMDTDYVRSLGYGLPPTGGLGIGVDRLAMLIAGTQSIKDVLPFPMV.... 487
97 0.000e+00UniRef50_A0A166WDV5 Lysine--tRNA ligase n=1 Tax=Leptolyngbya valderiana BDU 20041 TaxID=322866 RepID=A0A166WDV5_9CYAN  ali  38  4TATDHTPAQPEAD-NEFVRQRLANREAIAASGMPYGMREDGLVELARAHELYAKLKEDPSHDDRTRVRVAGRVVLHRDNGKLVWLNLRDATGDLQIAVSKRDCSEAGF-ELAKHTDLADIVVAEGPLMKTRAGELTIWASDLRPGAKSIEPPPEKHAGLSDPEARFRRRYVDLWSNPEAMARLVLRGKIVRDVRAFMEERGFAEVETPVLQAQAGGAAARPFVTHLNALDMDLSLRIAPELYLKRLLVAGMPRVFEMSRNFRNEGLSRRHNPEFTSMEAYQAFGDAHTMLELAESMVRRLAEMVCADPAYEWEGLEINYADPFVQVEYGDLFEKAVGCSMFDEAAVRKAA------HEYTDAATTDHWLLVDRLFEDKAEQLITRPTFVLHYPSATSPLTRPLEDRPELAGRWDLFIAGMEIGPAYTELNDPHIQEAKFRQQLAGAQADDNTFRTLDEDFLRALRVGMPPAGGIGLGIDRLAMLLTGGASLREVIPFPFMRPE. 535
98 0.000e+00UniRef50_A1RVC4 Lysine--tRNA ligase n=11 Tax=Thermoproteaceae TaxID=2267 RepID=A1RVC4_PYRIL  ali  35  5...........QSLEKVEEWRKI-VNSLREAGVPYPHSFRITHSVRALNELRRQALLEPW--VGLVIRTAGRVTDIRRHPNVVFIDLYEDGARFQVMADPRH-------SLLDYIWRGDYIGVEGVIVKTQRGDYAVRASSLVLLAKAVQPLPEWGKVDRDSPFYMRYRSVAMVLDLQLRWRIAARAKFIQALREAMWKRGFIEIPTPVLQPIYGGAAARPFTTKIWAIDEEWYLRISPELYLKRYIIAGFPKVFEVGPQFRNEDIDALHNPEFWSLEAYQAYADYNDMMKLTEEVVYEAVSAVLGTGVVKYRDQTINFSPPWRRITLHDALREYGGVDPDRLTD--DQIKEKLRELQVPV-KVYNRGIALVKLFEKLVEKKLVEPTFVLDYPEESTPLCKPHREKRGLVERFEAFVGGHEVANAYTELNDPVRQYEYFVREEELFPK--EEAHPLDWDFVEELSFGMPPTGGVGIGIDRLAMVITNAESIKDVIPYPIVK... 480
99 0.000e+00UniRef50_A0A058ZAC9 Lysine--tRNA ligase n=1 Tax=Fonticula alba TaxID=691883 RepID=A0A058ZAC9_9EUKA  ali  38  36...SITPADAEAGADSFTVSRMAFLARLQEAGIPFPH-YRRPADALALRAVVEHVRTHQTPPASKEASVAGRVEGIRQSGRLVFVDLAADGHQLQVVANRRQFGLDPFTDLVQNLTRGDVVEFAGHTRFSQSGEPSLYATQARLLAPCTLPLPAPGPVRSSRAAGA--RHLELILDTTARERFRIRSRVIATLRRFLEDLDFLEVETPVLSAIPGGASARPFQTTSNALGRDLSMRISPELYLKRLVIGGFERVFEIGKQFRNEGIDHDHNPEFTTCELYQAYANCEDMMDLTENLFREIIRKINGDSLVLTVENEVDFAPPFQRMSIPHELEILLGAPVPDLSTDVEFVERVIDRLGPGPPAPLTAARVVDHLVSEYLEPRCDQPTFLTGHPAALSPLAKAHPALAHASDRFELFVAQRELVNAYSEQNDPNAQYQSFHQQAASRLAGDDEAHVPDHDYCQAMRYGLPPTGGWGLGVDRLVMMLTGSAHIRDIILFPATK... 560
100 0.000e+00UniRef50_A0A1D3D5S4 Putative lysyl-tRNA synthetase n=1 Tax=Cyclospora cayetanensis TaxID=88456 RepID=A0A1D3D5S4_9EIME  ali  37  42..........EVDPREFYESRCKFVEQLRSKNAAYPHKFNVTITMEEYQKKYGSLADG-MHLPEEEVCLAGRLTRVAASGKLRFYDIRSCNLRLQVMANLGDHDPGDFFEIHNAFRRGDI-------------GFSRFPVLYTICQSA-------------PFLRF-------------FEPSCLRSKVIRFMRDFLEDNGFVEVETPMMHPIFGGANAKPFITHHNDLKTDLYMRVAPELYLKMLTVGGMEKVYEIGKNFRNEGIDMTHNPEFTACEFYWAYADYNDTMKLTEEMLSAMVLSIHGSHKIPFHPDELDFTPPFRRLCLVEEIEKQAGVTPLDGPECLEFMKSLIKKHGIELPNPFTPAKALDSLGGRFVETQCTKPTFIIEHPQVMSPLAKWHRSKPELTERFELFLMGKELCNAYTELNDPKKQRECFMDQAKARDQGDDEACPIDENYILALEYGLPPTSGWGLGIDRLTMFLSDQITIKEVILFPSMR... 506
101 0.000e+00UniRef50_A0A0E9NAJ5 Lysine--tRNA ligase n=2 Tax=Ascomycota TaxID=4890 RepID=A0A0E9NAJ5_9ASCO  ali  33  40.....EKKTEGEDRPDIKQRR--KL--FEELGVPYPVEFERAIDVSRFIAKYGE-TLGKGGRGEEVVTLRGRIRKSASSSKLYFYDIVQDGKKLQAVCRKFDGTPEEFTKMHHMFHRGDYISMTGIPGKTNVGELSIFTSSQILLSPCLHPPPLTP---LDLDKRMRNRHIDLMVNQSAANALRVRSKILTYLRKFLVDRGFVEVETPILSDTMGGASATPFITQSKVTGKELSLRIAPELWLKRLVIGSLDRVFEIGKCFRNEGIDATHNPEFTSCEYYQAYANLDDLIRDTEDLLSGMVAHLKDNPTDPTGGEPISFAIPFRRIEFIPALETAMGRKLPQLDDENESLLTLLKDLGIKPPSPSTPSKLLDKLASHYLEPQCIQPTFITHIPEIMSPLAKGSENGHRVSHRFELYVNSQEICNAYEEENDPISQRAKFTLQQSDRESGDSEIPAVDESFVHALEWGLPPTGGWGMGIDRWVMLMTGKTRIGEVLSFGGLK... 543
102 0.000e+00UniRef50_A0A1F1ZSW4 Lysine--tRNA ligase n=2 Tax=Corynebacterium TaxID=1716 RepID=A0A1F1ZSW4_9CORY  ali  35  648.EDIAQGRQRRRSIGDQNRARIDTARRLQSQGIPWQHGGKPTHGCGEI----------THLPADSVASVAGRIIGRRYFGGVLFLDVQDHTGLAQVIVERDSLSGALLATLESSIDLADLVRVTGTVGTSRRGHPSLLAQEVQIEAKSLHPLPDKRKGLQNPETRLRNRHLDMTLNPQVVQSLKARSAVLNAMRGELVRGDYLEVETPILQPIHGGANARPFRTYINAYNMDLYLRIAPELYLKRLMCGGLPKVFELGRDFRNEGADNKHNPEFTVLEAYEAHGDYRTMMALARQLICAAATAVHGKPVIRDPGELVDISGEWPVRSVIDSINQALGRMITQAQEHPDHLRQVAQAVGVHPQATWDAGKIIEEIYGEIVEDSTTLPTFYIDFPASVSPLTRPHPDNPDLCQRWDLVAFGMELGTAYSELTDPLLQRERLEQQSLLAAGGDVEAMEVDEDFLRALEFGMPPAGGLGLGVDRIIMLING-GSMRENLAFPLVK... 1178
103 0.000e+00UniRef50_A0A0Q8YD91 Lysine--tRNA ligase n=15 Tax=Micrococcales TaxID=85006 RepID=A0A0Q8YD91_9MICO  ali  34  606...........PRRSDQFRHRAAALNRMRAAGDAYPVG------AASVTTTPIATLGPDAWQAPRTLSVVGRVREVRDHGGVAFATLVDGESRLQVIFDAARLGRECLDRLTSFVDVGDLVRVDGTTGRSRTGTPSLLADDWRMEAKCLHPVP--FRAFDDPATRARRRSTDLLVHPRDVELLRSRSAVVGSIRRTLGDAGFLEVETPMLHTTHGGASARPFRTFINAYGVDLSLRIAPELHLKRLLVAGLGPVFELGRNFRNEGADATHNPEFTSLEVYQPHADYTTMRHLTERLVRAAARTVHGREVIPLGVDLVDISGEWPVVKVLDAVSDAVGQRV-TVDTDIDVLLGLAELHGITVRPEMGAGAVIEELYAELVEPVTMLPTFYTDFPVETSPLTRPHRTEAGLVERWDLVVAGMEVGTAYSELTDPVDQRARLTEQSLKAAAGDPEAMEVDEDFLHALELGMPPSGGLGIGVDRLVMLLT-HTSIRSVLTFPFVRP.. 1106
104 0.000e+00UniRef50_A0A1F0QDR1 Uncharacterized protein n=5 Tax=Actinomycetaceae TaxID=2049 RepID=A0A1F0QDR1_9ACTO  ali  34  602.QEAHQAVVPQRALTEQERVRRSKAERLRQSGMPWPPSLSLGLLPDQVRAQARQCADDTWSPD--EVTTGGRIRAIRDHGGIIFADLDRGGQTIQIMLEQSTTEPAVF-ELWGLCDIGDSVAVTGHPGRTRFGEPTVRVATWTMAAKSLRPLPAHGTTL-DAQTRSRQRVTHLLTDSTAVDLLRKRSRVMATTRAVLAHNGFTEVETPILHPIKGGANARPFTTHLNAYGSNVFLRIAPELYLKRLAVAGMDAIFEMGRSFRNEGADMTHNPEFTSLEAYRAGGDYTTMRHLAQELIQRCALEVNGQCVCLVDMVEYDLSGEWPVIGVHEAISAATNTTVTPDSD-DDELIGLCHAHGIDVPPVVDHGTLIAVLYDDLVEAQTVQPTFYRDFPASSSPLTRKHRDDPRLAERWDLVAFGMELGTAYTELTDPIDQRERFVEQSLAAAAGDPEAMSIDTAFLDDLDLGLVPTGGVGIGMDRLVMLLTGS-TIRQILAFPYVRP.. 1116
105 0.000e+00UniRef50_F0V3G3 Lysine--tRNA ligase n=8 Tax=cellular organisms TaxID=131567 RepID=F0V3G3_MYCS3  ali  34  6.............LNDQEIVRREKLNKLIELGSPYKVKVDVTFSLSDVISR--------GLEITQSFCCAGRVLLIRR----TFFVLSENGKRLQAYINKEDQGKELFKYFDEFVDIGDYLSISGNLFTTKTGELTVNVSSLQIISKSLKPLPEKRVGITNPELMMRNRVGALLVNNDLLEDLGWRSKIIFELRNYLNSLGYLEFETPILHKIAGGAVAKPFKTFHNSLKEELFLRIATELHLKRLIVSGFTKVFEIGKSFRNEGIDSTHNPEFTSIEIYTTYLDMELTMDLTENIILHLNKLISERTAGEERQRGISSLT-FERKAIWELLQEKLNVDFLNNPPSLEEMLKLASKWNIHLEEEKNWSSIYEKLFEDLISPELKNPTFVYGFSSELSPLAKKDFSNERFARRFELYMDGVELANGFSEQNDPEEQLNQFKLQASRETSQGG----VDYDYISCLEYGLPPTGGVGIGLDRLIMFLLNRQSIKEIIAFPHLK... 480
106 0.000e+00UniRef50_A0A1F4VIV5 Lysine--tRNA ligase n=7 Tax=Bacteria TaxID=2 RepID=A0A1F4VIV5_9BACT  ali  35  1..........MATLQELRNSRLNKLEKLKELGIPYPAKSFKDINNSEILQNFEKLE-------GKDAVISGRIVSLRRHGKLVFMDLKDSTGKIQLFIKEDRIKKANHKEDLELLDTGDFAEGFGKVIKTQTGEISVGVETLRILGKSIRPMPDSWDGLKDKEVRLRRRYLDTSMNGEVYDRFVRRAKFWETHREFFKENGFLEMNIPVLEQTPGGADAKPFVTHMDAIDQDLYLRISQELYLKRLIGGGYPKVFEIGPRFRNEGLSDEHLPEHMAMEFYWAYANWEEGMEFVKKLFERIFDNVYERRTFKIRGFDVDFSKGWKVIDFAEVMKEKFDIDVFK--TSVSEIEKVCEERGMRNVSDKNLHRSVDNLWKEL-RKTVAGPTFLINHPKYLSPLAKANAESPHITERFQPIIAGSELGNGWSEINDPQDQLERFKEQQGLRELGDDEAQWLDIDYVEMLEYGMPPT--FGYGHSERIFWFLEDVSAREGVPFPQLK... 487
107 0.000e+00UniRef50_A0A164YMV5 Uncharacterized protein n=1 Tax=Daucus carota subsp. sativus TaxID=79200 RepID=A0A164YMV5_DAUCA  ali  39  1...........MDPVQYFANRIKAVNALKTAGIPYPHKFHVSMSILEYEKKYSGLNSEER-LENVEVSLTGRILKKRSSSKLFFYDLHGVDGKVQLMLDARDTSEAEFAKFHGGVKRGDVVGVVGFPGKSKRGELSMFPTSFTLLSHCLHMLPRQKYVLKDQEIRYRHRCLDLMLNIEVRHIFKTRTKVISYVRRFLDNLNCQEVETPMMSMIAGGAVARPFETYHNDLDEILFMRIAPELSLKQLVVGGFERVYEIGKQFRNEGIDLTHNPEFTTCECYIAYEDYNDFMEMTENMLSG------------------------KRIEMIEDLEKMAGINIPKDLSSDEALAEACAKFEIKCPPPLTTARLLDKLC------------------------------------------------NAYTELNDPEVQRQLFADQLKARKSGDDEAMDLDETFCTALEYGLPPTAGWGMGTDRLVMLLTDSQNIKEVILFPAMKPQ. 454
108 0.000e+00UniRef50_A0A2V6SHX5 Lysine--tRNA ligase n=1 Tax=Candidatus Rokubacteria bacterium TaxID=2053607 RepID=A0A2V6SHX5_9BACT  ali  46  2.................VRRRQEKLARLRAEGIAFGGRYPVSHWAGVLHGRFDGASEDELQTAG-PLSVAGRIMSLRHHGKSCFAHVRDGTGTIQLYARADVLGEG-YRGFID-LDVGDFVGVTG----------------------------DYAYGYLKGETGVHR-----LVRISPFDAARRRHTSFASVSVF------VEVETPTMQAIPGGAAARPFATHHNALDLSLYLRIALELYLKRLVVGGLDRVYEIGRIFRNEGVSTEHNPEFTMLEFYQAYADYEDLMVLTESLFGDLAQAIVGGLTLTYQGEAIDLRPPWRRLAYLEGVAGALGLPPAALADRDTVSAAAERTAAARGVDPRGWGQMWKDVFDTFVEPDLVQPTFVVDFPTALSPLAKQKRDDPTLVDRFELFIGRLELANAYSELNDPHEQRRRFEGQLRARAAGDEEAHPLDEDYLRALEYGLPPTAGEGIGIDRLTMLFTDRPSIREVILFPLLRPE. 454
109 0.000e+00UniRef50_UPI0009FD6E2B lysine--tRNA ligase n=1 Tax=Azospirillum halopraeferens TaxID=34010 RepID=UPI0009FD6E2B  ali  43  1..........MTNPCDVFAARRARLHALEAAGVAYPAGAAPARVHAARLHAAHAALAAGQEHPEAVVTVAGRIRAVRNSG--LFMDLSDESGTIQLFADRDR-PVAPGALPPGDVQLGDVVEAHGHVRRTARGELSVAVHSLRLLAANLHPLPDRRAGLRDTEIRYRRRYLDMLATPETVRTLRTRSAVVSALRRALETGDYLEVETPMLHGVPGGATARPFRTRHNALGREMHLRIAPELHLKRLLVGGLERVFEMNRCFRNEGLSVRHDPEFTTLEVYRAYADGAAMMDLAGALLRTAAAAAFPDGRVPFGGRTLDFGGPIPAAAMHDLVRGATGIDFPALD--PARAMAEAVRLGAPPAEPRTWGHALEWVFGAVVEPTLVRPTFVTALPLDVSPLARASDDDPRLADRFELYANGWELANGFTELADPREQRRRFEAQAAAARAGDEEAMGLDEDYLTALEVGLPPAGGLGIGIDRLVMLLTGSPAIRDVIAFPTLR... 491
110 0.000e+00UniRef50_A0A1F8UDF6 Lysine--tRNA ligase n=1 Tax=Clostridiales bacterium GWD2_32_19 TaxID=1797679 RepID=A0A1F8UDF6_9FIRM  ali  37  7................................VAYKAKFNRTHRICEI----------ENEELGTEVAIAGRVVLKRIFGKLIFAQIYDIEATCQISLSLSVIGEEEMTRFKEFVDIGDFIGINGELYNTNVGELTVRVKSFQLLSKALRSLPEKFHGLSDQDMRYRQRYLDLIANESSRHVILTRFKIMQFIREFYNKHDFLEIETPILQNTVSGALAKPFHTHHNSLDLDVNLRISPETFHKRTLACGFDRIFEFAKDFRNEGLCADKLQEFTMLESYAAYWDFEDSIKYYTELFREVVKFVFGEYEFMSKGRKVILKEKFSRMDYVATLNNIVEFDILAIEDVEEFRRNLLVRKFFELRDQFSIGGMIDLLYKRKMRPNIIEPTILYNYPNVV-PLARFSDENPKIIELFQLVVNGQELVKGYSELINPIQQKRNFEIQQQAKNNGDGEAMDYDRDYLLAMEHGFPPCSGIGFGIDVFIQVILDCENIRDTILYPIMRPIE 470
111 0.000e+00UniRef50_A0A1V4M6P6 Lysine--tRNA ligase (Fragment) n=1 Tax=Firmicutes bacterium ML8_F2 TaxID=1775675 RepID=A0A1V4M6P6_9FIRM  ali  45  2.......DQEQQQLNELLKVRRNKLEGLRTRGDPFSPKFEVDHYSTDITGKFEDFE-------GKTVTIAGRLMSIRSHGKATFAHLQDYRGQVQIYIRLDQVGQEKY-DLLELIDIGDFIGVVGEVFKTRKGEVTVQASDYTFLVKALRPLPEKWHGLKDVEIRYRQRYVDLIVNQEVKQTFINRSKIISTMRELLNSWGFLEMETPIMQTIAGGALARPFVTHHNALDIKLYLRIATELHLKRLLVGGLDKVYEIGRIFRNEGISTIHNPEFTSVEIYQSYADYKDMMNITENLIFQIAEKVFGSGKIRFQGREIDLTPPWERQSMIEVVRRYTGVDFAKIPD-AEAAFQAARDAGLELDKGLSWGDILYMFFEEFCEEQLLSPIFVTDYPIEVSPLAKKKSDDPRLTLRFEGFIAGWE................................................................................... 407
112 0.000e+00UniRef50_A0A1X6X9L9 Lysine--tRNA ligase n=1 Tax=Brachybacterium nesterenkovii TaxID=47847 RepID=A0A1X6X9L9_9MICO  ali  37  605..RRVEAADLAPRRSDQSRHRVRHMQMLRDGGMPYPTGLRPPQPFAEVAAAVAAAGTEGTAMNPTIWRVAGRVRRIRDFGGVCFAQIVEGPASLQAVISRSAMPREQVNLFRACADTGDIVELEGRAGLSRSGTPSLIVTAWRMASKSLQPIP--FDAFEDPEARLRRRATDLIVHPRALGLLRARSVVIRAVREHVQAAGFTEVETPMLQTVHGGASARPFRTRINAYSTDLTLRIAPELALKRLLVGGMGPVFEIGRNFRNEGADQTHNPEFTVIEAYEPYSDYHGMRRLTESMIKAAARALYGAEVLPLHDLLVDVSAPWPVVPMCEALSQALGRDV-DLSTDLDTLLALAREHEVHVRDDMGPGAILEELYAELVEARTIQPTFYTDFPAETSPLTGPHRSKPGLVERWDLVICGMEIGTAYSELADPLEQRRRLTEQSLKAAAGDAEAMQIDEDFLLALENGMPPAGGLGIGLDRLVMLLTDT-TIREVLAFPFVRP.. 1131
113 0.000e+00UniRef50_A0A257VFR3 Lysine--tRNA ligase n=10 Tax=Bacteria TaxID=2 RepID=A0A257VFR3_9BACT  ali  54  48..................................................................................................................................KSGEFSIHASGLTFLSKTLLPMPEKYHGLEDVETRTRQRYLDLIANTDVRATFVTRAKVTQSLRRQLDARGFVEVETPMLQPLYGGAAARPFVTHHNTLDLDLYLRIAPELYLKRLIVGGMDRVYEINRNFRNEGISIKHNPEFTMLEFYQAYTDYRGLMDLTEELLRQVAIDVTGGTKITYQGQELDF-GSIGRYTMREAVIEYWGEDKPSIADLTDPA------WLVRHSSKSTSGEMLLDLFERVCEEHLFQPTMIYDYPVEVSPLSKNKPDEPSFVERFEIFCAGMEIGNAYTELNDPNEQRKRFELQLAMAARGDDEAHQMDEDYVRALCYGMPPTGGEGIGIDRLTMILTDSRSIRDVILFPLLRPE. 414
114 0.000e+00UniRef50_A0A2U1QLF2 Lysine--tRNA ligase n=1 Tax=Artemisia annua TaxID=35608 RepID=A0A2U1QLF2_ARTAN  ali  35  120..ERSAAADEDIDPTNYCDTRIKTVDAQKDTRVPYPH-FNTTSSISEFIKDYDKLKKGER-LEHVVVSLAGRIMSVRPSSKLYFYDLHGSGAKVQVTADAKKLGSEKFTNIHRSVKIGDIVGVTGFPVRSKRGGLIINATSFTILVRCLCMLPMQKYTLKDLETRYRHRYLDLMVNSQVTRTFKTRAFAIDYIRDFLKKRNFLEVETPMMHTLAGGAGAHPFVTHQNDLNMMFFMRIAPDPYLKQLIVGGVERVFEIAKQFRNEGIDLTHSPEFTTCEFYMAYADYNKLMELSEIMLSELEKEANLSIP-----------------------------KDLSSDEANKYLVDACTAFDIECPPPQTTAHLLDKLVEHFLKEKCVNPTFMMNYPEIMSPMAKGNRSKPGLTERFELFINKHKIADGYTTLNDPVVQRQRFTDQLKNPSAGPVTAMALDEMFIKSLEYGLPPTGGWGLGIDRLTMLLTDSQNIKECILFPAMRPQ. 658
115 0.000e+00UniRef50_K6X0V0 Lysine--tRNA ligase n=4 Tax=Actinobacteria TaxID=201174 RepID=K6X0V0_9MICO  ali  35  629...............DQTRVRLAHLAQLAQRPAPYAVGSWDAVELSRLTPQRWEQAQAATPDAPATMRVSGRVRAVRDHGGVVFVRLVDEGTQAQLILERDTLGAADLADFTRLVDRGDLLLVDVTRGFSRNGTPSLLVSHWRVLAKALHPIP--FEAFTDSDARLRRRSTDLIVHPQGAKLLRLRSAVVTSLRRTLDDSGFLEVETPILHSVHGGASARPFTTFINAYGVDLFMRIAPELYLKRLVVAGLGPVYEIGRNFRNEGADATHNPEFTALEAYAPFGDYTTMRLLTQQLVQDAATSVHGAQVLPLPEQLIDISGQWPVVTVLDAVSAVVGRTVR-LDDDFEELLTLAREHGVETEPHMGPGAVIEELYGELVEPATIYPTFYVDFPVETSPLAGGHRSDPTLAERWDLVLGGMELGTAYSELNDPLEQRRRLTEQSLKAAAGDVEAMQVDEDFLRALEVGMPPCGGLGIGVDRLVMALTGT-TIRQVLTFPFVRPL. 1138
116 0.000e+00UniRef50_A0A2M8NQY1 Lysine--tRNA ligase (Fragment) n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2M8NQY1_9CHLR  ali  46  1.................................................................................................................LIDMDDFVQATGQLMRTKAGEISVRVYELVLLAKSLSPLPIEHGEFSDKETRYRQRYADLAVNKDVREVFIKRAKVVKAVRQFLDNEGFLEVETPILQPIYGGAAARPFTTYHNQLDQMLYLRISFELYLKRLLVGGFDAVYEIGRDFRNEGVSFKHNPEFTQVEFYKAYADYHDVMDITERMVAYVAEQVTGSTIITYKDDQIDLSPRWQRITMREAICQYTEIDYMDYPTAPELEAQIRKLGDKSLKPNQTWGKLVEHLFSEYVEKRLIQPTFIMDYPRDISPFAKRIEGDDKHVERFEFYIAGMEMGNAFTELNDPRDQEERFFEMAKLYAKESDEETPLDEDYLRAMRYGMPPNGGFGMGIDRLTMLMTNQQSIRDVL......... 394
117 0.000e+00UniRef50_A0A0F6YJX1 Lysine--tRNA ligase n=2 Tax=Sandaracinus amylolyticus TaxID=927083 RepID=A0A0F6YJX1_9DELT  ali  42  1..........MASEEELIEARRANASALREAGTAYPNDFHDDETTSRARAVAILTDPEKRAALPEEKDLTGTEPSHHLFGRVVFVVIRTPHGDAQALVRNKKGGEPALAKQLELLDLADHVAVQGPMIRTRTGDGAIRADRFQHVGKALLPPPDKWHGLTDVEKRYRERYVDLFANPAVARVFHARSRIVRALRSFLDGRDFLEVETPLLHPLRGGAVAKPFETHHNELDMKLYLRIAPELYLKRLLVGGFDRVYEIGRAFRNEGVSTRHNPEFTILEFYCAYATYEDLMDLTEAMFRHVDAALHARAPEWWSERAYTLDEPFARVDMREAIVARTGGDLLPTPFDGALTRELLREARKLLAKSHTHGERVFVLYEVLVEPDLPKPVFVMHHPFDVSPLARKSDRDPFITDRFELFVEGREVANAFSELNDPDDQASRFRAQLDRRTKGDEEAMDYDADYVRALSHGMPPAGGFGLGVDRLVMMLCGQASIRDVLLFPAMRPE. 568
118 0.000e+00UniRef50_UPI00096FF357 bifunctional lysylphosphatidylglycerol synthetase/lysine--tRNA ligase LysX n=3 Tax=Micrococcales TaxID=85006 RepID=UPI00096FF3  ali  36  604..........APRRSEESRHRLATLDRLRASGIPYPVGGGTATPLALV-----PGVRCGTWTEGEAVEVVARVRELRDHGAVVFVTLEEAGARVQALLESSRTGRRSVDRFAADVDTGDLVRLVAETGHSRTGTPTLLVEDWRLEAKALHPVP--WRGLADPEARVRRRSTDLLAHPGELELLRRRSSVVAALRRTLADRGFLEVETPMLHVTHGGATARPFRTHINAYGTDLSLRIAPELYLKRLLVGGIGPVFELGRSFRNEGADATHNPEFTSLEVYEPHADYVTMRHLAECLVREAATAVHGRPVIPLGVDLVDVGAPFPVVRVLDAVSEAVGLRVGPDTD-LDVLLEVASRHGVTVPERAGWGAVVEELYAELVEPVTVLPTFYTDFPVETSPLVHPHRTERGLVERWDLVVAGMEVGTAYSELTDPVDQRRRLTEQSLRAAAGDPEAMEVDEDFLHALELGMPPTGGLGIGVDRLVMLLTNT-SIRSVLTFPFVRPE. 1099
119 0.000e+00UniRef50_A0A1V9Z7T3 Lysyl-tRNA synthetase n=1 Tax=Thraustotheca clavata TaxID=74557 RepID=A0A1V9Z7T3_9STRA  ali  34  45..................................YPNHFPLTMSVKDFVEKYNDI-PAKARLEDTPVSLAGRITSIRASKKLVFLDICNDGHNVQVLAEKKHYADKSFEHVHECLRRGDVIGIHGFPGKSGKGELSIIPRTVQVLSPCLAPFPSSKYGVKEIDIRFRQKYLDLLTNKDIRQVFATRAKVIQYIRRYLEDRDFVEVETPILCTSAGGAAANPFKTTSRALHTDLFL------------------LFEIGKVFRNE--------------------------------------AIQDSYQVEWNNQVIDFSPPFKRISIIAGLENALNEPLMDDPELVPKLLDICHKRGVVCPKPHTPARVLDCLIGEYLEPLCTNPTFLIDHPAHLSPLAKAHRDKAHMTERFELFVGGKELCNAYTELNDPDEQRERFAAQSKDRDSGDTEAHVKDEAFCTALEYGLPPTAGFGIGIDRLVMMLTGMPHIREVILFPTMKP.. 464
120 0.000e+00UniRef50_A0A0G1BDE5 Lysine--tRNA ligase n=19 Tax=Parcubacteria group TaxID=1794811 RepID=A0A0G1BDE5_9BACT  ali  46  1..........MPTLEELRQTRIEKLENIKAGNNPYPAKIRRDFEIKKILDKF-----WFWRLTKKEFYLVGRIKTQRIHGKVAFFDLEDASGKIQCFLNPADY--------LLNYDIGDFAEVKGSVFKTKKGEKTLRVSEARIIVKSLLPLPEKWHGLKDVEERYRKRYLDLLMNKEAKEKFLVRSNIIKKLRNFLDERDFDEFETPMLQAISGGATARPFKTHLNALDMDLYLRVAPELYLKRLLVGGFEKVYEIGRNFRNEGMDAAHNPEFTMLEAYIAYKNSDYLKTFLQELFRY-----------------LGFDQPWQEKDYDDLIKKYGDFNI--------------------------------------AKKNLIQPTFVNGFPAETLPLSKKLEKNPKKADAFQVIIGGLELVKAFTEQNDPIEQRERFEEQEKLREGGEEEAQRLDEDFLESLEYGMPPCAGFGLGIDRLAMLLTNSHTAREIILFPTMKPKE 427
121 0.000e+00UniRef50_A0A1N4YMI3 Lysine--tRNA ligase n=23 Tax=Actinobacteria TaxID=201174 RepID=A0A1N4YMI3_9MYCO  ali  37  614.....APAPVEHRFTDQSKHRIRHMKQLREAGNPYPLGISTQLTPAQLAEKIATFENAAVSSTRERLSVAGRARAIRSFGSVVFVELIDGATTVQVVCEREEASGADLDLLRHNADTGDILVFEGALGRSKNGTASLLASSWFMGAKSLHAIP--FENFKDPEARLRRRSTDLIVNPQQREFLKMRTSIITSIRATLDGEAFTEVETPILNSIHGGASARPFKTFINAYGAELYLRIAPELYLKRLVVGDMGAVYELGRDFRNEGADATHNPEFTVLEAYKPFSDYNGMREITESLIKNAARSVFGTESLPLGEKLTDVSGSWPVKTVCGALSEAVGREI-SLDTDFEVLLKLARENEIYVRDDMGAGAIIEELYGELVEANTIFPTFYKDFPVETSPLAGPHRSEEGLAERWDLVINGMELGTAYSEMADALEQRRRLTEQSLKAAAGDPEAMEIDEDFLYALETGLPPTGGLGIGVDRLVMLMTGTQ-IRGVLSFPFVKP.. 1117
122 0.000e+00UniRef50_A0A2R6IYT1 Lysine--tRNA ligase n=2 Tax=unclassified Halobacteriales (miscellaneous) TaxID=38063 RepID=A0A2R6IYT1_9EURY  ali  40  14....................RLEKLGRLREAGDPYPPAFRPSRSVGGFV---DEYEDIEEIEDDTTHRLAGRVHRINDLGGIAFVEIEDESGAVQLILDEDTDG----YEHIDELDFIDIVGAEGEAVRSNTGELSLHADSFTFLTKTLHHNPPSQSELGD---RYETRAVKFW-WGEVRDPVETRYRMTRQLRRFLDDCGFLEVETPVLQNVAGGTDATPFETHLEAKDQEMYLRIATELHLKRLLVGGFEKVYEVGPVFRNEDIDVTHNPEFTMLELYQAYADYTDMMDLTEDLVAHLVEAAAGDLVVTYDPVEIDFSPPWPRMTPEEAIERYSDESIDVTECDDEELRELALAHGGEFPGGYSRGLGIVELFENVAEYEIVDPTFVVDHPKETTPLCKDHREKEGRIERFELFAAGFELANAYTELNDPVEQGELFAEQVARREAGDEEAHQMDEDFLDALAHGMPPAGGLGVGIDRLAMLATNSQTIKDVIAFPI..... 504
123 0.000e+00UniRef50_A0A0J0UVZ8 Lysine--tRNA ligase n=1 Tax=Actinobacteria bacterium IMCC26207 TaxID=1641811 RepID=A0A0J0UVZ8_9ACTN  ali  42  12.................RAARLAELEGMRCAGDPYPGRFDATTSISQLRAQFVDLPA--SAETEEQFSFTGRVVLLRDHGGIWFVTLESGGAKLQLMCDSHPRLEPP--------RRGDLIGVTGLIVASRTGELSVRVQEFELLSASLVAPGDKSGRPRSVEYRSRYREADLMENLQSRTVFTMRSEAISGIRVALEARGFLEVETPVFAADAGGATARPFVTRHNALGQDLMMRIAPELFLKRLVIGGMDRVFELGRVFRNEGMSAKHNPEFTMLEVYQAYADYTDMMELVQHVVVEAALASLGSTTVRIPGQQIDLALPWRRASMSDLVFEHTGERIEARMELG-QARAALGRLGLGFNEVWGSGRCLVAVFEDRVEANLISPTIVTGHPVETSPLARHCRTDPSLTERFEVIVGGMELANAYSELNDPVEQRERFMSERSRAQAAGEDTLSLDQRYVEALERGLPPTGGLGIGIDRLVMLLTNSSSIRDVILFPTMR... 489
124 0.000e+00UniRef50_A0A0E3N5K1 Lysine--tRNA ligase n=33 Tax=Bacteria TaxID=2 RepID=A0A0E3N5K1_CORUL  ali  36  591......PAIEPPALSTQERMRKTKLEELEALNMPYPPAVPRTTSIKELLASGGAEAP---------VSITGRVTFIRDHGGVVFADLVEEHTKLQLVVER--TTEQTLRLFKRLVSRGDLISATGQLGTSRNGTRSLIVSSWDMAAKSLTPMPRAP--LSNPHLRAKFRHMDFALNQKATDIFMARSKAVSAVRSVLQEQGYMEAETPILQTIHGGANARPFRTHIRAYDQNLTLRIAPELYLKRLVVGGIPRVFEIGRNFRNEGVDATHNPEFTSLEAYQSYGNWDTMRILTEDLIRSAAIAVYGEPEVTTDGQVLDLSGSWPVVPVYDAVSEAVGTHISPDADISEYA-DITEKYDITAA---TVGDLVNELYDELIEPNTVFPTFYAGFPVETSPLTMADPDQPRIAQRWDLVACGMELGTAYTELADPLEQHARLSDQSLRAAGGDAEAMELDENFLKALQFGMPPTGGLGIGIDRLVMFLTGQ-NIREVLSFPFVKP.. 1070
125 0.000e+00UniRef50_UPI000B76E1D0 lysine--tRNA ligase-like n=1 Tax=Chenopodium quinoa TaxID=63459 RepID=UPI000B76E1D0  ali  35  50...............QYYESRVKFLDAQKAAGIPYPHKFNVTMTVADFIGTYEGLDNGEY-LEDVLVSLAGRVRSKRSSSKLLFYDLYGGGAKVQVVARSSELEEAEFSKFHSSVKCFDIVGVIGFPGK-KRGMLSIFSKSFVVLSHCLRVMPIQEYLLDDEETRYSMRFLDLMLNDEAREVFKTRSKVITYMRTFLDNLNFLEVETPIMNMIPGGAAARSFVTHHNELNMKLCMRTAPDVYLKQLVVGGLDRVYEIGKQFSNEAIDQRRNPEFTTCKFYMAYSDYNDLMWLTEKMLSEIVKVLTGSFIIKCHSNEIDFTPPFRRINVIDELEKFTQLSIPQDLASEEFLMDVCSKYDVKCLPPLTSARLLHKLVGHFLEETCLNPTFIMDYPEMIHPLAKCHRSKPGLTEYFKLFVNKNVLCNGCTEANDPMVQHRRFTDQLKDPQSDGG-AVVLDET-CTALEYGLPPSASWELGIDYLAMLVTDSRSIQEVLFFPAMKPL. 572
126 0.000e+00UniRef50_A0A2E9UR12 Lysine--tRNA ligase (Fragment) n=1 Tax=Acidimicrobiaceae bacterium TaxID=2024894 RepID=A0A2E9UR12_9ACTN  ali  52  2..........................................................................................................................................VEKWVVLATTERPFPDKWHGISDQDTRYRQRYVDLWVTEEARNTFVTRSKLMSLTRKWLEERHFMEVETPVFHPIPGGALAKPFTTHHNALDIELYLRIAPELYLKRLVVGGFEKVFEIARVFRNEGLSTRHNPEFTMLELYEAYADWEDIMKLSESLIEFLAEELTGSTIVSFDGRDLDLSTPWKRASMVDLIKEYVNEEV-SLETPIEDLWSLCDKLGIEYETDYGQGKLILEIYEKSVEPNLWAPCFVTEYPKEVSPLSRDHREKPGFTERFEGIVAGREILNGFSELVDPSEQMERFKDQLRKSESGDEEAMGLDKDYVRALEFGLPPTGGIGIGLDRLVMLLTDVQTIRDVVLFPTLRPEQ 366
127 0.000e+00UniRef50_A0A2G6GB43 Lysine--tRNA ligase n=1 Tax=Candidatus Campbellbacteria bacterium TaxID=2026716 RepID=A0A2G6GB43_9BACT  ali  36  12...............EIRNLRIQKIKNLESLGSAYPKDTKPTHTLKEVVDNFAKFKRQKKDKKYKLV---GRIMIKRGAGKIAFVKFFDGTEYFQAVLQADVLGKKKMKIFDKNFDMGDFVIFQGTLFKTKKGEKSLKVTSFKMAGKSILPLPEKWHGITDIEEKYRKRYLDVLSDQNAFDKFKKRSEVIREIRNFMDNEGFLEIETPILQNQASGAMAETFNTHHNDYNLDMVLRISLEAEHKIVMAGGYPAVYEIGKNFRNEGSDSTHIQEFTMIEWYKAYRGLDYNIKLTEKLLKHLAKKVIKKTVFEIKDEKVDFSKEWKKVKFNDLIKKYAKIDVQKA--TRKELEKKAMELGGVKKEKMSHGNLLDFIYKKSARKKLINPTFVLNYPGSLKPLAIQNED--GTSEVAQLVIGGAEVTNQYAELVNPLVQRKLLEDQLKAKKSGDKEAMDFNSDFLEAMEYGMPPMTGFGMGIDRLMAIFTEQDNLRDTILFPIIKPK. 502
128 0.000e+00UniRef50_F8DZC7 Lysyl-tRNA synthetase n=1 Tax=Corynebacterium resistens (strain DSM 45100 / JCM 12819 / GTC 2026) TaxID=662755 RepID=F8DZC7_CORRG  ali  36  642.EDIARGNQRRRSIGEQSQVRIDTARRLQNAGIPWRQHPRPTHTCGEVANLAEH----------TEATISGRVMARRFFGGVLFLDIQDSTGVAQVIVERDHFGRNRLEQLESAVDLADLVRVTGVAGKSRKGHPSLLAHEVNLEAKSLHPLPDKRKGLQNPETRLRNRHLDMTLNPGVMQSLRTRSAVLNAMRSELVQRDYLEVETPILQPIHGGANARPFRTYINAYDMDLYLRIAPELYLKRLMCGGAPKVFELGRDFRNEGADNKHNPEFTVLEAYEAHGDYRTMMDLTRRLICAAATAVHGQPVIRDPGELVDISGEWPVRSVIGSINEALPCTTIGLDTDIDQLRKIAETVGLHPQAAWDEGKIIEEIYGELVEDTTTLPTFYIDFPASVSPLTRPHPENPNLCQRWDLVAFGMELGTAYSELTDPLLQRERLEQQSLLAAGGDAEAMEVDEDFLRALEFGMPPAGGLGLGIDRIIMLING-GSMRENLAFPLVK... 1172
129 0.000e+00UniRef50_S3X8E6 Lysine-tRNA ligase n=1 Tax=Propionibacterium sp. oral taxon 192 str. F0372 TaxID=1203605 RepID=S3X8E6_9ACTN  ali  35  589TTRALPPGSDTVPRSDQSRHRIRHLHELQDAGQPYPVASRTCVELADL---------AEDATVDPSIELVGRVRSLRDHGGVCFIDLVDGMAHRQLVVEAEAIGRESLRRMARLVDSGDLLGVHAHSGESRNGTPSLLVDSWQILAKALQPIP--WWGFNDPRARARSRSLDLLVHPEQMDLLAARSRAITSVRRTLVDAGFCEVETPMLNTVHGGANARPFRTHINAYDTDLVLRIAPELALKRLVVAGMGAIFEIGKNFRNEGADASHNPEFTVVEAYQPYADYTTMRLLTQRIIQEAATAVHGRPVMPLPTGPTDISGDWAVVSVCDAVSEAVGTRI-DPTTDLDELIGIAQEHGIHIGPDWGAGKLIEELYGELAEATTVAPTFYVDFPAETSPLTAPHRTQPGLVERWDLVAGGMELGTAYSELTDPIIQRQRLVEQSWHAAMGDAEAMEVDEDFLTALELGMPPTGGLGIGLDRLVMALTGS-SIRQVLTFPFIRPQR 1086
130 0.000e+00UniRef50_UPI000D0B17F2 bifunctional lysylphosphatidylglycerol synthetase/lysine--tRNA ligase LysX n=1 Tax=Brachybacterium sp. Marseille-P4339 TaxID=2  ali  35  691......PSDLAPRRSDQSRHRVLHLEQLRAAGMPYPVGVPAPMDLAEVAKKVQADAAGSVSLEPTELRVAGRVRHLRDLGGVAFVELMDRSERLQAIMEREQLGAASFDLLTRAVDRGDLLEISGRPGRSRTGEPSLIGASWRIVSKALQPIP--FDSFEDPESRLRRRATDLIVHPQTAELLRARSAVVQAVRQTLLDAGAMEVETPVLATVHGGANARPFRTRINAYDTDLTLRIAPELQLKKLLVGGLGPIFEIGRNFRNEGADATHNPEFTALETYWPYSDYTGMRHLTERLVRAAARAVHGDEVLPVGGALVDVSGPWEVITVCDAVSRAVGRSV-DVNTDIDELLEIIRDHDLEVREDMGPGALIEELYGELVEPATMMPTFYLDFPAETSPLTAPHRSCPGLVERWDLVAGGMEIGTAYSELADPLIQRERLTAQSLKAAAGDAEAMEVDESFLEALENAMPPAGGLGIGMDRLAMLIT-RTAIRDVLAFPFVRP.. 1223
131 0.000e+00UniRef50_G7GUV5 Putative lysyl-tRNA synthetase n=1 Tax=Gordonia amarae NBRC 15530 TaxID=1075090 RepID=G7GUV5_9ACTN  ali  35  622...............DQQRARLAKIGMLDALSMSYPPGVTRDADIAGVRAGFAELPPDT--ETGVVVSVVGRARGVRDFGGLVFVDLAESGARIQAMFDAAQSDPGAHTALRVGVDIGDLISVTGQVCTTRTGELSILVRRWQMAAKCISPVPAPGAELTD-EVRTRNRTLELLTDFSATELLVQRSCGVLALRNTLQEAGFLEVETPILQTVHGGAAAHPFTTHINAYDMPLTLRIAPELYLKRLVVAGMPRIYELGRNFRNEGADATHNPEFTALEVYQAYADYRVMARLARELIVAAAVAVNGAPVAKRRGGTVDLTGEWPEITVHQAVSLATGVPV-TAGTGAAQLAEICRDHTVEVAPDASAGQLVMKLYEALVEKQTVTPTFYYDFPVEVSPLARPHRDDPRLTEHWDLVAFGAEVGTAYSELTDPVDQGERLLAQSFAAAGGDPEAMAFDDDFVRALGYGMPPTGGLGLGVDRLMMMLTDVP-IRRTLTFPFVKPL. 1105
132 0.000e+00UniRef50_A0A2T2QY19 Lysine--tRNA ligase (Fragment) n=1 Tax=Parcubacteria group bacterium SW_4_49_11 TaxID=1919225 RepID=A0A2T2QY19_9BACT  ali  36  1.................................PYQAHAHRDMTLGELASQLDALQ-EQSEYVGERLTLTGRLKSIRLGGKIGFAPLEDESNTVQAVFKKDILPEEEFADFKHLVDTGDYVQVTGEIGFSKRGEASIFVEEFHVLTKALRALPE---NIEDPEQRYRYRYLEMKLNPQVRDMFQRKSRFWEAGRQFLIEQGFLEVQTPTLEHTTGGAEAHPFSTYHEALEENFYLRISSELYLKRYVVGGFEKVFDVDKNFRNEGIDSEHLQEYTALEFYWCYASHEELMDFAEALIKHVIEHTYSTLQLTHGEHVIDWSQAWPRMTYEEFLKTYGGIDLGEYATF-EALQNLAQGYGFDLEAYPNYGRLLDGLYKKLARPHCIEPVWLTEHPVEISPLAKRNPDDPSKTLRSQLIAYGSELTNGFSELNDPVEQLRRFKEQQTLRDEGDEEAMMLDYDFVRALEYGMPPTVGFGVS-ERLFSVLEGQ-SIRETAPFPMMKRKE 471
133 0.000e+00UniRef50_A0A2M7YM55 Lysine--tRNA ligase n=4 Tax=Candidatus Portnoybacteria TaxID=1817913 RepID=A0A2M7YM55_9BACT  ali  42  1..........MPSINEIRQNRIKKLGRIEKKGVPYPAKTKRTHTCREALERF-----EEISSKREKIFLAGRLMTVREHGGSTFCHVQDGAGRIQAYFKKDELGEKAYKFFLDSFDSGDFIEVGGTLFLTKKGEKTLLVGECRMLAKSLLPLPEKWHGLKDAEEKFRKRYLDLLINKDTREIFEKRSEVIGKIREFLGRHQFIEVETPILQLLYGGANARPFKTHLNALDMDLYLRIAPELYLKRLLVGGFERVFEIGRCFRNEGIDREHNPDFTMLECYAAYWDWEKLMEFMEELAHYLDPEIFPE--------------KWDRVEYKDI-----------------------------VTNGDERGSFA----------QIKKPTFVLRLPDI--PLCKNN-------EALQGIVQGIELIKAFSEQNNPIEQRAAFEKQEKLRQKGDEQAQRLDNDFLEALEYGAPPAAGFGLGIDRLTLILTKARSLRETILFPLMKPKE 428
134 0.000e+00UniRef50_A0A1F5EJP5 Lysine--tRNA ligase n=5 Tax=Parcubacteria group TaxID=1794811 RepID=A0A1F5EJP5_9BACT  ali  34  1..........MSSLDEIRKVRIEKKEKIEKNKIPYPSKVDFDLTLKEVTEGF---------KEDKDVKLVGRIMSLRPQGGLTFFNFDDGTAVFQGILKKEDVTEESFNFFEEVMDIGDFIQVEGKLFTTKRGQQSVVVSSWDIISKSLRPLPEKWHGLQDIEQKYRKRYLDVLMDKDAQNRFIIRAKVISEIRKILDGEGFLEVETPILQNQASGAIAETFKTHHNDYDIDMVLRISLEAELKMIMVGGYTAVYEIGKNFRNEGSDPSHIQEFTMIEWYRAYKDLEYNIKLTEEMIKNIAKNVVGKMQFKNKEVEIDLDKKWERVRFNDLVEKNTGWNPQGASREEIEKNALKLGFDGKEISKISDGNLIDFVFKKSSRGKIINPTFVTHYPGSLKPLAIQNED--GTAEVAQLVINGAEVTNQYAELVDPIVQRDLLEKQMKMKEQGDAEAMEFNSEFIDAMEHGMPPMTGFGMGIDRLVAILTEQSNLRDTVFFPIMRPL. 488
135 0.000e+00UniRef50_A0A0G0MBN6 Lysine--tRNA ligase n=1 Tax=Candidatus Woesebacteria bacterium GW2011_GWB1_39_12 TaxID=1618574 RepID=A0A0G0MBN6_9BACT  ali  38  1.............MPDLKQVRIDKLDLLDQL--SWSEDANETNTSVE--DIVAHCSEVENLDSNENLDFIGRIHAKRGSGRILFLDVYQDGSKIQVFLEKN--SLNDYDTLKKVVDTGDVIWVSGSPFRTAAGELTIKANQCRVISKCLLPIPEHFSSLEDVEEQQRKRHLHLMVNPEEMETFRARSVIIRALRTFMEQEDFLEVETPVLQPLRGGAIAKPFATHHNALEQDMFLRIAPELYLKRLLVAGFNRVYEIGKNFRNEGIDTTHNPEFTMLEGYSIGMDYQQGMLLVESLLCYV--------SSQSSDNAFDPEKPFKRIKFFDAL---TGIGLP-PDALPEESKQFAKRHGLDVD-GCHYAQVLDQIFKKLVVRKTDEPTFFFDYPAETSPLAKQKTDDPLLVERFQFVWKRMELVNGYSEQNDPFLQRKAFEEQAKNSMAGDQEAMPIDEDYIEALEYGMPCACGFGIGVDRLCQLLLEKDNIRDVILFPTLRN.. 477
136 0.000e+00UniRef50_A0A1V4RH94 Lysine--tRNA ligase n=4 Tax=FCB group TaxID=1783270 RepID=A0A1V4RH94_9BACT  ali  37  2..........AIEENEFISNRLEKLDAIREMGIPYPPRTPDRSPVEFLR---------TTGETEEVLNTSGRIAAMRKHGKTVFCDISDSTGRIQLFINKKNLDDTGWELLGK-LDLGDIIWVSGSLFVTRTGELSVRVVSLVLLVKAVRPVPHVHDAVSDPDFIYRHRSLDLMLNESSRNRFIARSRIITAIRGYLDSDGFLEVETPILQQIYGGAAADPFVSHYNSMDDQCYLRIATELYLKRLVAGGIHRVYELGKDFRNEGVDRTHSPEFTQLELYEAWTDYQGMMTRFENIVQAAAQAAGVGPVVNYAGHDIDLTPPFKRIPFVAALHEKSGEKLFEWST--EKLSGLVSSLGLG-DDINERPALLDKLFDHYVTPGIIQPSFVVDYPVELSPLAKQKADDPGITERFEAFIAGLELANAFSEQNDPVYQRKVLENQAAHSQHRRG---VVDNEFLYALEVGMPPAGGLGIGVDRLVMILTGAASIRDTILFPYLRREQ 488
137 0.000e+00UniRef50_A0A0G1WIZ8 Lysine-tRNA ligase (Fragment) n=1 Tax=Candidatus Adlerbacteria bacterium GW2011_GWC1_50_9 TaxID=1618608 RepID=A0A0G1WIZ8_9BACT :_  ali  45  1...........MSLEDLRKTREEKLDLLKKAGNPYPAKSSFQLSVAAVKKNF-----EKHRRSRRPLAVAGRVMAKRAHGQAAFLDIFDGSEKLQIFLAKDKLGEKSFALFSETVDIGDFIAAYGKVFLTKKKEQTLEAVKWEMLTKSLRPLPEKWHGLQDAEERFRKRYLDLLMNTEVRERFQKRTKIILELRQRLQAEGFMEVETPQLQPLPGGATARPFVTHHNALDIDLYLRIAPELYLKRLLIGGYGKVFEIGRNFRNEGIDRDHNPEFTMLELYWAWQDYRGLMTFVQKLLKKWL------------------PGKWRTLTFSQLVKNPTEEN------------------------------------YKEARNKIKEPTFIIDYPEALMPLAKLKPENPKLTESFQLIANGAEVVKGFSELNDPLFQRQQMERQEAEHRRGNEEASRLDEDFLEALECGMPPAAGLGLGIDRLAMLLTETKN--DVITIPA..... 429
138 0.000e+00UniRef50_D7BP89 Lysine--tRNA ligase n=49 Tax=Actinobacteria TaxID=201174 RepID=D7BP89_ARCHD  ali  36  583......QDVPEPRIPEQRRVRRRKLVEFEQGGIGYPVSVPRTHSIADAV-----------NMEAGHMSLTGRVHHVRDYGGVVFADIVEEHAHIQVIFERSAG--EAWATFRACVNRGDLVSVTGDLGASHSGTFSLLGESWAMAAKSLVPMPKIP--LTNPHLRAKLRHIDYAMNPQAYNLFRARAQVVAYVRQTLYAQGYLEAETPILQTIHGGANARPFRTHIRAYDQALTLRIAPELYLKRLVVGGTPKVFEIGRNFRNEGVDATHNPEFTSLEAYEAYGDWDTMRVLTEELFRGAATAIHGKPEIVEDGTVLDLSQPWPVVSVFDAVSEAVGRTIVPGSTIAEYA-DLCERYEIEAE---TVGQLVTELYDELIESSTVFPTFYTGFPVETSPLTMADPDNPHIAQRWDLVGLGMELGTAYTELAHPLEQRARFTQQSLLAAGGDPEAMEIDEPFLTALEFGMPPTGGLGIGMDRMVMFLTGT-TIRDVLAFPFVKPEK 1062
139 0.000e+00UniRef50_A0A090PUG8 Lysine--tRNA ligase n=11 Tax=Bacteria TaxID=2 RepID=A0A090PUG8_9FLAO  ali  45  1..........MNPLSEQEIIRREKLGKLREMGIPYPAAYPVDNTSTSIKADF---------KEGKQVNVAGRLMSRRIAGAASFAELQDSDGRIQVYFNRDEICPGDDKSYKKLLDIGDIIGIEGELFKTQVGEMTIMVKKFTLLTKALKPLPLPHDGFVDPEMRYRQRYADLVVNPQVKEVFVKRTKLFNAMRNFFNEREYFEVETPILQPIPGGAAARPFITHHNSLDIPLYMRIANELYLKRLIVGGFDGVYEFSKNFRNEGMDRTHNPEFTAMEIYVAYKDYNWMMDFTERLLEHCAVAVNGETNSQFGEQTIEWKAPYPRITMRQSIIDFTGFDIDGKSE--AELYAFAKAEGIDVDATMGKGKLIDEIFGEKCEGNYIQPTFITDYPKEMSPLCKAHRDNPELTERFELMVCGKEIANAYSELNDPIDQRERLKRKL............................................................. 437
140 0.000e+00UniRef50_A0A1Y1W9N7 Lysine--tRNA ligase n=1 Tax=Linderina pennispora TaxID=61395 RepID=A0A1Y1W9N7_9FUNG  ali  33  69...............................................LQSQYGHALEEGAKLPNVQVTVQGRVRSKRESKKLFFFDIEQDGHTVQLVAQARYVGDEDFRGLNRALLPGDIVRASGFIGKTNTGETSVFVTHLELLAPCFHTIPVR-SGLTDTQKRFRNRHVDLLVNPQAKHNLVTRAKVLKYIRSYLDTRDFTEVETPVLSPNVGGASAKPFVTTAAAFGNRMFMRVAPELFLKQLVIGGMDRVYEIGKQFRNEGVDADHNPEFTTCEFYQTYATLDDLMAMTEEMLRGMAHAVTGETTISGNEIQVDLGKPFRRIDVTQFLRDKLPGLPNDFPDALPQLLDLLAKNNLSAPQPHTVPRLLDRLIGHYIEPLCQQPTFLIGHPSIMSPLSKCTDDSAQVSARFELFVNGKELVNAYEELNNPNEQRAKFMVQATERAAGDEEVPEMDQAFCDALEFALPPTGGWGMGVDRVVALLAGVRHLRETIAFPVMKNDS 536
141 0.000e+00UniRef50_UPI000C769FA9 lysine--tRNA ligase-like n=1 Tax=Eurytemora affinis TaxID=88015 RepID=UPI000C769FA9  ali  36  22........SEIENPENFKRLR---VEGFKRSGVMYPSGYKIDSSVRSILDRYEKMEKGQT--VDKSYKIAGIVTNIRDSGKLKFVDMLSDGKKIQIKLHSNSFNQEEFELNTRWMKRGDRVGVQGSPCRTKSGELSLNSNHVTLLAPCLHVLPS--SPIENPTKRLSKRYRDILTNPELRRTLVSRSNIIKFIRHFLEEREFMEVETPILGNAVGGASATPFLTYHKEMKLDLFMRIAPELYLKQLIIAGFDRVFEIGKLFRNEGIDASHNPEFTSCEFYMAYADYTDLMQLTQALFSELCQAHNFQP--RHGSIELDFIKPYSRLEFLQALESALDTKDLHHQDSFKFLLDICTRKEIPVSAPLTVPRLLDKLASALLEPNLVQPTFLINHPMIMSPLSKPSPGNPDIAERFELYAGGMELCNAYTELNDPEIQRKTLLTQS---GMSDPESMLPDEGFCTALEYGLPPTAGWGCGLDRLTALLTNTTNIRETITFPLIKPIQ 513
142 0.000e+00UniRef50_A0A0S4JV94 Lysine--tRNA ligase n=1 Tax=Bodo saltans TaxID=75058 RepID=A0A0S4JV94_BODSA  ali  40  126..................................................................VKVGGRVVSMRDLGKMLFITIRSFGEQLQICARVGNFTESQLQELKSKITTGDIIGVEGLPGKSKKGELSLFAESVSVLAPYLTVVPDQRTAVSDPDIRYRYRFVDMITDPTVLEVFKARHRMINQLRQFLNNKGFIEVETPMFHTVPSGANAKPFSTHHNANDTDLFLRVAPELHLKQCVVGGMDLVYEIGRVFRNEDSDKSHNPEFTSCEFYAAYHTYEDLMLMTEALFRDLAISVRGEPTMEVPWFCIDLTKPFHRVSVYDAIQEAAGVDLPDTPTGIAFMAAIMLRHNIPLPSVRTASKFFDKLIDHFITEHVVEPTFVCDHPLFMSPLAKEHANRPGLSERFELFINGMEVCNSYSELSDPQEQLKRFEQQLRDKHNGDDEAMNLDETFLKSLQTGMPPTAGWGMGIDRMVMLLTKKKSIRDVIVFPLLRP.. 632
143 0.000e+00UniRef50_A0A0L0G023 Lysine--tRNA ligase n=1 Tax=Sphaeroforma arctica JP610 TaxID=667725 RepID=A0A0L0G023_9EUKA  ali  37  31.................................PYPIYDAHDHTLDELQAAFKHLQPGE-KLAEETVTTVGRISTRRDGGKLFFLDLQQDGHSYQAVVNRKNMTADDFNLFWDLLGRGDVVKVDGVPGRSPKGELSVYAASIEVLSPCLHHLPLSGT-LKDTGIRFRQRYLDMMVNPQTIQSIKVRSKMLRYLRDYLDRHRFIEVETPILNDVAGGANARPFITEADANKQPYKLRIAPELYLKQLVIGGLDRVYEIGKVFRNEGVDSTHQPEFTTLEFYEAYGDFETLISRTQDIISGLVENITGTLRPNLTLHEINFGKPYNRIEVMSELQKHLGPIDLDSPDLLERLMNFCEEHGIQTRSHATEANLIDKLIGHFIEPQCVNPTFIIYHPKIQSPLAKERPEEPNTCYRFELFVRGQEICNAYVELNNPVEQRQRFKAQEKDFNFGDSEAQLPDEGFCTALEYGLPPTTGWGMGLDRMLMLLTNNTQIREVQTFPQMKEDK 521
144 0.000e+00UniRef50_A0A2M6YBM0 Lysine--tRNA ligase (Fragment) n=1 Tax=Candidatus Berkelbacteria bacterium CG08_land_8_20_14_0_20_39_8 TaxID=1974511 RepID=A0A2M6  ali  50  1..............................................................................................................LIDLFDVGDFIQVEGKLFITKAGEYTLKVLSFKLLTKSLRPLPEKWHGLTDVETRYRQRYVDLIVNPKVKELFYKRSKIIAALRNFLTKNGFLEVDTPTLQPIAGGAVAKPFITHYNVYDRDVFLRIAPELYLKRLVVGGFEKVFEFAHCFRNEGVDATHNPEFTNLEFYWAYTDYEKLMKFTEELLRNVVSQVFGKTEIEISGKKVDFNKKFPRITFNDI----------------------------------TDGKNTDETFKNAVR-KIIEPTFIIDHPIGISPLAKRK--DEKTVERFQLILGGLEVVNAFSELNDPIDQKKRFEEQIERKEDG--EKHPYDEDFIKALEYGMPPTAGWGMGIDRMVMLLTGSKTLREILFFPFMKP.. 353
145 0.000e+00UniRef50_I0UWN4 Lysine--tRNA ligase n=79 Tax=Actinobacteria TaxID=201174 RepID=I0UWN4_9MICC  ali  37  611..........QTRRSEQTRHRIRHAELLRSAGMPYPLGVRCDYSVEKLTNI---LHSGNISV--EEFTLSGRVRFIRNHGGVVFLTLIENGRTLQVVIERAAVGAQALRLLSQTVDTGDILLITGSMGTSRNGTVSVLASNWRMVSKCLHPIP--FDSFTDPEARLRRRSTDLLVNPEQVQNLRMRSAIITSIRRTLDTEGFTEVETPILNTVHGGASARPFKTFINAYGADLTLRIAPELYLKRLVVGGMGAVYELGRDFRNEGADNTHNPEFTVLEAYRPYADYTDMRHLTERIIKNTAQAVYGQCVLPLGAKLDDVSGAWPVVSVCEALSAAVGTTI-TLDTDFETLLALAREHEIHVRDDMGAGAVIEELYGELVEAKTVFPTFYTDFPVETSPLAGAHRSVLGLVERWDLVINGMEMGTAYSELADALVQRERLVAQSLKAAAGDPEAMQVDEDFLYALETGLPPTGGLGIGIDRLVMLMAQTQ-IRGVLSFPFVKPLK 1102
146 0.000e+00UniRef50_A0A2D6DRM3 Lysine--tRNA ligase n=2 Tax=Parcubacteria group TaxID=1794811 RepID=A0A2D6DRM3_9BACT  ali  42  1...........MSINEIRKTRIRKLENIRQAGNPYPAQVKRTHTCQEAIDSFEKLLADKEGLF-----LVGRLQAIREHGGSTFTQIRDGSGEIQAYFKKDQIGDKEYKFFQDNFDLGDFVEAQGELFLTKKGEKTLLVKDYRILTKGLLPLPEKWHGLKDVEERFRKRYLDLIMNKETKEIFKKRSEIIKKLRGLLESNKFIEVETPILQSLYGGASAKPFKTHLNALDMELYLRVAPELYLKRLLVGGLERVFEIGRCFRNEGMDREHNPDFTMLEFYAAYWDWEDLMKFVEQIMHQLDAKVFPE--------------KWDRVEYKDVVKN-------------------------------------DDIKGSFA--KLEKPTFVLHLPDI--PLCK-------DGQAFQGIVQGVELFKAFSEQNDSMEQRKVFEQQEALRKKGDEEAQRLDSDFLEALEYGMPPAAGIGIGIDRLAILLTEARSVRESILFPLMKPK. 426
147 0.000e+00UniRef50_A0A1G6GDL3 Lysine--tRNA ligase n=1 Tax=Raineyella antarctica TaxID=1577474 RepID=A0A1G6GDL3_9ACTN  ali  34  595.ETVRPLAELHPSRDDQTRHRLRHLEELTASGRAYPGRTEVTRLAEAAL----PSLDDSPAADAPTLSLAGRIRTIRDHGGVCFADLVDGRARAQLLLDAGVLGHDEVRDFARMIDSGDLVQVEVRPVTSRTGTPSLQVASWRMLSKSLRPVP--WQGFDNPDARLRNRSLDFVVHPDEADLLRARSRAIEAVRTTMREAGYQEVETPILQTVHGGASARPFRTTINAYSTDLVLRIAPELALKRLLVGGLGPIFELGRNFRNEGADATHNPEFTSLEAYEPFADYTDMRLLTERLVRAAAMAVHGREAVPLGNEMVDISGEWAVVPVCEAVSEAVGRPV-DLDTDMEVLLELAREHEVHVRDDWGAGALIEELYGELVEPVTVLPTFYTDFPAETSPLSGPHRTKPGLVERWDLVLGGMELGTAYSELTDPIEQRRRFVEQSWKAAAGDPEAMEVDEDFLRALEVGMPPAGGMGIGVDRLVMALV-ARPIRDVLTFPFVRPQ. 1096
148 0.000e+00UniRef50_UPI00049131C6 bifunctional lysylphosphatidylglycerol synthetase/lysine--tRNA ligase LysX n=1 Tax=Pseudonocardia acaciae TaxID=551276 RepID=U  ali  40  590..EAAQARYPRRRLTEQERVRHAKLDALRARGDAYPPASRPADDPAELARELAGLPPD--RRTGRDAELSGRVLRQRDHGRLRFVELRGTNADLQVMLSADTT--ACFDLWENTVDLGDQVAVSGEMITTRTGELTLHARSWWMAAKCLRPLPRR----LDSDARRRRRHLDLIVNADARRMLRLRCAAVAALRDELRGRGFAEVETPILQPVHGGAAARPFRTWMNALGADMYLRIAPELYLKRLLVGGSGPIFELNRTFRNEGLSARHNPEFTMLEAYQPYADYHTAADLLRDLVVAAARAALGTTVVERDGLRLDLAEPWRHTTVYGAVSDQLGQEI-TPATPRDRVAGLAEAHGVDPDPGWGQGRLVQELFERLVEEHLVAPTFVHDYPAETSPLARRHRDDPLLSEKWDLIAFGMELGTGYTELNDPVDQRDRLTEQSLLAAGGDPEAMALDEDFLAAMEYGMPPACGLGMGVDRLIMVLTG-RTIGDTILFGPAR... 1080
149 0.000e+00UniRef50_A0A2L0EN74 Lysine--tRNA ligase n=19 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A2L0EN74_SORCE  ali  46  30................LIATRKAKAARLRARGNPFANDVEPLTELAAVRARFDGDRYDPARVEPLPFRVAGRVLFVRSFGGVTFVRLRDRTGELQLYC---EQGSLADFERLEDVDLGDFVEAHGVAMATQKGELSIRAERLRLLTKAYRPLPTKTS-FKDVEARYRMRYVDLVANPHVAGVFRARTAIVAALREFLDARGFLEVETPTMHTLVGGAAAKPFKTHHNALDLELFMRIAPELFLKRLVVGGFERVYEIARCYRNEGLSTRHNPEFTMLEYYQAYATYETLMDATEAMLRHVDARLAERLPAEWAAQRPYSLDRFARVPMAEGLARALERDDAPIKEWAKAAKAAGREIDWTAKKCESPGELVFCAYEYVVEPFLTRPVFIIDYPFEVSPLARKKDSDPALVDRFELFIEGRELCNAFSELNDPEDQDARFRAQVAKKSRGEEETMDYDADYVRALEHGLPPTAGFGMGIDRLTMLLTGATSIRDVILFPLLRPE. 570
150 0.000e+00UniRef50_A0A0I9W5K2 Lysine--tRNA ligase n=3 Tax=Enterococcus cecorum TaxID=44008 RepID=A0A0I9W5K2_9ENTE  ali  38  12.....................................................SIDEFKKSVEGTEFCFAGRLTKLRIFGKLIFATLSDIEGNLQISFESSKLNKEMFQKAKKELHTGDFIGVKGVIYFTKKMEKTISVNEFEILSVSIRELPEKFHGVTNKEIMYRQRYLDLIANEESRKVFLKRLEILSEIRRYFSSNKFLEVETPILNMTSSGAAAKPFITHHNSLDKDLYLRIAPELYLKQLMVGGFTKIFEIGKNFRNEGVDTTHLQEFTMIEWYAAYWDFNDNIEFSKELLCTVVRLVSDNLKVEYKSDIIDFNK-WAELDYTSEMNRVLGIDILNVNS-LEELQKHCLKFNIIDSSDINKAKLIDAIFKRKVRPYIIQPTIVYNYPRIMVPLARINDEDERLIDMFQIIVCGMELVKSYSELINPFQQIVAFEEQEENKKNGDEESMDIDWEFIKAMEYGMPPMSGAGLGIDRLVALLLNKESLRDVIFFPNVR... 461
151 0.000e+00UniRef50_A0A1G2Z7Y4 Lysine--tRNA ligase n=1 Tax=Planctomycetes bacterium RBG_13_63_9 TaxID=1801965 RepID=A0A1G2Z7Y4_9BACT  ali  40  6SDQSTSGAET------LEAARREKLHKIQQLGIPWGQRFDGHLPIGEIRIREDEIVVEPPAVHGPTVRAAGRIVLQRKAGKLIFIDIRDWTGKIQLLLGKNQVGERNW-DLAQCLDLGDIIGVDGELSRTRTGEITIFVEQLHFLAKSIEPPPAKHKGLKDPELRQRMRYLDMIHTEGVLERFLRRTKIVQSIRNTLAAEGFVEVEGPTLHAIAGGAAARPFTTHHNALDIDLFLRIALELHLKRLLVGGIERVYELGRVYRNEGISPRHNPEFTMLEVYQAYGNYQTMMELTEKLVVDAIEATGQDLKLPFGETQLDFTPPFPRRTYNELFAEHTGVP----ADDAAAVKTFAEQVGLDTAGKHG-DVIKNEVFEARVESALSGPVFVVDYPESICPLTKRKADNPAIAERFELFIQGMEVANAYTELNDPDLQEELFSRQLEGLAEEDSMA-TMDRDFIRALRHGMPPAGGLGIGIDR........................ 482
152 0.000e+00UniRef50_A0A1Q5Q2K9 Lysine--tRNA ligase n=1 Tax=Actinomyces nasicola TaxID=208480 RepID=A0A1Q5Q2K9_9ACTO  ali  36  576.....AEPVVERKVPEQVRVRTDKARALIESGNPWPVGS----------SNPDPTTAIATAADGTELTIQGRATRIRDFGSIVFLVVRDWNGQCQVMVESGAAEAHEFA--RRQIDLGDQIEVAGTRCVSRSGEPSLSATQIRMTSKSLRPMPDKHHGLTDPEAQVRLRHIDLAINDATRETLKARSTILASLRKTLMDEGYLEVETPILQPIHGGANARPFTTHINAYDLDLYLRIAPELYLKRLCVGGVDRVFELGRTFRNEGVDFSHNPEFTILEAYRAHADYIDMLHTIRRMIQNAAIAVHGECVVPGPGTMVDISGEWPIVPIYDGISAGLHLAPITTETSVDDLQVICDALDIAYRPDWDHGDIVLELYEHLVEDRTTSPQFNIDFPLSVSPLTGMHRQNPKLAERWDLVAWGVELGTAYSELTNPIDQRDRLTEQSVKAAGGDPEAMELDEDFLSALEFGMPPTGGLGMGVDRVVMLITG-KSLRETLPFPLVKP.. 1067
153 0.000e+00UniRef50_A0A1F6EH42 Lysine--tRNA ligase (Fragment) n=1 Tax=Candidatus Kaiserbacteria bacterium RIFCSPLOWO2_01_FULL_53_17 TaxID=1798511 RepID=A0A1F6EH  ali  46  1.....................................................................................................................GDFVEVRGSLFLTKRGEKTLAVGDWRMLAKALRPLPDKFHGLADAEERQRRRYLDILANPEARERFLLRSHTVSFLRAELDRAGFLEVETPALQPLYGGASAEPFTTHHNALDQDLYLRISDELYLKRLLVAGFPKVYELCKDFRNEGLDATHYPEFTMLEWYESYSDALKQRKFVEELFRTLVRDIKKESSVSYSGETIDFLKPFRVVKYFALLEENTGVPNLKEVTLPE-LRGHAEKLGAEFAPEDGRGKILDILYKRFCRPKLLQPTFVIDYPADAFPLTKKKEDDPSLVDMFQLVIGGLEIVKAFSELNDPREQRERFLAQDVLAGKGDKEAQPVDEDFLEAMEHGMPPAGGVGIGIDRLVMLLTGTQNIKDTILFPTMRP.. 384
154 0.000e+00UniRef50_A0A261Y4C1 Lysine--tRNA ligase n=1 Tax=Bifiguratus adelaidae TaxID=1938954 RepID=A0A261Y4C1_9FUNG  ali  34 1182..ESDSRPTKDMRLNHFASDRI----------DPYPRYKHPDTSTREFAERWDHLSPSERVES-ESIALTGRVVSKRASSKLVFYDIVQDGFALQVVANHYNGSLDSFSALNRLICRGDILSITGIPGKTQKGQTSLFATSAQLLAPCLHDIPR--TGLKDPEKRFRNRHVDFLVNPQASNILRTRSKIIASIRHYLESKGFLEVETPILSSQSGGANAQPFVTTAHALDMSMQLRIAPELYLKQLVVGGFDKVFEIGKQFRNEGIDADHNPEFTTCEFYYAYANLETLYSLTEDMVKDVAKSISPENAAEAIPPVLDLSKSFRRLHVLDELERVLGLDNTSESDAIQALLDLAASHNLTIPKPHTLTRVLDKLISEYIEPQCIEPTFLYGHPVCMSPLAKAMTDNRGRSARFELFLQGKEIVNAYEELNDPQEQRERFAKQQLDRQSGDVEAQLPDAAYCDALEFGLPPTAGWGMGIDRLVAILTGAKHIREVLAFPVLR... 1682
155 0.000e+00UniRef50_A0A2N6AC64 Lysine--tRNA ligase n=2 Tax=unclassified Parcubacteria TaxID=1046984 RepID=A0A2N6AC64_9BACT  ali  39  4........QPELNINDEREIRLKKLADLKESGIPYPAHTENNHSVSEAL----------GMKAGESVQVSGRIMTKRDMGKLTFCHLQDESGKMQIAFKQDELGNENYKLFTKKIDIGDIILIDGERFQTHKGEESVLIKTWTLLSKAILPLPDKFHGIQDEELRLRKRYLDLLLNPEIRDMFYKKAKFWDVTRTFMKEKGFFEVETPYLETTTGGAEATPFATHHNDFDLDVFLRISGELLQKRLMAAGFEKTFEIGKVFRNEGSSPDHLQEFTNMEFYWAYANYNDGMKLTQELYQRIAEEVFGTTKFKTKEYEYDLAGEWPHVEYAKEIKKQTKIDITKA---TEDEMKKKLEKLKVKYEGDNKERLTDTL-WKYCRRNIAGPAFLINHPKLISPLAKARPEDLETTERFQVIIAGSEVGNGYSELNDPVDQRERFELQQKLIERGDDEAMMPDFEFVEMLEHGMPPTCGFGFG-ERLFAFMMDKP-IRECVLFPLMKPE. 484
156 0.000e+00UniRef50_A0A1Q3NLX8 Lysine--tRNA ligase n=4 Tax=Bacteria candidate phyla TaxID=1783234 RepID=A0A1Q3NLX8_9BACT  ali  37  1..........MSTLKDFRDERLRKLADLKELGNAYPSQSHRTHNAGVVKNDFDSLE-------NQVVTVTGRVMGIRKFGKLAFIVLRDQTGEIQLFLQAGKVGERNAAEDLPLLDTGDFLEATGPVIKTKTGEVSIEVQALRLLTKALRPMPSAQEGFTNKEERMRRRYVDMNVNLDVRERFVRRSVFWQATRDFLNQHGFVEVNVPVLEHTTGGADANPFVTHMDALDQDFYLRISHELPLKRLLGAGFEKVYDIGPRFRNENYSDEHLPEHVAMEWYWAYANWQDGMQFMEAMYKDVLQKTFGTLQFKLGRFDVDMGGEWEVWDYATVIKDRYGIDVYESS--LDDVKKALVDNKLEVEQTENRARGIDKL-WKNIRKDVAGPVWLINTPKFISPLAKSNPEDDRVVQRFQPVIAGSELGNGFSELNDPIDQLNRFVEQQNMRDAGDDEAMMLDIDYVEMLEYGMPPACGWGYS-ERVFWIFEGV-TAREGVPFPQLRQE. 488
157 0.000e+00UniRef50_A0A258G8I1 Lysine--tRNA ligase n=4 Tax=unclassified Saccharibacteria TaxID=1895827 RepID=A0A258G8I1_9BACT  ali  35  1..........MATLKDFRDERLRKLADLRDLGNPYVAEANRTHRTADVLGDFDELK-------GQSVTVSGRIIAIRKFGKLAFIVIKDQSGQIQLFFNESVVSDRDVAQDIPLLDTGDFIEARGVVDKSKTGEISIFVDEFRLLTKTLRPMPSVVDGFTNKEERMRRRYIDMNVNSDVRDRFLRRSRFWQATRDYLNQAGFIEINTPILEHTTGGADATPFVTHMDALDQDFYLRISQELPLKRLLGAGFEKVYDIGPRFRNENYSDEHLPEHVAMEWYWAYANWRDGMAFMEKMYRQVLEQTFGTLTFKLGDFDIDMSKDWEVWDYATVIKDRYGIDVFD--STLDEVKAALTANGLEVEQTENRARGIDKL-WKHIRKDVAGPVWLINTPTFISPLAKTDPQDDRITQRFQPVIAGSELGNGYSELNDPVEQLRRFREQEAMRQAGDDEAMMLDIDFVEMLEYGMPPACGWGYS-ERVFWIFEGV-TAREGVPFPQLRTE. 488
158 0.000e+00UniRef50_A0A2H0U715 Lysine--tRNA ligase n=19 Tax=unclassified Bacteria TaxID=2323 RepID=A0A2H0U715_9BACT  ali  35  6...............EIRAEREKKLALLRSAGMPYPVSTERDSTIAELLEEFDALE-----QSGTTRTIAGRIASIRGQGGITFVDVIDGTARVQLVLNRKEMDAARFDLFQEAVDQSDFIQATGAAFRTKRGERSLSVIKWKMLAKSLRPVPDEWYGVKDEELRLRERYLDILLNEDVRAMFERRAAFWQVIRTFYLQRGFLEVETPVFENSPGGADARPFITHHNALDMDVYLRISLELWHKRLLVAGYPKVFEIGRVFRNEGQSREHLQDYTMLESYEAYMDMQRGMHMVQELYRAIASEVYGTHSFSMRGHAVDLAGQWNTIDYSSAIRDAYGIDPLECTE--AEAISSAQSAGVLAENTGRNKARAIDNLWKRLRKDIAGPAFLIGTPVYLEPLAKRSASDERVVERMQVIIAGSEVGKGFSELNDPLDQRARFEEQQKLREGGDEEAQRLDLEYIRAMEYGMPPAFGFGVS-ERLFAFFEDTPA-HESQLFPLLKPRQ 486
159 0.000e+00UniRef50_A0A1L7CEA9 Lysine--tRNA ligase n=3 Tax=Corynebacterium TaxID=1716 RepID=A0A1L7CEA9_9CORY  ali  37  575..EQAKAHIPERRVPEQVRHRMAVRENILAHGDAYPAHFDREYSLEDL----------AQLPAGSPVTTAGRIIGRSDHGGVIFLRIQDFHGATQIICERDTLGQETMTRLRRELSIGDHIGARGTTGTSRTGTPSIIATSVTLTAKSLRPLPNMHQGLSNEETKVRQRYLDLIVNEDARRQVEARSAIIHSLRSTLMGEKFLEVETPLLQTIHGGANARPFKTHINAYDMGLYLRIAPELYLKRLMVGGVDRVFEIGRNFRNEGADATHNPEFTMLEAYAAYGDYNSMRELTRELIINAALAANGHTRVTGRGHSIDLADPWRVVTVHGGIAEATGRNI-TPDTSKEELIELAAEYAVPVDPEASRGAIVIELHEHLAERFAIAPTFFCDFPTDVSPLTRQHRTDPRVAEKWDLICFGAEVATAYSELIDPVIQRQRLVNQSLLAAGGDPEAMEVDEDFLLALEYAMPPSGGMGMGVDRLVMMLTE-KNIRETIIFPLVKPQQ 1070
160 0.000e+00UniRef50_A0A2A4RJU5 Lysine--tRNA ligase n=14 Tax=Bacteria TaxID=2 RepID=A0A2A4RJU5_9BACT  ali  41  27..QETIGAADAVDIHHLEQQRRDNRDAVIALGMPYGERTDDLVTLADAHALYNEDADKANKESNQRVKVAGRVMLHRDNGKLIWLNLRDHTDTFQIAASKRDCDENGFK-LAKVLDGGDLVIAEGPLTMTNTGEVTCWVDTLIPASKCLVPPPEKHAGLQDTERRYRQRYMDMWANPDTTRVLILRSKMMSAMRRFLERQDFIEVETPVLQVQAGGAAARPFMTHMNALSLDLSLRIAPELYLKRLLVGGMPRVFEVSRNFRNEGLDKSHNPEFTSLEVYQAYGNYETMMELTEGLIRELAQLAASEPAMPFGNLVIDYAAPFEKITYAELFEKALGFSI----DEIDKARAECEKRGFKTKSKDGTAFIINELFEEVAEHMIDRPTFVMDYPASLSPLTRPKPGTENLADRWDIFIGGMEIGPAYTELNDPDIQEEKFREQLAGVDDEESTFRTFDEDFVNALKVGMPPAGGLGLGMDRIVMLMANQRSIRDVLPFPMMKP.. 566
161 0.000e+00UniRef50_UPI000B53D02C lysine--tRNA ligase n=1 Tax=Haliangium sp. UPWRP_2 TaxID=1931276 RepID=UPI000B53D02C  ali  46  24................QMTARRKTVQTLRDHGNPFANDAPITHQISEADQVASLPLDAEVNATQPRYAVAGRLLQVNEMGKAKFLFLRDRGSMLQLYLRAEN--AEAFA-LSGSLDLGDIVWAHGPLFRTRKGKRALLVEDLRLLTKAIRPLPGKGEKATDDDWRYRQRYADMIVHPEAAEVFRKRATIVREMRHFFDERGYVECDTRMLLPTNGGAAARPFRTHMNVLNLDLNLRIATELDLKRLVVGGIDRVYEIGRIFRNEGLSRFHNPEFTTIEFYQAYATYADLMDLTEALFERLCLAVNGTTTIDYQEHKVQLARPFRRATMRQLVKQARPDAPIADGPCTDAEWAALPGYAKQVDASPEYGHCLVALFERFVESSLVQPTFVCEFPTVVSPLSRKNDRDPRFVDRFELFVVGKEIANAFSELNDPDDQRERFLSQVAAKQRGDHEAMDYDEDFCRALEYGMPPTAGEGIGIDRLTMLLCNQASIHDVIPFPQLRPES 532
162 0.000e+00UniRef50_A0A2H6AAB4 Lysine--tRNA ligase n=1 Tax=bacterium HR35 TaxID=2035430 RepID=A0A2H6AAB4_9BACT  ali  36  4.....................LEKLKLIKEKIDPYPADSPSRKEIKEVIDNFKAYFKNK-----KKFWLVGRIMAIRDHGKIIFLDLKDFTGRIQIILKKEET--KDFSIFQDIADIGDFFGFYGSVFLPVTKEKSFLAQKWILLSKSIKNFPREYYKVRDEELLVRHPYLKTIFYDDERLTFYYRFRLLEELRKILWQEGFIEVETPILQTHYGGALARPFITYLEALKEKLYLRIAPELYLKKMIVGGFEKIFEIGKNFRNEGIDREHNPEFTMIELYWAYQNREGLMKFTQKIIQELVRRYNKLRKIEFQGKKVNLAGNWQVLKYTEVIKQATGLDYFQ-SSLDDFLKIAKKEKIEFNPKIINKGKIVDEIFKKLIRPKLWEPTFLIDHPKEISPLAKSHPQNPELTLRFQLYLCGFEIANAFGELNDPVDQKERFLAEAEELKKGNLEAHPFDETFITALEYGMPPTAGLGIGLDRLFTILLNKSTIKEVIYFPFVKKE. 484
163 0.000e+00UniRef50_A0A0C9N3C5 Lysine--tRNA ligase n=1 Tax=Mucor ambiguus TaxID=91626 RepID=A0A0C9N3C5_9FUNG  ali  37  70...................................PEKHGKWITAKDLL-KYQPLEKGK-KAEDDLVTLTGRIISKRESSKLIFYDIMQNGESVQVVASRGRFSPEDFADKNRDLCRGDIASFTGVPGKTNHGQLSVFVTKMQVLTPCMQDIPR--TGLKDPEKRFRARHLDLLVNPESSKILRTRSKIIRFIRDFFDKRGFLEVETPILSGKAGGANARPFETHAHAMDMDMQLRIAPELYLKQLVIGGIDRVFEIGKQFRNEGVDADHNPEFTTCEFYQAYGNLEGLMKDSEALLSEMAECVCGQTPILLKGEEINFRDPFRRINVMDRLSSELGTSFLESKDALSQLTSLCHAKGIKLSGPLTLARILDKLISEYIEPECIQPTFLYNHPLALSPLAKIDAKGQTVAARFELFVGGKEIVNAYEELNDPQEQRKRFKMQLQDRQDGDLEAPLPDTDFCDALEYALPPTAGWGMGIDRVVQLMTGATHIRE........... 532
164 0.000e+00UniRef50_A0A0D2X2W4 Lysine--tRNA ligase n=2 Tax=Capsaspora owczarzaki (strain ATCC 30864) TaxID=595528 RepID=A0A0D2X2W4_CAPO3  ali  37  129................................NPWPAA--RQTTIAEFLRENASKKPDELAPQEDMIALSGRIDSKRSSAKTLFYHLVHGEHRLQIVCTERRHDPEEFALLRTGLHRGDIVHVVGYPFLTQMGELSLASVRTRVLAPCIPDIPFK---LTDPDIRARQRALDMLANPQLIRMLKTRHAIFRSIRRMMDAQGFIEVETPSLCALAGGANARPFITKARASGHPLNLRIAPELYLKQLVIGGIDRVYEIGKQFRNEGMDADHHPEFTTMEMYQAYANFDDLFDFTESLLVSTLNEAKQADKISYQGQTISFQRPFKRISIMPALEEALGEPLPDAPTATQDLINLFERRKFHLPQPPTIPKMIDELVSLFLEPQCINPTFLCYHPKAMSPLARESPENPALSLRFELFVNGFEICNAYAELNNPHEQRARFAEQAKARDAGDDEAQPMDSAFCDALEYGLPPTVGWGMGLDRLVMLLTDSANIREVIPFPMLRPLS 631
165 0.000e+00UniRef50_A0A0G1R4C6 Lysine--tRNA ligase n=23 Tax=root TaxID=1 RepID=A0A0G1R4C6_9BACT  ali  32  2.............LEDIMREREKKLTRYEGKISAYPATVKKTSRIKDVVSGFSKMAAAKR-----KISLCGRIFSWRDQGKIIFADVRDECGKIQAVLKIGETDNVDF--LKETVDAGDFVEVTGTLFTTKRGEKSILAKKFRVISKSLRPIPSSWYGIEDAEIKFRKRYLELLIDDDLKEVFRKKRVFWDEMREFLKENGFFEVEMPVFEAIPGGAEAEPFVTHHNALDRDFYLRISLELPLKKMLVAGFDSVFEIGRIFRNEGIDKEHLQDYTQMECYRSYWDYRDMMKFVEAMYKRVIKKTFGMLSFDRDGKKISWSGKWPEVDYYKIFLKKTGLDLNSAS--KKDLARKALELGAKPEVSFGRGRLIDLVYKKAIRPGLVAPCFLVNPPVDVEPLAKRSPTDQSRVERFQVLAFGTELGKGFSELNDPRDQRARFEEQMKLRAEGDAEAHRIDDDFLEALEYGMPPAAGFGVS-ERLFSALANKP-VRETVIFPLVREE. 480
166 0.000e+00UniRef50_A0A2P4TFC3 Uncharacterized protein n=1 Tax=Bambusicola thoracicus TaxID=9083 RepID=A0A2P4TFC3_BAMTH  ali  39  105SENNIGADEESLDPNQYYKIRSHAIQQLKGTNDPYPHKFHVDLSLSDFIE------------SKTAVT--------------------------EFCNYRLYKSEEEYFRINNKLRRGDIIGVVGNPGKTKKGELSIIPYEITLLSPCLHMLPHLHFGLKDKETRYRQRYLDLILNDYVRQKFITRAKIVTYIRSFLDELGFLE----------------------------------------MLVVGGLDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYRDLMEITEKLLSGMVKHITGSYKISYHPDEIDFTPPFRRISMVDELEKTLGVKFFETEETRRFFDDLCAVRNVECPPPRTTARLLDKLVGEFLEVTCINPTFICDHPQIMSPLAKWHRIHRGLTERFELFVMKKEVCNAYTELNDPFQQRQLFEDQAKAKAAGDDEAMFIDENFCTALEYGLPPTAGWGMGIDRFTMFLTDSSNIKEVLLFPAMKPE. 542
167 0.000e+00UniRef50_A0A1Y1YVT2 Lysine--tRNA ligase n=2 Tax=Fungi incertae sedis TaxID=112252 RepID=A0A1Y1YVT2_9FUNG  ali  37  2............................................................KLEEEAFTTAGRIISKRESSKLVFYDILQNGSTLQAVATRRYFDNDEFAQINKTLHRGDIVKITGIPGKTNTGQMSVFITEFELLSPCLHDLPL-HTGLKDPEKRFRNRHLDFLVNREAVDILRNRAKIIQFIRQYFDSRSFLEVETPILSPKAGGAIARPFTTKANALDLDMHLRIAPELYLKQLVIGGIDRVYEIGKQFRNEGIDADHNPEFTTCEFYQAYTNMEGLFKTTEDILSGIVFNIKNSHVVEMDGIPISFKPPYRRIYIVDELENQLGTKLPPFRDESEMYLDLCHKHNVPLSKPYTIPRILDKLVSHFIEPMCVQPTFLCGHPMIMSPLAKAIDKGSEITGRFELFVAGKEVVNAYEELNDPEDQRSRFSQQLKDRNSGDVESQLPDDAFCDALEYGLPPTGGWGMGIDRVCAMITGASHIRETLAFPTMKP.. 453
168 0.000e+00UniRef50_A0A1N4IJ28 Lysine--tRNA ligase n=2 Tax=Actinobacteria TaxID=201174 RepID=A0A1N4IJ28_9MYCO  ali  38  54...PEPAPTGRVRVSDQVRHRLGVRDAMLEAGV-------------------EPYPAEAAPAAAKGTVLTGRVLGIRDHGGVVFLDLRSEGHDHQLVCEREVLGEESLRRLSAWVSRGDRISVSGREGTSRNGTPSFLVTSWTMSAKSLQPWPSLWQGLSDPEAKVRQRYLDFTMNTGQRDLMVIRSNTFRTIRETLQSRGFLEVETPVLQTVHGGANARPFLTHINAYNLDLYLRIAPELYLKRLLVGGFDRVFEMGRNFRNEGVDATHNPEFSMLEAYQAGGDYNTMRELTRTMVINAAEAALGTTVVRGTEHEIDLAEEWRTVSLTDAISEKIGEEVSTA-TSIETLRRIAARTGLTVNPKWGWGMLLQEIYEEVAEGSTVAPTFYTDFPAETSPLTRQHRTDPMLAEKWDLIIFGSELGTAYSELVDPVLQRERLTAQSLAAAGGDPEAMQLDEDFLTALEYGMPPAGGMGMGLDRLVMLLTEQ-TIRSTITFPLAKPK. 536
169 0.000e+00UniRef50_A0A1H3W7L4 Lysine--tRNA ligase n=1 Tax=Actinomyces nasicola TaxID=208480 RepID=A0A1H3W7L4_9ACTO  ali  37  588...........RRVPEQVRVRTDKARALIDEGIPWPVGASSPQHAAKLLE----------AATGASLTISGRVIRQRNFGSVVFLVVRDWSGQCQVIV--DAGAPEALDFIRSNVDLGDLIEVSGSRGESRTGEPSLLATDVRMIAKCLRPLPDKYHGLTDPEAQVRQRHVDLAINDEARRTLAARSAILNSLRASLLAEGYLEVETPILQPIHGGANARPFTTHINAYDLDLYLRIAPELYLKRLCVGGVERVFELGRTFRNEGVDFSHNPEFTILEAYRAHADYIDMLHTIRRLIQNAAIAVHGECIVPGDGQMVDISGEWPIVPIYDGISDALHLAPITTETSVEDLQQVCEGLDIAYRPDWDHGELVLELYEHLIEERTTTPQFNIDFPLSVSPLTGTHRHNPKLAERWDLVAWGVELGTAYSELTNPIDQRDRLTEQSVKAAGGDPEAMELDEDFLSALEFGMAPSGGLGMGVDRVVMLITG-KSLRETLPFPLVKP.. 1073
170 0.000e+00UniRef50_A0A2E2AN32 Lysine--tRNA ligase (Fragment) n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2E2AN32_9CHLR  ali  46  1.................................................................................................................DLDIGDWLGIKGPMFRTRTGEITVEVREFEVLAKSLRGLPEKFHGLTDTXTRFRQRYLDLIANPQAREIXIMRSRAVSVIRRFMDGRDFIXVETPMLVPVAAGGMAHPFETHHNALNQDLFLRIATELYLKKLIVGGLERVYEIGRIFRNEGIDLNHNPEFTTMESYESFADYNDVMNMVEELVXTVATEVFGASVVEYGGETIDLXPPWPRLSLVEQIKLHSGIDILECP-XTETLXTEMQAAGXDVSAATSWAGMVDKLLSDRVEPHLIQPCFLVXYPVAMSPLAKKKPGDDRIVERFEAFAAGMELANAFTXLXDPVXQRSRFEDQELQRXQLGEEWDRLDEDFLTAVEHGMPPTGGLGIGIDRLIMLLSGHQSIREVVLFPQLR... 388
171 0.000e+00UniRef50_C7DCH1 Lysine--tRNA ligase n=1 Tax=Thalassobium sp. R2A62 TaxID=633131 RepID=C7DCH1_9RHOB  ali  42  1..........MTDSNKYQRF-----ADLRAQGVPFPAKRVDYVYAADLQSKYAELPDGEVTED--VVTVAGRIHAIRNSG--MFVDLRDATGRIQVY--SDVKGGGPIAEMLALMKVGDFASVEGVVRRTGRGELTVNSTDVKLQSAMIGEMPDKHHGMSDVEAIYRARYIDLVSNQDSKDRFLARSKIVRAIRRTFEGMDYVEVETPMLHPISGGAAARPFTTHYNALDSQFYLRIAPELYLKRLIVGGLAPVFEINRNFRNEGVSKKHNPEFTMLEAYEAFADFETMKQRIAEICEAACVAVNGSTTATYQGTELSFKAPFQEIEMAELIKNTLGIDFREIPDAAAARAAMAEK-GVEVPADATWGECMEVAFDEYGEATLIQPTHVTMYPSEISPLSKPCLDDPRFCERFESFANGWEIANAFSELNDPEKQLAIFEGQVAQDASRGETEREVDYEYVAALDFAMPPTGGLGLGIDRLAMLLTDATHIKEVILFPTLR... 481
172 0.000e+00UniRef50_A0A2N2EUD0 Lysine--tRNA ligase n=3 Tax=unclassified Elusimicrobia TaxID=1797919 RepID=A0A2N2EUD0_9BACT  ali  43  3...................ARKEHLKWLKENSIEYPVLSGKSENIAQIKERFE--KDGESFDA----SVSGRVTAVRLMGKAAFAEIFSGGNKIQMYIKRDEIPDD-FNVFKKT-DIGDFANVSGFVFKTKMGETTLHTKKFTFLCKSARPLPEKWHGLKDEEQILRKRYLDILTHERSRNNFKARSRVISGIRKFLDEREFMEVETPILHGIAGGAEAEPFKTHHNALDLDLSLRIAPELYLKRLLVAGYDRVYELGRNFRNEGISTRHNPEFTMLELYQAYSNCQGMMDLCEELIKDAALRAFPGEEP-----AIDINKPFRRIAVFEALLEKTGINFEGNLE-RAFLAESASKLGIEFEKDASAPKIFENLSEGILLEGVTEPVFMHDFPEEFSPLAKPKPGTK-IADRFELYMNGMEIANAYSELNDPAKQRENFEAQVSDASAKN-----IDEDFLEALEYGMPPAGGLGIGIDRLVMVLIKSASVKDVIIFPQLKKK. 467
173 0.000e+00UniRef50_A0A2B4REV1 Lysine--tRNA ligase n=1 Tax=Stylophora pistillata TaxID=50429 RepID=A0A2B4REV1_STYPI  ali  50  2..................................................................VVLSGRMMSRRLMGKASFAEIKDASGRMQIYINRDEICPEEDKNFKKLLDIGDIIGVEGTVFKTKVGEISVSVKKLSLLSKSLRPLPVVHDAFSDAELRYRQRYVDLIVNDDVKDTFIKRTKITNSIRQFFNERGYLEVETPILQPIPGGAAARPFVTHHNALNIPLYLRIANELYLKRLIVGGFDAVYEFAKDFRNEGMDKTHNPEFTVMELYVAYKDYRWMMGMTEQLLERVAVDSKGGTEVTVGDEKINFKAPYPRVPILEAIKIHTGFDVSEMDEIG--LRGVCDKLNIPTDETMGIGKLIDEIFGEKCEHHYIQPTFITDYPKEMSPLTKTHRDNPRLTERFELMVNGKELANAYSELNDPIDQKERFQSQLALAEKGDDEAMFIDADFIRALEYGMPPTSGIGIGIDRL....................... 427
174 0.000e+00UniRef50_A0A0G1HZ34 Lysine--tRNA ligase n=60 Tax=root TaxID=1 RepID=A0A0G1HZ34_9BACT  ali  36  2..........ASRLEEILKEREKKVETLKLMGIEYPARSEKQAENQSIVDNFEKY-------DGKEMVLAGRIMAWREHGKLIFGQIQDQSGRIQLFIRADAMGPTDKEEDLELLDIGDIIQAGGHIVKTRTGEVSLQVSVIKLLAKSRLPLPDKWAGIENPDEAFRKRYLDLLMDPEKMRRFERKAKFWEVTRSFLKNKGFIEVETPVLESVTGGADAKPFVTHMNAIDQDFFLRISTELYQKRLIGAGYEKIYTIGPNFRNEGMDDEHLPEYYQCEWYWAYADYRDNMELVKELYRYIAKEVYGKTKFVSRGMEYDLAHEWTEIDYVEIIKGKLGIDIFKSTD--EEMLAAVKKAGVVLTGAINRSRLIDN-CWKIIRKSIAGPAYLINEPKFMSPLAKSKPENPELTERFHVIIAGSELGNGYTELNDPEDQRQRFEEQQAQREAGDEEAQMLDTDFVEMLEYGMPPTSGWGHS-ERLF-WFLEDVSGREGVLFPPLRVKK 490
175 0.000e+00UniRef50_A0A163RTE5 Lysine--tRNA ligase n=4 Tax=Oerskovia TaxID=162491 RepID=A0A163RTE5_9CELL  ali  35  618.......SAPTRRLTEQQATRHAKLGVLRAAGMPYPVSVPRTVSIGEAVRRGTHVPDGGAPAGATTLSVVGRVVRLRDHGGVIFADLREGTDEIQVMFTADRPGPD-LALWRRAVDLGDQVSVTGDLTRSRRGELSLHGTAWCMASKALTSPPDKHRGLADAEAKVRLKHMELALDTRTAQVLRGRSAAVKSLRDSLAAREFIEVETPILQRVHGGANARPFTTHINAYDVDLYLRIAPELFLKRLAIGGVGKVFELGRNFRNEGADATHNPEFTSLEAYQAYGDYTSMRVLTRDLIIEAAIAVHGEPISRRDGTVVRLDGEWPVHTVHGAVSRAVGQEV-TPDTPLETLQAICEEKGVHWTPTMTHGAIVTELYDAFVEGQTVEPTFYTDFPLETSPLTRTHRRDPRLAERWDLVAFGAELGTAYSELIDPVDQRERLTQQSLLAAAGDPEAMEVDEEFLSALEFAMPPTGGLGIGVDRVYMMLIGA-SIRETLAFPFVRP.. 1121
176 0.000e+00UniRef50_A0A1X2HHQ8 Lysine--tRNA ligase n=1 Tax=Syncephalastrum racemosum TaxID=13706 RepID=A0A1X2HHQ8_SYNRA  ali  38  74.........................................................DKGQKTAEIVTLTGRILTIRESSKLFFYDIVQNGQVVQVVASRSFEDKESFTETNRRLRRGDIVSFTGVVGKTKHGQVSLFPTEIQVLTPCLHDIPSR-SGLKDPEKRFRHRHLDMLVNPEPVRILRTRAKIIQYIRRFLEDRGFLEVETPVLSANAGGANAKPFLTHANALDMDMQLRIAPELYLKQLVIGGLDRVYEIGKQFRNEGIDADHNPEFTTCEFYQAYGNLESLMTDTEDMLQGMVSSVLGTTSITCRGDEVCFERPFMRINVMDHLERELGIPLDKVLRLPEELIAVCREQRVGLSGPLTIPRVLDKIISHYIEPLCVQPTFLYNPPVALSPLAKSSLDEKGRAARFELFVGGKEIVNAYEELNNPEEQRVRFEQQMRERQQGDLEAPIPDVAFCEALEYGLPPTAGWGMGIDRVVQLLTGSTHIREVLAFPAMRP.. 528
177 0.000e+00UniRef50_A0A139AYR9 Lysine--tRNA ligase n=1 Tax=Gonapodya prolifera JEL478 TaxID=1344416 RepID=A0A139AYR9_GONPR  ali  36  59SATKIPSNSELTSPGEEAFVRERRVTFQRYNVNPYPHKLETFLHLSDFRERFERKYENGNRDPSIVVTVVGRVTAKRVAGKSMFLDITRDGHRLQVISNKSYDDAEEHAKWANVLLTGDIIEVTGFPGSTRTNELSIIATRMNLLAPCLRRIP-KTQGLEDAELRLRIRPLALLASADLSNNLRLRSRIVSYMRRYFDTEGFLEVETPVLSLKAGGANAKPFVTWNNGLDAEMRMRVAPELYLKQLVVGGLDRVYEIGKCFRNEGIDNTHLPEFTSCEFYEAYADLNKVMTRTEKLLHGLVQEVTGSAEVDLSSPKINFTPPFRRIHVVDTLSAAIGEPLPLPSESCTELIPILDRHHVALPKPLTLARVYDKLIERFIEHDCFQPTFLVGHPGVMCPLARRDPTLPATTLRFELFVKGFELANAYAELNDPLEQHTRFVAQFAARTEQDEEVAPPDEDFVRALEYGLPPTGGWGLGIDRLVMILTGAKGIRDVVTFAAVRPV. 586
178 0.000e+00UniRef50_A0A1I3ZCY3 Lysine--tRNA ligase n=2 Tax=Cellulomonas sp. KH9 TaxID=1855324 RepID=A0A1I3ZCY3_9CELL  ali  39  635........APRRRLSQQQRVRRAKLDVLRAAGDPYPVVVPRTHTVAAAR---------GVTPDGPAVSVVGRVVRLRDLGGVVFAVLREGTAEVQAMLTAS--GTAGLDLFRRAVDLGDQVSVTGPLTHSRTGELSVGVTSWRMAAKALTPPPDKRHGLADAEARVRLRHMDLALHDAAAAALRARSTAVWSIRTSLVARGFLEVETPILQRIHGGANARPFTTHINAYDLDLYLRIAPELFLKRLMVGGTGKVFELGRNFRNEGVDATHNPEFTSMEAYEAYGDYTTMRELTRELVVAAAVAVHGEPVAHRPGGEVVPDGPWPVVTVHEAVSRAVGREVTPDLPLTE-LQALCGRLGLAWEPTETHGALVSELYDRFVEGQTVAPTFYTDFPVETSPLTREHRTDPRLAERWDLVAFGAELGTAYSELTDPVEQRRRLTEQSVLAAAGDPEAMEIDEDFLDALEFAMPPTGGVGIGVDRVVMTLVG-GTIRDTLAFPFLRP.. 1117
179 0.000e+00UniRef50_A0A2H9L4B0 Lysine--tRNA ligase n=7 Tax=cellular organisms TaxID=131567 RepID=A0A2H9L4B0_9ARCH  ali  39  9...............QIVNLRLKKIADMGAEGISFPSKFKKRVWTSDIVANFSKLKNDE--KSGKTVVIAGRMMTKREFGKLNFIKLQDFKGFIQVIFQKDETPEKTMVLFKKT-DAGDIIGVKGEVMQTKTGELSVLANELQILSKSILPLPDKFHGLKDEEDKFRKRYLDIIMDQEVKELFVKKQIFWSTIRNFLVKNEFLEVETPVLENSAGGASAEPFKTHHNALDINVFLRISGELWQKRLLVAGYEKTFELGRQFRNEGMDIEHLQDYTQMEFYWGYANYEDGMELVEELYKEVTKAVLGTLKFESKGYKVDMSKKWEKYDFETVIKEKTGXXXXXXXXXXXXXXXXXXXXXYDPRVDKWR---LVDVLWKHCRKQLSGPGFLVGQPVELSPLAKRKKEDPRKVEQFQVIIAGSEIGNGYSELNDPIDQEQRFERQTELKAQGDVEAQDHDKDFIEALKYGMPPACGFGVS-ERLFAALVN-RSMRECVIFPLLRPE. 493
180 0.000e+00UniRef50_E4ZWA8 Uncharacterized protein n=5 Tax=Eukaryota TaxID=2759 RepID=E4ZWA8_LEPMJ  ali  43  13...........................................................................................................FEKQHENIQRGDIIGVIGFPGRTNEGELSIFAREVILLTPCLRMLPTEHFGYKDQEQRHRNRFLDLIMNDTTRDTFITRSKIVKYVRKYLDERDFLEVQTPMMNKIAGGATARPFKTYHNELDMELFMRIAPELYLKQLVVGGLEKVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYNDVLDMTEELVSGLVKEVTGGYETVYHTQNVNWARPWRRVQMIPALEEATGEKFPHTTETNEFLKRVLKKVNVDCSEPRTNARMIDKLVGEFIEETAINPTFIVGHPEVMSPLAKYHRDIPGLCERFEAFVCKKEICNAYTELNDPFDQRLRFEEQANQKSQGDDEAQLIDETFCQALEYGLPPTGGWGMGIDRLVMFLTDHYSIKEVLTFPFMK... 421
181 0.000e+00UniRef50_A0A1E1J1H2 Lysine--tRNA ligase n=19 Tax=Trypanosomatidae TaxID=5654 RepID=A0A1E1J1H2_LEIGU  ali  38  125..................................FPHSFGNVITLEKFRAKYDHISADQRCSEAPGVRVGGRVVSIRDMGRILFITIRSGEAQLQVLRQVSEFTKTDLRAFADALHTGDILGATGVPGRTAKGELSLYATEASILAPALCPDLRGFVPLTDTDIKYRYRFVDMMSNPSVLQHFRKRHAITRALRDYLDARSFIEVETPVLHSVASGASARPFITHHNANGADLFLRVAPELHLKQCVVGGMERVYEIGRVFRNEDADRSHNPEFTTCEFYAAYHTYEDLMVMTEEIMRHLALAANGTTKVVVEPVEIDFEQPFRRVSAYDAVQEAAGVELPPPTELNAYMSAIMLRYNIPLPSVRTAAKMFDKLIDYFITDRVVEPTFVTGHPLFMSPLAMEQRARPGLSARFELFINGIEYCNAYSELNDPQEQYYRFQQQLLDRQTGDDEAMALDETFLKALQAGLPPTAGWGMGIDRVVTLLNGSATIRDGILFPLLR... 612
182 0.000e+00UniRef50_A0A1F6BVL9 Lysine--tRNA ligase n=16 Tax=unclassified Bacteria TaxID=2323 RepID=A0A1F6BVL9_9BACT  ali  41  2.............LQDLIEDRKKKLEAYQNKGSAFPARSERTHTIGEALRNFSVLEKSE-----EKVALVGRVTSLRGQGGILFGDFFDESGKFQFVLKAEET--KDFEDKKELFDFGDFVEITGKLFTTKKGEKSVLASEIRMLTKCVRPWPSSFYGISDEEERHRKRYLDFIFNPESKKAMDARFQITAVLRELLHKDGFLEVETPILQPIPGGALARPFQTHFNALDTDIFLRVAPELYLKRLLVGGFEKIFEIAKDFRNEGVDRDHYPEFTMIELYAAYWDYEMMMEAVERWLKEIAKRAGISEVRFRGKELKGFFRPWPRKKYAELIKEYAGKDVRKLKT-----------------------EEIDEVFKKKVRPNLIDPVYVVDYPKEISPLTKARDDDPEITERAQLLIAGSEFANIFSELNDPIDQRERMEEQERRHRAGDEEASRMDEEFLEAIEYGMPPAAGVGIGIDRLAALLTDTNSIREVISFTNLRPKK 463
183 0.000e+00UniRef50_A0A2D5EPL1 Lysine--tRNA ligase n=2 Tax=Myxococcales TaxID=29 RepID=A0A2D5EPL1_9DELT  ali  44  1..........MASEEQLREARKQKIARLEEAGTAFPNTFRVDDAMEAKRREIAALATKLAEAQDVEVWLYGRLVAKRGP----FYVIQTPYGRVQGLVRVKDSKPEPQRPIAKAADLADHVALRGPLVHTRSGELAVRAHSYEHVGKALLPPPEKWHGLKDVEKRYRERYVDLFANPEVADVFRARGHIVSTLRRFLDARGFLEVETPLLHSVRGGATAKPFDTHHNALDLDLFLRIAPELYLKRLLVGGFDRVYEIGRCFRNEGISTKHNPEFTMLEFYMAYATYEDMMDLVEAMLREVDAQLGTQHQAWYDERPFTFEGEWKRVPMPQALVDATAGDTLETLGDPAALNALAEKLMPRLEPCTRHGERIFALYEILAEPKLPEPVFITEYPFEVSPLARRNDAEPAWVDRFELFVEGREIANAFSELNDPEDQAERFEAQLVNREKGDDEAMDFDADYIRALSHGMPPATGFGLGIDRLVMLLCSQPSIRDVLLFPLLRPE. 544
184 0.000e+00UniRef50_A0A1V0SFI4 Lysyl-tRNA synthetase n=1 Tax=Hokovirus HKV1 TaxID=1977638 RepID=A0A1V0SFI4_9VIRU  ali  34  8...............QYAQARLSKFKDY--NINPYPYTYETTCELFTFINDFKNIK--ENKITDYIHSLTGRITNIRKCSKLYFYTIQNSGYQLQLIVNRTEYNNEDFDIDNELINRGDVIGAYGFAGKSKTGELSLIVKKIVILAPCLRMLPDQHYSVINRDIREKKRYLDLLIDQNNIQNFIIKQKVCSSFRNFLDSNDFIEVTTPILHKITGGASAKPFTTYHNDTKQTMHMRISPELYLKQLVVGGLNRIYELGPQFRNESADKTHNPEFTSLEFYMAYNDYKKLFTFCENLISSVVLSVNKSHIVKYGDLLLDFSVPFNRINIMDHLIQ-LGIKILPNDELVKQLTGICNVHKIELPIPSTANKLLDKIISHFLESKCIQPTFLCDHPKIMSPLSKVHRDNNNLTERFELFVAGMEICNAYTELNDPKDQEERFKLQLQDKQNGDQEAQLIDEIFIDALFHGLPPTIGFGCGIDRFVMLLSNKQNIRDIISFPL..... 500
185 0.000e+00UniRef50_UPI00080A8218 bifunctional lysylphosphatidylglycerol synthetase/lysine--tRNA ligase LysX n=4 Tax=Micrococcales TaxID=85006 RepID=UPI00080A82  ali  36  603..RRIAPEDLAPQWSDQTRHRIAHLEQMREAGIPYPKGTGEGMSVVSFSALLNSPEAEEAEPGPSALSVTGRVRSIRRHGKVSFIDLYEHGTVIQAVLDDAVCGPET-RRAVRWIDTGDHVLFRGRIGASRNGTPSLIVESWEMLSKCLHPIP--FDSFTDPEARLRRRSMDLIVNPAESHRLRIRSATIRSIRRTLDAHNFLEVETPMLNTVHGGASARPFKTFINAYGVDLTLRIAPELYLKRLVVGDMGPVYELGRDFRNEGADATHNPEFTVLEAYQPYADYNVMRELTERLLKNAAREVFGEEVLPLRLGETDVSGPWPVVSVCDALSEAVGQRI-DLETNFEELLGLARQHEIHVRDDMGPGAVIEELYGELVEAKTSRPTFYKDFPVETSPLAGPHRSEPGLAERWDLVINGTEMGTAYSEMADALEQRRRLTEQSLKAAAGDLEAMQIDEDFLDALETGLPPTGGMGIGIDRLIMMLTGAP-IRGVLAFPFVRP.. 1135
186 0.000e+00UniRef50_A0A0G0Y026 Lysine--tRNA ligase n=49 Tax=root TaxID=1 RepID=A0A0G0Y026_9BACT  ali  40  1..........MATLSELRQVRIEKLEKLKTLGDPFPPTSYKSHSNIVFHESFEKLE-------GNEVVASGRIVSIRKHGKLAFIDLKDATGKIQLYIKEDAKSEIGFEEL-NLLDSGDFAEGKGILTKTQRGEVSVEVTSIRILTKSLRPLPDMWDGLKDKETRLRRRYIDTNINPDVYQRFIRRSKFWEAHRDFFKKQGFMEMNIPVLETTPGGADANPFVTHMDVLDQDFYLRISQELYLKRLIGGGYEKVYEIGPRFRNEGISDEHLPEHIAMEFYWAYADWNDGMKFIKNLFRYVAEEVYGTQKFEIKGFNVDFGKEWEIIDYSEIFKEKFGLDIFNSD--FDDAKKILEKKHIKIDKNMNFGRGVDSL-WKTIRKDIQGPAFVVNEPKFLSPLAKANPSNPKYAMRFHPIVAGGELGNGFSELNDPVDQYERFKEQQSMRDSGDAEAQFLDIDFVEMLEYGMPPT--LGYGHSERVFWFLENVSAREGVPFPQLR... 486
187 0.000e+00UniRef50_A0A1L6MZN1 Lysine--tRNA ligase n=3 Tax=Proteobacteria TaxID=1224 RepID=A0A1L6MZN1_9DELT  ali  44  1.................MESRRIKASRLREQENPFANDVKPTIDLETLRKRVESIQEEGLYQEEKPFHVRGRILSMRSTGGLTFLRLRDRTGELQLLLNKKVMGE--HYAYLENLDIGDIIEAEGSPTASKRGELSLETTRVRVLTKAFRPLPEKWHGLTDTESRYRQRYVDLIANPHVADVFRARSYILNTIRKVLGDAGFLEVETPTMHSLIGGAMARPFVTHHHTLHMNLFMRIAPELYLKRLLVGGLERVYEIGRCYRNEGISTNHNPEFTMLEFYQAYVTYKELQDFSEFLLRSIDESLATHMPQAYAQWKAKRSEPFARVPMYQAVKR--GAEQTEIPAWRETLRAKASRFHDVWCQCESHGERLFVCYEFLSEPFLIEPVLIQDYPFETSPLARRNDQNPHLVDRFELFIAGRELCNAFSELNDPEDQAERFRVQLQKKEKGDEEAMDFDEDYIRALEYGMPPATGFGMGIDRLTMLLTNCSSIRDVILFPLLRPE. 543
188 0.000e+00UniRef50_A0A0G0TW94 Lysine--tRNA ligase n=6 Tax=root TaxID=1 RepID=A0A0G0TW94_9BACT  ali  37  1..........MEPIDNLRKIRLQKLEKIKKLKDPFPAKASKKQTVEECVK-----------SIGKNVQTAGRLVGLRGHGGSTFADLKDESSQIQLFFSKSQLSKVN-CQLLDLLDIGDFVEVSGSVDKTQAGQITIFVNNFKLLAKSIRPIPSSFYGLKDIETRLRRRYIDLITNPEAQDLFVKKAKFWTAARNFLIDNNFLEVETPALEAIPGGADATPFTTHHNALDVDYYLRISLELYQKRLLVGGFEKTFEIGKIFRNEGIDAEHLQDYLQMEFYWAYASFEDLIDFIEKYYRFIIKQTLGEETSKNGDTQINWKNDWPKIDYFDSFKDATGTDLAKDPKIND-LFKLAEKVGAKPNKKLGAGRLIDMIYKKTIRPKIIQPSLLINHPVLVSPLAKRKEDDPQKVERVQVLAAGTEIGNGWSELNNPIDQQERFEEQQKLRKEGDTEAQMYDRDFVEALEYGMPPAAGFGMS-QRFFSVLVDKP-IRETVFFPALRPEK 480
189 0.000e+00UniRef50_W8JGY4 Lysine--tRNA ligase n=8 Tax=Bacteria TaxID=2 RepID=W8JGY4_9CHLA  ali  38  9..............NEDFLHRSNKLQEIIALGIPYPYEFPEATSVREIKEKFAAQPLGNSEKQTPKVRISGRMVLFRSMGKNAFAQILDNDQKIQVMFNRDFSPEDAMKFIEKKLDLGDILGISGYLFFTHSGELTILVETVTLLCKALLSLPDKHSGLSDKEIRYRKRWLDLISSEEVRQTFLKRSRIIKLIREYMDAHDFIEVETPILQNIYGGAEATPFTTELKALHSKVFLRISLEIALKKILVGGTPRIYEIGKVFRNEGIDRTHNPEFTMLEAYAMNIDYHGVMVFVERLIEHLVRSINNGSTIQQGPQTVDFKAPWIRMTMKDSLKTYGNIDVDLHGDH--ELRAILKERTSLPESSYSRGLLIAALFDEFVCDQLIAPHHITDHPIETTPLCKYLRSDTGYVERFESFCLGKELCNAYSELNDPFLQRKLLEQQMEKKALNPEEYHPIDEEFLEALCQGVGPVGGFGIGIDRLIMILTDSASIRDVLYFPVMRRLE 521
190 0.000e+00UniRef50_E0SQD3 Lysine--tRNA ligase n=5 Tax=Thermoprotei TaxID=183924 RepID=E0SQD3_IGNAA  ali  38  16................................DPYLYRYEVTASIADIRKRYAHLNSGE--ETKDVYSIAGRVMGLRRHGKIVFGVLSDGTENIQLVFRYDIVGERLWK-LVEILNVGDVIGVRGRPIKTLRGELSILVEDFRVLSITWRDYPEKWHGIVDSEKRYRLRYLDIMLNEKVRNAIISTYKIEKAFRDFLDSRGFIEIHTPKLQPIYGGALARPFITKMYALDKTLYLSIAPETYLKRAVVANLFKVYEIAVCFRNEDIDAQHYPEFVQIEIYQAFADWNDMMELVENMIAYAVKQTFGDYKIEVERVELDFKPPWRRISLEDSIEIFSGIKIKNKE--YDELIEIARSLDISIDDPR-RGKIIEKIFEKVVEPKLLQPTYITLYPRDISPLARPYREDPRYSERFEIFLMGLEIGNGYSELNNPVVQYYFFKKESRARAKEDLEYHPMDKDYVRALEYGMPPTAGVGIGIYRLVMQLLGLSSIKDVIPF....... 485
191 0.000e+00UniRef50_A0A139P884 Lysine--tRNA ligase n=14 Tax=Bacteria TaxID=2 RepID=A0A139P884_9STRE  ali  51  1...............................................................................................................................MRTDMGELSIKATHITHLSKALRPLPEKFHGLTDVETIYRKRYLDLISNRESFERFITRSNIISEIRRYLDGQGFLEVETPVLHNEAGGAAARPFITHHNAQNMDMVLRIATELHLKRLIVGGMERVYEIGRIFRNEGMDATHNPEFTTIEVYQAYVDFQDIMDLTEGIIQHAAIAVNGDGPVNYQGTDIKINEPFKRVHMVDAIKEITGIDFWQDMSFEEAAAFAKEKHVPLEKHFTEVGHIINAFFEEFVEETLIQPTFVYGHPVAVSPLAKKNPEDPRFTDRFELFIMSKEYANAFTELNDPIDQLSRFEAQAKAKDLGDDEATGIDYDYIEALEYGMPPTGGLGIGIDRLVMLLTDVTTIRDVLLFPTMK... 374
192 0.000e+00UniRef50_A0A1H0KDM5 Lysine--tRNA ligase n=2 Tax=Nakamurella panacisegetis TaxID=1090615 RepID=A0A1H0KDM5_9ACTN  ali  37  627........................LAVLADAGMAYPVSVPRTGSLPEVV----------GHPDGAVVSATGRIESLRDFGGVSFGVIAAESARLQLVLDASTTDPALHSLWRRAVDRGDIVSATGTLGHSRSGERSLLVTDWQMASKSLKPLPSSRTGLTDPEARVRNRSVDLIVNPETGAVLAARSVAVGALRTAFWNRGFREVETPILQSVHGGATARPFTTHINAYDRDLSLRIAPELFLKRLIVGGTGPIFEIGRNFRNEGADATHNPEFTSLEAYLPFADYHRMRQITTDVIREVATAVHGSPIAMRPNEPVDLSAPWGVVAVHDAVSAACGTTI-DPGTPADKLQRIALAHQVPAPDGMTAGEIVMDLYDHLVEPKTFAPTFYTDFPIETSPLTRTHRADPRLSERWDLVAFGMEIGTAYSELVDPVDQRARLTEQSLRAAAGDEEAMELDEDFLSAMEIGMPPTGGLGLGVDRLVMMLTGTA-IRSVLTFPFVRPL. 1099
193 0.000e+00UniRef50_Q9Z6X5 Lysine--tRNA ligase n=97 Tax=root TaxID=1 RepID=SYK_CHLPN  ali  40  16....................RSHKLQELSELGVVYPYEFPGVFSCEDIKKTFASQELGNSEASTPRVRFAGRLVLFRAMGKNAFGQILDHNQTIQVMFNRHGLSEDAIKFIEKKLDLGDILGIDGYLFFTHSGELTVLVETVTLLCKSLLSLPDKHAGLSDKEVRYRKRWLDLISSREVSDTFVKRSYIIKLIRNYMDAHGFLEVETPILQNIYGGAEAKPFTTTMEALHSEMFLRISLEIALKKILVGGAPRIYELGKVFRNEGIDRTHNPEFTMIEAYAAYMDYKEVMVFVENLVEHLVRAVNHDNTWKHGPQEVDFKAPWIRMTMKESIATYAGIDVDVHSDQ--KLKEILKKKTTFPEATASRGMLIAALFDELVSDNLIAPHHITDHPVETTPLCKTLRSDTAFVERFESFCLGKELCNAYSELNDPIRQRELLEQQHTKKELLDSECHPIDEEFLEALCQGMPPAGGFGIGVDRLVMILTNAASIRDVLYFPVMR... 519
194 0.000e+00UniRef50_F6FFJ6 Lysine--tRNA ligase n=4 Tax=Mycoplasma TaxID=2093 RepID=F6FFJ6_MYCHI  ali  38  4...........EEVHEQEQNRRKNLASLEE--NPFSVKVSSSHKVTSVIEEYSDKSEDWLTENNISISLIGRLVSIREP----FATLREEWHDLQIYFKKGD---------LESLDVGDFVFIDGTLFKTKKGTLTLRAQSCRVVSKCLNPFPSQYYGIKDKEIQLRNRVVHCLVDQDVFNTFKFRAKIIRYIRNFLDDRGYLEFETPILESNYGGANAVPFRTHYKALKSDFFLRIATEISLKKIIISGFSKVYEIGRVFRNEGIDSTHNPEFTSIEIYTVNHGLDEVMDLTESLFKHVSRELQVD-SVSWNESNISFKEPFRRVSISDLLKEKISVDFYNDDISLERALKLAQEYDVHVEKHQTVGHIFHLLFEELVEKDLVDPTFVTGFHKDVSPLSKADPQNPNFTLRYELYIGGKEFSNGFAELNDPDDQLERFKKQVEERDLGNEEAFDVDYEYIEAMKYGLPPTGGIGIGIDRLVMLFTEKKSIKDVIFFPQLK... 479
195 0.000e+00UniRef50_A0A0G0KVA6 Lysine--tRNA ligase n=25 Tax=root TaxID=1 RepID=A0A0G0KVA6_9BACT  ali  38  3.............REDILQTKLDKLKNIKDYGDAYPEKTERDISNKEALEKFSEIG-------EKKITLAGRVRSLRPMGGSAFANIEDESGKMQLFFNKGNMDENLFKLFTKNVELGDFVQVTGELFLTKTEEKSLKVVDWKLLSKNIRPIPTEHFGIKDEEELLRRRYLDLMINEDTRELFRKKNTFWQTTRNFLTNEGFLEVQSPVLEHTPGGADAEPFITHHNALDQDFFMRISLELPLKRLLVGGYEKVFEIGRVFRNEGVDRTHLQEFDHMEFYWAYSDLQKGMEMTERMYKEIAFKVLGKYEHEYEGNIINWNIDFPHVDYFEAFQKETGIDLSADVTXXXXXXXX-XXXXXXXXXXXXXGKMIDTIYKKTVRQKLIQPCMLVGHPIEVSPLAKKDPSNPNKVLRFQVVAGTAELCNAFAELNDPIDQRERFEAQMKLREAGDAEAQMIDEDFLEALEYGMPNAFGLGFS-ERLFSFFMN-KSVRECVIFPPMKEKQ 484
196 0.000e+00UniRef50_A0A0P5GTF7 Lysine--tRNA ligase (Fragment) n=20 Tax=Daphnia magna TaxID=35525 RepID=A0A0P5GTF7_9CRUS  ali  37  42.KKKDAIKEEDINPNEYFKLRSAAVQQLKSKSSPYPHKYHVDTSLQEFIEKFTYLTKEQ-ALQDQTFSVAGRVHAIRESGKLVFYVLQSEGVKLQIMANQSYESSELFYDDVDKIKRGDIIGVKGYPTRTKTGELSIVPRKMELLSPCLHAMPH-YYGLKDKETRFRQRYLDLIVNTDVRKKFYIRSQIISYVRRFLDNMGFLEVETPMMNMIAGGAAAKPFVTHHNDLNMQLFMRIAPELYLKMLVVGGVDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYNDLMDVTESMISGMVKEIHGTYKIPYHPEEIDFTPPFRRLRMFPDLEKATGTKLPHPPESRKQLDDLCVKHQVDCSAPRTASRLLDKLVGHFLEEQCINPTFICDHPQVMSPLAKGHRSEPGLTERFELFVMKKEVCNSYPELNDPFIQRERFEQQAQDK.......................................................... 499
197 0.000e+00UniRef50_C0AW72 Lysine--tRNA ligase n=5 Tax=Bacteria TaxID=2 RepID=C0AW72_9GAMM  ali  84  1......................................................................................................MPEGIYNEQFKKWDLGDILGARGRVFKTKTGELSVHCTEVRLLTKALRPLPDKFHGLADQEMRYRQRYLDLISNEESRKTFQIRSQVMAGIRQFMVNKGFMEVETPMMQTIPGGASARPFITHHNALDIDMYLRIAPELYLKRLVVGGFDRVFEINRNFRNEGVSPRHNPEFTMMELYMAYADYRDLIELTEELFRTLTENVLGSSLVKYGDQEFDFGKPFAKLTMKEAICKYRPETVMADLDDMDKAVAIAQSIGIKIEKSWGLGRVQCEIFEEVAESHLIQPTFIIEYPAEVSPLARRNDDNPFITDRFEFFIGGREIGNGFSEXXXXXXXXXXXXXXXXXXXXXDAEAMFFDHDYITALEHGLPPTAGLGIGIDRMVMLFTDSHTIRDVILFPAMRPNK 402
198 0.000e+00UniRef50_D5UM75 Lysine--tRNA ligase n=7 Tax=Actinobacteria TaxID=201174 RepID=D5UM75_TSUPD  ali  36  622.......EAPAPRLSEQQRVRRRKLTAMEAAGMPYPPSVPRTASLAEVRGHLNGLAPD--SSTDTVVSVTGRVRGVRDYGGVTFVDLHEDRATLQVIAERGRTPDDVRAFWRESIDMGDLVSVTGEMVTSHTGELSVLLQDWAMAGKCLSPVPKPRVRLGD-ETRARSRSLDLMTDDGAVDLLYRRSRAVAAMRAAFTDRGFTEVETPMLQSVHGGAAARPFTTHINAYDMDLYLRIAPELYLKRLAVGGMGRIFEINRNFRNEGADATHNPEFTSLEAYEAYGDYTTMRTLTREVILGAAIAVNGRPIAVRPDGEVDLTAEWPVITVHEAVSRAVGTSVTPDSE-VEELEALCKQWHVAAPRGASAGKLVMELYEGLVEKQTEFPTFYCDFPIEVSPLARRHRRDPRLTEQWDLVGFGAELGTAYTELTDPIDQRERLTQQSMAAAAGDPEAMELDESFLDALSYAMPPTGGLGIGVDRIIMLLAGV-NIRATLAFPFIKPQ. 1118
199 0.000e+00UniRef50_A0A1A9X905 Uncharacterized protein n=1 Tax=Glossina fuscipes fuscipes TaxID=201502 RepID=A0A1A9X905_GLOFF  ali  47  2.........EKRDFTEQEQIRRDKLEKLVKDGNPFIAKFERTHTSKEINEQFNNLSKEELSADKTVVKIAGRIKTFREAGKATFATLQDQNGIFQIYVRNDEVGDEKYQEFID-FDLGDIIGVSGIMMKTNTGELTVRVEDFVLLSKALCPLPDKYYGMTDIEEKYRRRYVDLIMSAETKDIFIKRSKIIVLMRDFFNNKGYLEVETPVLQPIHGGAAAKPFTTHHNTLDMNFYLRVATELPLKRLIVGGFEGVYEIGRLFRNEGMDTR-------------------------------------------------HNPEFTTVEIYVAYQDMSFLMQLTEDTICYIAKNILNK---------------DETEYEFVEDKLIQPTFIYGHPVEVSPLAKTNAEDPRFTDRFELFIKGREYANAYSELNNPVEQYDRFVSQLAERDNGNDEAQELDIDFVEALEYGMPPTGGLGIGIDRLVMLLTGQDSIKDVLLFPHMRP.. 433
200 0.000e+00UniRef50_A0A0W1KIB7 Lysine--tRNA ligase n=22 Tax=Actinobacteria TaxID=201174 RepID=A0A0W1KIB7_9ACTO  ali  34  604.DELLNPPAIEPKRNEQQRVRIAKLATLEAAGDAYPPAVSHTASIAQVKRAFGPGADATGAVDATEISIVGRILRIRDHGGIIFADLREGTDELQISLERS--GAADMALWRAGVDRGDVVSVTGRLGVSRTGEPTFAVESWTMAAKSLVAPPDKFRGVADPEARLRNRHMYLATDAGAWTRLYTRSAAVKAVRDFLAVRDYIEVETPILQRVHGGANARPFATHINAYDLNLTMRIAPELFLKRLCVAGVERVFELGRNFRNEGADSTHNPEFTSLEAYEAYGDYLTMRDLTRELIIAAATAVHGSPRVPRGGGWLDISGPWRSITVHDAVSEACGQRV-TAETSAEELRELCKKFDIEVGLHATPGAMVTELYDELVESQTEEPTFYLDFPVETSPLTAPHRSVPGLAERWDLVAFGMELGTAYTELTDPIDQRDRLTRQSLLAAAGDAEAMEVDEEFLSALEFGMRPTGGLGIGIDRLTMFLVD-GTIRDTLAFPFVKPAQ 1114
201 0.000e+00UniRef50_A0A1F5NAJ3 Lysine--tRNA ligase n=13 Tax=Bacteria candidate phyla TaxID=1783234 RepID=A0A1F5NAJ3_9BACT  ali  44  1...........MSLEDLRKTREEKLDLLKKAGNPYPAKSSFQLSVAAVKKNF-----EKHRRSRRPIAVAGRVMAKRAHGQAAFLDIFDGSEKLQIFLAKDKLGEKSFALFSETVDIGDFIAAYGKVFLTKKKEQTLEAVKWEMLTKSLRPLPEKWHGLQDAEERFRKRYLDLLMNTEVRERFQKRTKIILELRQRLQAEGFMEVETPQLQPLPGGATARPFVTHHNALDIDLYLRIAPELYLKRLLIGGYGKVFEIGRNFRNEGIDRDHNPEFTMLELYWAWQDYRGLMTFVQKLLKKWL------------------PGKWRTLTFSQLVKNPTEEN------------------------------------YKEARNKIKEPTFIIDYPEALMPLAKLKPENPKLTESFQLIANGAEVVKGFSELNDPLFQRQQMERQETEHRRGNEEASRLDEDFLEALECGMPPAAGLGLGIDRLAMLLTETKNIREIILFPTLRPKE 436
202 0.000e+00UniRef50_A0A1V0KHM2 Lysine--tRNA ligase n=5 Tax=Actinomyces TaxID=1654 RepID=A0A1V0KHM2_9ACTO  ali  37  36.....KQSKAEPSPGEQFAIRAGKRERLRAEGDPYPVQLPLTTTIAAVRAKYADLAAGE--ETEDVVGVAGRVVFLRNTGKLCFVTLADGAGTLQAMLSAKSRGHSSLAAFKADVDLGDHLFVHGHVGTSRRGELSVFAEAWRIASKALRPLPKTWTNEASEEQRVRRRELDLLTRPAARDMVRIRAAVVRSLRENFHRRDYVELETPMLQVIHGGAAARPFVTHMNAFDMDLYLRIATEIYLKRAVVGGVDRVFEINRNFRNEGADSSHSPEFAALEAYEAYSDYNGMAELTRNLVQQAARDAFGLPEVLADGTEYDLSGEWAKIDLYTSISEAVGEEI-TVGTPREDLVRIAEKLGLEVDDYAVAGKIAEDIFEVTVGDSLWAPTFVYDFPEDTSPLTRYHRSKPGLTEKWDLYVRGFELGTAYSELADPVVQRERFEAQALAAANGDPEAMVLDEDFLVAMEQGFPPCGGMGMGIDRLLMALTGQG-IRETITFPIVK... 566
203 0.000e+00UniRef50_A0A0G0Q1X8 Lysine--tRNA ligase n=7 Tax=root TaxID=1 RepID=A0A0G0Q1X8_9BACT  ali  42  24................................DPYPAKSKKTHRVTDIFAEFAKLEAAQSELI-----IAGRLRSKREHGNLTFSNLDDGSATIQIAISKKEVGPDSYKLFSKLIDLGDFVEVVGKLFITHKGEQSLMVKEFRLLSKTLRPLPDKWRGLQDEEERLRKRYLDILSNEEVKEMLKKKALFWQSMRAFLVSKGFLEVETPVLENTTGGADARPFITHHNALDIDVYLRISGELWQKRLMVAGLEKTFEIGRQFRNEGMDAEHLQDYTQMEFYWSYANYEDGMLLVEELYKYVAEKTFGTLKFSIGKFEVDLGKKWERYDYRETVKKYTGXXXXXXXXXXXXXXXXXXXXXYD-KEGFNITRAIDNL-WKYCRKQIGGPGFLVGVPVEVSPLAKRDEANPKITQRFQPIIAGSELGNGYSELNDPIDQAERFMEQTKLREAGDVEAQMNDYDFVEALEYGMPPTCGFGLS-ERLFAFLMN-KSMRECQTFPLMRPK. 486
204 0.000e+00UniRef50_A0A1V0SAC0 Lysyl-tRNA synthetase n=1 Tax=Catovirus CTV1 TaxID=1977631 RepID=A0A1V0SAC0_9VIRU  ali  37  5........................LERSKEQNFSYPNNFKPNVKISELLNLITNNIIEVGQIDKQNVKIAGRVVLKRKYGKLYFYTMKKDNIKFQILCNAKEYLSDDFKAINNTIQMGDIIGAEGYISKSNTGEPSLVPIKLLLLTPCLHPIPKSFEKIVDVDVRYRKRYLDMIINDETMNIFIKRGKIIKFVRNYLDSLGFLEVETPILHQSYGGANAKPFVTYHNDLKQEMFMRIAPELNLKQLAIGGMDKIYEIGKQFRNEQNDATHLCEFLSLELYQNYANYTDMITLTENLMSELVKNINGDYQLKYNNETIDFTPPFNKIDITQKLSEFVNLDLLQETDITQYLQQKCVELKVKC-HPMTIPKMLDKIIGHFLEPLCKNPTFLMNHPSTMSPLSRRCDSNTHIAERFELFISGMEYANAYSELNDPKIQKSNFENQLKDKSNGDDEAQIPDLDFVTALEYGLPPCAGLGIGLERLIMLLTNCLNIKEVSTFPPVR... 495
205 0.000e+00UniRef50_Q2JFY7 Lysine--tRNA ligase n=30 Tax=Frankia TaxID=1854 RepID=Q2JFY7_FRACC  ali  43  36..................................................................VRLAGRVVLWRRMGGLIFGHLQDRSGRVQVSLSKTDLGAEVVKEWSRAVKIGDFVGIAGSLYTTRRGERTVAISEMTVLNRTVRALPDKWQGLSNVEARYRRRYLDLLVNAESRERFQTRANIIRRIRRLLDDNDFLEVETPILQEAASGAAARPFITRHNALGEDFYLRISPETYLKRIVVGAYDRVYELGRNFRNEGMDSSHLQEFTMLEWYAAYWDYRDNMAFVRELILTVLDDVLGTRAVTYEGVKLDFGADWPEIDYRAEVERRTGIDLTVVRDLP-TLRARVAELGLDVGTSPSYAGLVDLLYKKTVRPDLVQPCFLVHHPAELVPLARRSDTDPTALDMFQVVVNGVEIVKAYSELVDPAEQRQRLEEQAALREAGDDETMMLEEDFIEAMEYGMPPMSGLGLGIDRFVALLTGAPTLRDVVLFPTMR... 469
206 0.000e+00UniRef50_A0A0B7NMZ7 Lysine--tRNA ligase n=17 Tax=Fungi incertae sedis TaxID=112252 RepID=A0A0B7NMZ7_9FUNG  ali  37  45...................................PEKHGKWITAKDLQ-KYQPLEKGK-KAEDDLVTLTGRIISKRESSKLIFYDIMQNGEPVQVVASRGNGSADEFADKNRDMCRGDIASFTGVPGKTKHGQLSVFVTEMQVLTPCLQDIPR--TGLKDPEKRFRARHLDLLVNEDSSKILRARSKIIKFIRDFLDKRDFLEVETPILSGKAGGASARPFETHAHALDMDMQLRIAPELYLKQLVIGGIDRVFEIGKQFRNEGIDADHNPEFTTCEFYQAYGNLESLMNDTEIMLSEMASAVCGSDQITTKGQEINFRGPFQRINVIDRLSSELGLEFLESEDALTQLTSLCQQKGIVLTAPVTLGRVLDKLISEFIEPECLQPTFLYNHPLALSPLAKDAIDEKGRAARFELFVCGKEIVNAYEELNDPKEQRKRFRQQLQDRQDGDLEAPLPDIDFCDALEYALPPTAGWGMGIDRVVQLMTGATHIREVLAFPVMRP.. 517
207 0.000e+00UniRef50_A0A1N5NCV5 Lysine--tRNA ligase n=2 Tax=Actinobacteria TaxID=201174 RepID=A0A1N5NCV5_9MYCO  ali  36  125..QRVGADDLTPEWSDQTRHRIAHLEQMRAAGEPYPKGDGQGVSVSALARMLAQ------EPAGTTAAVVGRIRSIRRHGGVAFLELTEHGHTIQAMLERAVLGEESLRR-VRWADTGDHVLIRGRLGASRTGTPSLLAESWRILSKCLHPIP--FGSFTDPEARLRRRSVDLIVNPEESRRLRVRAQTIRAIRRTLDADGFLEVETPMLNTVHGGASARPFKTFINAYGVDLTLRIAPELYLKRLVVGDMGPVYELGRDFRNEGADATHNPEFTVLEAYQPYADYDAMRLLTERIIKSAARAVFDAEQLPLRHGEHDVSGQWPVVSVLDAVSEAVGRRI-DLDTDFEVLMRLAAEHEIHVRDDMGPGAVIEELYGELVEARTVRPTFYRDFPVETSPLAGPHRSIPGLAERWDLVINGTEMGTAYSEMADALEQRRRLTEQSLKAATGDPEAMQIDEDFLAALETGLPPTGGLGIGIDRLIMMLTDAP-IRGVLAFPFVRP.. 625
208 0.000e+00UniRef50_A0A2H0B565 Lysine--tRNA ligase (Fragment) n=1 Tax=Candidatus Beckwithbacteria bacterium CG23_combo_of_CG06-09_8_20_14_all_34_8 TaxID=1974497  ali  42  1...............................................................................GNLYFLDLEDPSSKIQTMLRKDLVSDTIF-TLVKLLDIGDFVSIQGKVITSKTGETTVEASDLQIVTKSLRPLPDSWYGLKDVEERYRHRYIDMILNQEVREKIINRSKVVQKIREFLLQEGFLEVETPILEITASGALANPFLTHIKAYDMDLYLRICGELWQKKLMVAGFEKTFEIGRAFRNEGVDREHNPEFTMMEYYYGYADYLKNMEMQERLMGFVVKEVTGDYKVKIDDQEINFQPPYSRKTFAQLIKEATNIDIDSFTD-LKTMQKGMTDYGLKIDPKWGRGHLVDEFYKEYVRPNLIQPVFVTHHPRDLKPLAKADPNNPEYTQSFQLLANGFELSNNYSELNDPIDQAERFAKQSELDQAGDDETMTSDSEFVEALEYGMPPVSGTGIGIDRFVALITNSHHIREVIAFPLMKPK. 423
209 0.000e+00UniRef50_R1F8A9 Putative Lysyl-tRNA synthetase n=1 Tax=Emiliania huxleyi TaxID=2903 RepID=R1F8A9_EMIHU  ali  50  84.................................PYAYSFAPTHSSAAFAEAFDSLSPGAEDASA-EVALCGRVMTKRSFGKLAFFTVQDGEGTFQLYLDKKRLG-AAFRPFLDATDGGGF----GGVKRTDKGELSVLA---TLLTKALRPLPDKWKGLADVNKRYRQRYLDMIVNPRVRATFAARARITAYLRRYLDERGFLEIETPCLNAQPGGAEAKPFETYHNALGLDLTLRIATELYLKRLVIGGVERVYELGRIFRNEGISTRHNPEFTSIELYQAYADYEAHDRPPGELVAGAARHVAGGTSVEYQGASIDLAPPWRRVTMAEL---------------------------------------------ELCEPELVQPTFVLDHPTE---------------ERFELFAVGRELANAFSELTDPVDQRARFEAQAAKKAAGDEEACGVDEDFLTALEHGMPPTGGLGIGIDRLVMLLTDSPSIKDVIAFPLLRPE. 484
210 0.000e+00UniRef50_A0A1W9R7N6 Lysine--tRNA ligase n=4 Tax=Bacteria TaxID=2 RepID=A0A1W9R7N6_9BACT  ali  43  13.....................................KFPKGGSIKNILDNFE---------ENKEVATAGRLIAKRDHGKSMFAHISDITAKLQVYAKLDILKEG--YQVFTSLDVGDIIGVKGVLFKTRTGEPTLLVREVKLLAKSLKPLPEKWHRLKDVEVRYRQRYLDLISNPTSAQVFLGRSKVISFIRDFFAKEEYIEVETPMLHPLAGGASGKPFVTRHLSLDCDVYLRIAPELYLKRLLVGGFDKIYEINRSFRNEGLSSRHSPEFTMLEAYCAYQNYEYMMEVCEKLFSSLLEYLYGRLEINYQGYSIDFTPPWLRVSLAEILEEELGI---KSSDSKEKAIKKMRNYFRKSKGEEVVSLSRSQLLEDLMEKRYTKPVFVTDFFTWASPLAKRKKDNPNLVERFELFIAGLEIANGYSELNDPIEQRRRFEEHLEFEEELLKK---IDEDFILSLEYGMPPAVGLGIGIDRLVMLLFNQPSIKDVILFPLHR... 464
211 0.000e+00UniRef50_A0A1J4U2X4 Lysine--tRNA ligase n=2 Tax=Candidatus Kuenenbacteria TaxID=1752740 RepID=A0A1J4U2X4_9BACT  ali  39  8...............DEYKIRFEKLAKIRQAGNPYPAKFNKENRVTEI----------QTSADGIGLKTAGRIVDLRKIGKLVFCNLRDEWGRAQIVLKQDELGKDKFTFFIKYFDRGDFLGVEGNIFTTRTGEKTLLVKRYELLSKSLLPLPGKWHGLKDEESCYRQRYLDLIANDETIKRFKFRSRFIKILREFYAQNGFEEIDTPILANQASGALAKPFKTHHNALGTDIYLRIAPETYLKESIVGGYEKVFEVARCFRNEGMDPSHLQDFTMVEHYAAYWDYVDNMRFTERMFEYILAKLKDGKKKIKIPNEIDFSLPWKRVSFCEQLIEDADIDIDKY-ENADKLREAIKRKKIKIEDKLGRGNLIDALYKLVSRPKIINPTFLTNHPLDLSPLARRSDNNIKAVDRFQLIINTWEIINAYSELVDPIDQEERFRVQEKAKKDGDEEAHGKDDEYIEAMKHGMPPISGFGMGIERIVALLTGQTNLRDVVLFPLMKPK. 493
212 0.000e+00UniRef50_A0A0U1HAK8 Lysine--tRNA ligase n=3 Tax=Enterobacterales TaxID=91347 RepID=A0A0U1HAK8_YEREN  ali  86  1...............................................................................................................................................MLTKALRPLPDKFHGLADQETRYRQRYLDLIANDESRNTFKVRSQVMSGIRRFMVEKGFMEVETPMMQVIPGGASARPFVTHHNALDIDMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGVSPRHNPEFTMMELYMAYADYKDLIVLTEELFRTLTETVLGSSVVQYGDQTFDFGKPFAKLTMKEAICKYRPETNVADLDDMDKAVAIAESLGIKVEKSWGLGRVQCEIFEETAESHLIQPTFITEYPAEVSPLARRNDDNPFITDRFEFFIGGREIGNGFSELNDAEDQAQRFADQVSAKEAGDDEAMFYDEDYVTALEHGLPPTAGLGIGIDRMVMLFTNSHTIRDVILFPAMRPVK 361
213 0.000e+00UniRef50_X4R9Z0 Lysine--tRNA ligase n=8 Tax=Trueperella pyogenes TaxID=1661 RepID=X4R9Z0_9ACTO  ali  35  606......PAPIEPKRNEQQRVRIAKLATLKTAGDAYPAAVPHTSSVTEVLRRGSA----------DVASIVGRILRIRDHGGVIFADLREGTDELQISLERS--GSADMKLWRAGVDRGDVVSVTGRLGQSRSGEPTFSVQAWTMAAKSLVAPPDKFLGVADPEARLRSRHMYVATDSDAWRRLYVRSAAVKAVRDYLAERDYIEVETPILQRVHGGANARPFATHINAYDLDLTMRIAPELFLKRLCVAGVERVFELGRNFRNEGADSTHNPEFTSLEAYEAYGDYLSMRELTRELIIAAATAVHGSPRVPRDGGWMDISGPWRSITVHDAVSAACGQPI-TSETSTEELRELCKKFGIEVSAHATHGAMVTELYDELVESQTVEPTFYMDFPIETSPLTAPHRTNPALAERWDLVAFGMELGTAYTELTDPIDQRDRLTRQSLLAAAGDAEAMEVDEEFLSALEFGMRPTGGLGIGVDRLTMFLIN-GTIRDTLAFPFVKP.. 1089
214 0.000e+00UniRef50_A0A0B3B1B1 Lysine--tRNA ligase n=1 Tax=archaeon GW2011_AR19 TaxID=1579377 RepID=A0A0B3B1B1_9ARCH  ali  36  1..........MGREEQITQERLRKISELKKQEIPYPNKFDKKQTCAECLK----------LKLGAKVKTAGRLMTKRDIGKIAFCVLKDDSGKIQLVFQEGETPQKEKDFFKKYLDSGDFVGVQGEIIKTKTGEISILIKKIEILSKSILPLPEKFHGIADEEEKLRKRYLDILMNPEVKEMFVKKSKFWNAIRNFLLEKGFLEVETPVLENSAGGAAATPFKTHHNALDIDIFLRISGELWQKKLMVAGYEKTFEIGRQFRNEGIDMEHLQDYTQMEFYWAYANYEDGMKLVEEMYKKIAKEIFETLKFESHGYKIDLGKKWEIYDFENLIKKETKXXXXXXXXXXXXXXXXXXXXXDDPRGPSSKDDKMIDLLWKYCRKKISGPGFLINQPVELSPLAKRNSEDSKKVEQFQVIIAGTELGNGYSELNDPIDQEERFRRQSELKKAGDKESMEHDKSFVEALKYGMPPTCGFGVS-ERLFSYLMNKP-IRECVIFPLMKSE. 502
215 0.000e+00UniRef50_UPI00094CCF0A lysine--tRNA ligase n=2 Tax=Buchnera aphidicola TaxID=9 RepID=UPI00094CCF0A  ali  50  21...................NRKIKLKKLCNTGFNFPNSFHCNNTVKNILSLYKKHTKQELKNININIKIAGRIIKKRVMGKASFFIIQDCDYEIQIYIKSNNFQKNFYKDYILELDLGDIISIIGIIFKTNTKELSVNCHKIELLTKSLHPLPDKYHGLQDQELKYRKRYLDLMSNNNIKKIFKKRSRILSVIRIFMEKKNFLEVETPMMHSIPGGANAKPFITYHNTFNSKMYLRVAPELYLKRLIIGGFNKIFEINRNFRNEGVSTRHNPEFTMMEIYMAYSNYKDMMIFLIKLLKYITKKICNTSTIYYDNYTIDFKKKIKKITMINAILHYNSNIQKSDLKNLKKAKKIMKELKLLIPSDISLGEAINIIFEKTTEKKIIKPTFITSYPIEVSPLAKSCSKNKSFTERFEFFLAGYEIANGFSEXXXXXXXXXXXXXXXXXXXXXKKKHYQYDKEYITALEHGLPPTAGLGIGIDRLIMIFTNQKNIRDVILFPTLRPIE 507
216 0.000e+00UniRef50_A0A0G1VBG2 Lysine--tRNA ligase n=6 Tax=Parcubacteria group TaxID=1794811 RepID=A0A0G1VBG2_9BACT  ali  36  1..........MSSLDEIRQTRIKKLEALKKSGNPYPADSKRELSLGEAAANFDALEK-----SKEEKWVAGRIMSIRGQGAIIFITLYDGTGSFQGLLKKDVLGEEKLNFWNEVTDIGDFVELRGTFFKTNRGEKTLEARDWRMLSKSLRPLPEKWHGLVDVEERYRRRYLDILMNPELHDLFIKKARFWDATRSFLKKEGFLEVDTPTIEVTTGGAEARPFKTHHNDFDLDVFMRISGELWQKRLLAAGFPRVFEIGRVYRNEGSSPEHTQEFTGMEFYAGYMDYRQGMEFTEKMIKEVAEATFGTLQFETHGHRVDLSEPWEKIPYVDTVKKMIDIDVLSATE--KEMMKKLDELGVKYE-GANKERLTDSL-WKYCRKQIVGPAWLIDVPKLVSPLSKAKPENPLLTERVQLILTGAEMTNGFSELNDPIDQEERFEVQKKLIEGGDEEAMMPDDEFVEMLEHGMPPAFGFAYG-ERLFTFLADKP-LRETQLFPLMKPE. 484
217 0.000e+00UniRef50_A0A2E7R142 Lysine--tRNA ligase n=3 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2E7R142_9CHLR  ali  39  4SESTDEFTDSITDISSLVAPRLEQRKQLVDLGDPYPARVQNTQLIAEARATFDESENVPSEPKQLETIVAGRLTGMRRAGGMIFSDLRDYSGEIQIQFKSDELDD---FEQLSLVAAGDFLEISGVLFRTKRGEVTIGCNSWRVITKSIRPFPSTKYPIVDEDIRSRQRYLDLMANSSARDLAITRSRIVRSIRNFMHDRGFIEVETSMFPDVPGGANARPFKTVSNALDRELSLRISLELPLKKLLVGDLPPVFEIGRVFRNENVDRDHSPEFTMMESYEPYTDYMGVADMVEGMFHHIAREMPELGQVDLPERTINLTPPFIKSTYRELMVSFADGFDDRNYQTNEDIMEKARSMNVTTDNSMSRGKLLDRIFSEKVEPNLIQPTFVMDYPVDSTPLAKKKIDDHSLVERFELFIDGREIANAYSEXXDPVDQRSRMI-QEQDXGIEDDEIPPIDEDFLXAIDHGMPPAGGIGLGIDRLIMLYTGSTNLREVILFPTLRN.. 516
218 0.000e+00UniRef50_A0A0G1F9Y5 Lysine--tRNA ligase n=44 Tax=unclassified Bacteria TaxID=2323 RepID=A0A0G1F9Y5_9BACT  ali  35  1..........MSSIDEIRDTRIKKLKLLQSKGIPYPAESQREISLKAAIDGFEDLEK-----SKEIKWIAGRVMSLRGQGAIVFATLYDGTGSFQGLLKKDVIGAEKFDFWNEVVDIGDFVEIQGTFFKTNRGEKTLEVKDWRMLSKSLRPLPEKWHGLTDAEERFRKRYLDILMNPEIKDVFEKKAKFWEATRNFLRKENFLEVETPTIEVTTGGAEARPFKTHHNDFDMDVYMRISGELWQKRLLASGFERVFEIGRIYRNEGSSPEHTQEFTNLEFYAGYMDYKKGIEFTERMIKEVVKETFSALQFEIHGNKIDLSPKWERIAYVDTIKKMLDIDVLSSSE--KEMKKRLDGLKIKYE-GESRERLIDSL-WKHCRKQIIGPAWLVDAPKLISPLSKAKQENPLLTERVQLLLCGAEMTNGFSELNDPIDQNERFEAQRKLIEAGDQEAMMPDEEFVEMLEHGMPPAFGFAYG-ERLFAFLVDKP-LRETQLFPLMRPKE 485
219 0.000e+00UniRef50_A0A1Q2TR06 Lysine--tRNA ligase n=11 Tax=Bacteria TaxID=2 RepID=A0A1Q2TR06_9ACTO  ali  38  583....SAIARPEPKRSDQLVGRAAAREAMLASGIPYPASVSVDAACATA---------------EGACCVAGRVLTIRDHGGVIFATLRDASGDLQILLEAGRAGAEALASFRRLVRNGDQIAVVGEIGESRTGTRSQLADSWMMTSKALRPLPDKRRGIQNPEARVRLRHVDLIVNPRQRAMVRSRSAAIQAVRSTLLGRDYLEVETPILQPVHGGANARPFRTHINAYDLDLYLRIAPELYLKRLMVGGLERVFEIGRNFRNEGADATHNPEFTMLEAYQAHADYNVMKDVMRDMVIAASRAATGSTIVRGSEHEIDLAGPWRTVTIAEAVSTALGEEVGTD-TPVAELRRHAESVDMPYDPKWGWGTMVQELYEHLAEGTTVEPTFFSDFPADTSPLTRQHRHDARLAERWDLIIFGSEVGTAYSELVDPVIQRERLTAQSLAAAGGDLEAMELDEAFLAALEQGMPPSGGLGMGLDRLVMMLTGA-SIRETIAFPLVRP.. 1068
220 0.000e+00UniRef50_A0A162UQ09 Lysine--tRNA ligase n=2 Tax=Fungi incertae sedis TaxID=112252 RepID=A0A162UQ09_PHYB8  ali  36  1..........................................MTVKDLSAFDSQLSKGQ--KADTLVTLAGRVQAKRESSKLVFYDIIQNGEPIQVVVSRGEGSFDEFAAANQEVCRGDIVSFTGVPGKTNHGQLSVFVTKMRVLSPCLHDIP--KHELKDPEKRFRERHLDMLVNPHVTDIMRTRTKIIRFIRRFLDDRDFLEVETPVLSGKAGGANAKPFETHAHALDMDMQLRIAPELYLKQLVVGGIDRVYEIGKQFRNEGIDADHNPEFTTCEFYQAYGNLESLIQDTETMLSEMVESITGTRILEHKGEAITFDRPFKRINVLDRLETQLGIPILDGKLGVDTLLQACRELSIPVSRPFTTARILDKLISHLIEPECTQPTFLYNHPIALSPLAKVDEKGRRIAARFELFVRGKEIVNAYEELNDPVEQRLRFQQQANDRVDGDDEAPVPDLAFCQALEYGLPPTAGWGMGVDRVVQILTGATHIREVLAFPVMRPLQ 467
221 0.000e+00UniRef50_A0A136K0G6 Lysine--tRNA ligase n=3 Tax=unclassified Acidobacteria (miscellaneous) TaxID=305072 RepID=A0A136K0G6_9BACT  ali  46  7........DEILVPNDQTQAREEHLARFADLGNAYPSKFDRSATISNLKAEVKDKLNETLKELG-TVRIAGRIATPI---RGNFVHLTDGREKLQIYAKKGDRDSDQAWEAWQILDHGDLIGVEGYLFVTNTGEVSVHVERLYFLAKALSPMPDKMHGIEDAEIKQRQRYLDLIASSSTRETFEVRAKTISSLRRFLEDNGYIEVETPMLTPKATGAAAKPFKTHHNALDIDLYARIAPELYLKRLLVGGFEKVYELNRNFRNEGISYKHNPEFTMLEFYCAYMDVNGMMDFCERMIQESVRRATGGLTVNYERHTIDFSA-FRRLTMKEAIAETGRSEPMSDDGLVAC-------------------------FEEFVEPNLIQPTFITDFPKSISPLSKASPENPQVAERFELYINGMEVANGFSELNDPREQYERFVDQAEARERGDDEAMVLDEDYVRALSYGMPPAAGIGIGIDRLVMLLTNKHSIRDVILFPHMRPER 526
222 0.000e+00UniRef50_A0A2E5UF68 Lysine--tRNA ligase n=15 Tax=Planctomycetes TaxID=203682 RepID=A0A2E5UF68_9BACT  ali  39  15................LVAARRAKMQRWIDDYNPWGNRVDGLTSLESARAQFSQEAHDASKEEGGKVKVAGRCIQHXAMGKLTFLVIRDETGDLQISCSKAAXPTEXFK-VASKLDYGDIXVAEGPIGATQKGXICVWADSFELACKSLVPPPEXXHGISDAELRYRXRYVDMYTNPETIXTFKKRSDIIRAIRSYMETDRFVEVETPMMQPLAGGAAARPFSTHHNALDIPLFLRXAPELYLKRLLVGGMRKVYEINRNFRNEGVSKKHNPEXTMLEAYEAFGDCETMLELTEGMVRAGAQAVSETLTISFGEHEVDYNKPXDRISYGDLFERALGFSMCDEASV----RAKGSELHIDGSDSMDQWLLVSEIFDACVEETITRPTFVTDYPSAISPLTRPHADNDSLSHRWELFIXGMEIANSYTELNDPDLQLQRFTEQLDGADDEVQAXRTLDEDFIHALRVGMPPAGGLGVGXDRLVMLLTSNESIRDVVLFPXMXPQ. 505
223 0.000e+00UniRef50_A0A2P6MWI2 Lysine--tRNA ligase n=1 Tax=Planoprotostelium fungivorum TaxID=1890364 RepID=A0A2P6MWI2_9MYCE  ali  35  25........PQRLSSTEAVLVRKQQLNEYKEKGLPYDNRYKEDMSIAQFREKFDATIQNGQKLEDQIISIAGRISSKRESKKLFFYDLTRGDSQLQIMSTQQYTDKDHYETLHSTMRRGDIVAVRGIPGKSKLGELSIIPLEVKILSPCIQPLPEADH-LTHTDTRFMKRHLDLLTNRRSRDTLIARSKVITCVRDFFTSRGFIEMETPILGAKAGGANATPFVTQGQAIGDHLFLRIAPELYLKQLVIGGMEKVR------RNEGVDATHNPEFTTCEFYQAYSDYNDIMDMTQELLRDIVGKVTGGSTITVEPHVIDFSKNFARFDLVTKLEETMNEKLPENFDCVTDLLEIAHRKGVYIPKPHTPARILDKLVGHFIEPLCIQPTFIMNHPLCLSPLAKSIPDRPQCTERFELFINEAEYCNAYSELNDPEEQRVRFRQQAEDKKLGDADSQVPDEEFCEALECALPPTGGFGLGVDRFVMLLTGSESIKEVIPFPIMK... 525
224 0.000e+00UniRef50_A0A0K3ZJ86 Lysine--tRNA ligase n=21 Tax=Bacteria TaxID=2 RepID=A0A0K3ZJ86_ECOLX  ali  91  1.............................................................................................................................................MRLLTKALRPLPDKFHGLQDQEVRYRQRYLDLIANDKSRQTFVVRSKILAAIRQFMVARGFMEVETPMMQVIPGGASARPFITHHNALDLDMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYHDLIELTESLFRTLAQEVLGTTKVTYGEHVFDFGKPFEKLTMREAIKKYRPETDMADLDNFDAAKALAESIGITVEKSWGLGRIVTEIFDEVAEAHLIQPTFITEYPAEVSPLARRNDVNPEITDRFEFFIGGREIGNGFSELNDAEDQAERFQEQVNAKAAGDDEAMFYDEDYVTALEYGLPPTAGLGIGIDRMIMLFTNSHTIRDVILFPAMRPQK 363
225 0.000e+00UniRef50_A0A2G6F8L3 Lysine--tRNA ligase n=1 Tax=bacterium DOLZORAL124_38_8 TaxID=2044884 RepID=A0A2G6F8L3_9BACT  ali  38  1..........MSEENRFITERKQKINLWEEKGFAYANKFDRTHTSQEAKKKSEDEKATLRDATSEELSLCGRITNKRAMGKLAFLRINDTGGDFQICLSQKIIGDE-FKSFLKMIDLGDFCGFSGELFFTKHGEPTLMAKTITPLSKALRPLPEKWAGVSDTEMCYRERNLDLVSNKETFERFKLRSKLIQEVRHFFEEKDFYEVETAILQPQAGGAMAKVFETHHNALDHNFVLRISLELDLKRAIGGGFERIFEIGKNFRNEGSDPSHLQEFTMCEWYAAYQDLETNKQWTEELFHRFCQKVFRKEIFTVNETEINFGGKFAEARFPDLLKEYANIDMFAASD--EVVVAKAKEVGVEKIEGVGRANLLDDIYKKTARGKLIQPTFVFDYPEDLKPLARPNGD--GTASCFQLVVNGWEIVNSYGELIDPQVQRKLLEAQAAAREAGDDEAMPIDEVFLKAMEHGFPPMTGSGFGIDRLMAIFTGQPNLRDVVLFPTMRPKQ 502
226 0.000e+00UniRef50_Q4JCI5 Lysine--tRNA ligase n=55 Tax=Thermoprotei TaxID=183924 RepID=SYK_SULAC  ali  37  13..................ERRVKIVDELKSKGIPYPHKYDITHTIIDIKKMERSDKPTDAFAFD--ISTAGRVANIRRHGKISFVDIFDEGERLQLQLRVNELG-DRYDKFFEIVDRGDILGVKGDLLYTIKGELTLRIKDYVLLSKSLIEPPD-WSKLS-PEFRYAHRYVDFLYNDLARRNMEIRYSTIRRIREFLYSKGFMEVETPILQPVYGGALAKPFMSHVNYLNENWYLRISLELYLKRYIVGGFNKVFEIGKVFRNEDIDVTHNPEFTLLELYWAYADYNDIMRLTEEMLQDVVKNINNDSKIKYSIGGKEYTIEFRKITMIDSLTEVLGKDVDKMSD--EELKSLMDKNGLKPRGNMYRGLMIEKLFDKLVTPTLIQPTFVLDYPVETTPLCKPHRSKQGLVERFELYVAGMELANAYTELNDPIIQDMLFKQEQEMFKRGDEEAHPYDVDFVRALSYGMPPTGGLGIGIDRLIMLLTNNMSIKEIIPYPML.... 492
227 0.000e+00UniRef50_A0A1D8MSF4 Lysine--tRNA ligase n=5 Tax=cellular organisms TaxID=131567 RepID=A0A1D8MSF4_9ARCH  ali  44  1.............MSSEREQRLEQLRSRRENGEAFAYSFDRSHTIRELQE----LDEEDRDLPDREFSTAGRVMEVRDFGGLLFLDLRDARSEIQVMVREN---EEALQTI-EDVYRGDFIGVTGTLTYTDRGEFSLEALDVEILTTAVRPIPSKHFGVEDEELRYRDRPLHLTMDMEARDRFRTRSEIISELRSFLESREFMEVETPTIQPVYGGANAEPFETHVNDRDMDAYLRISPELYLKRLIVGGYERIFEIATNFRNESIDTTHNPEFTMMELYQAYADYEDMMELTEELVEHIAVEVLGETVVEYRGEEIDLSAPWRRMTMHEAIEEHGGLEVEEMSD--EELREAMDELGIELDSGFERGLAIAEIFEEVAEEELVQPTHITDYPEETTPLCMDHRSEEGLIERFESFIAGMELANAYTELRDPIRQREHFEREHQRQEEGDDKAHPLDMEFVEALELGMPPTGGLGIGIDRLVMILTDQESIRDVLFFPMM.... 477
228 0.000e+00UniRef50_A0A0G4HY39 Lysine--tRNA ligase n=1 Tax=Chromera velia CCMP2878 TaxID=1169474 RepID=A0A0G4HY39_9ALVE  ali  45  45...............EMISKRQDKVRELRENGEVYPSGFPVRDEISNVVTRFQNLESGEV--TEETVTVAGRALSMRNSG--MFMDLHSPTDKIQIFSHKDNL-EQKFLDLLPSLDVGDVVGVRGVVRKTPRGELTVNSREIFLLSKCVRPLPDKWKGLRDVEQRYRQRYLDLIVNTEGRRVLRARTSLLRSVRTTLESEGFMEVETPMLHPIAGGASAKPFTTFHNALNAELFLRIAPELYLKRLVVGGLEKVFEMNRCFRNEGISVKHNPEFTSVEIYEAYSDVQRMMDLTERIVGDSVVAVSHSKKVVYNGEEIDFSSPWRRVSMTSSIEEITGVDFPATEEGADAARNAALDLGIAIPENSRWGNVVAAVFEERVEASLVQPTHVTDFPLDVSPLARKQSGDPRLTERFEAYVNGWEIANGFTELADPVDQKFRFERQLEALEAGDEEAQRMDEDFVTALEYGLPPTGGLGIGIDRLAMLLTDSKSIRDVIAFPALRPK. 564
229 0.000e+00UniRef50_A0A1V5XQ68 Lysine--tRNA ligase n=1 Tax=Parcubacteria group bacterium ADurb.Bin192 TaxID=1852938 RepID=A0A1V5XQ68_9BACT  ali  39  1..........MPNKTDERQDRLDRRQKLLDMGEPHPAKFEKTHNLDELAK----------VKEGEAVKVCGRIMLQRVIGKLAFYTLQDEFGAHQVGAKIDDVGEDNF-QLVDLLDRGDFLGVNGVMGVNKTGQPIVWVTELLVLGKAITPLPEKWHGVQDIEKIYRHREMDLVSSRESFDRFKLRSIFLSNCRRYLEDSGFLEVETPILTSVATGAAARPFVTHHNAYDMDMVLRIAPETYLKRLIGGGFERVFETAKCFRNEGSDPSHHQEFTQIEYYVAYKDYEWNMDFTEKFLRAVLQKTFGKLQFEVIGHTIDLSQAIPRYKITDLIKQKTGIDVLEFNE-AKDLVKVMQSKNIQVEEKKGIGTLIDELYKHAVRPDLIAPCFITHHTTEMKPLARRNNEDARLADSFQLVIAGWEVLNAYSELVDPIDQSERMRKQAEFRAAGDEESFELDEDYIQAMEMGFPPITGWGMGIDRIFALLTGQSNLRDIIFFPIMKPE. 489
230 0.000e+00UniRef50_A0A1G2TH32 Lysine--tRNA ligase n=3 Tax=Parcubacteria group TaxID=1794811 RepID=A0A1G2TH32_9BACT  ali  40  1..........MASIEEIRSARLNKLNFLIKKGNPYPTTAHQDITCKEAGIRFDELTG-----SKKNLSMVGRILSLRAQGKIIFFDFDDGTGRFQALLKKSEPSSELYELFEEAFDIGDFVEVKGTFFLTKKNEKTILAEEIRMLSKSLLPLPEKWHGLQDIEERFRKRYLDLLSNPGIKERFVTRAKIIELVRQFYLNDGYIEVDLPNLQPLAGGATALPFKTHHNALDMDFYLPIAQELYLKELLAGGMSKVFEIGKRFRNEGIDTTHNPEFTMLESNEAYADAKSQREFIEELFKFVVEGLFGKLQFEYQGQEINLEPSFKVMPYPE---------------------------------------VTDEEYKREIRPTLVQPTFLVDYPVSANPFAKRKEDNPNLIDRFQLVMGGLELVNAFSELNNSIDQRERYLEEDKKGKAGEKDISPSDLEYLEAMEYGMPPNGGIGIGIDRLVMLLTNVKNIKEVILFPTLKP.. 450
231 0.000e+00UniRef50_A0A291GTD4 Lysine--tRNA ligase n=19 Tax=Actinobacteria TaxID=201174 RepID=A0A291GTD4_9MICO  ali  39  650..DPLEEALAAQRLPEQVRVRLAKLATLRAEGIPYPVGIERTSTLA--AAREAAAGLGADARSGHEVRIAGRVMRRREHGRIGFATLRDGSGDLQVMI--ADAADDASWEVWRRLDLGDQIAVRGELITTRTGEVSVDAAGLVLTAKSLRPLPDKHHGLSDPEARVRERAVDLVVRPDARTTAYQRATVVRSVRDTLHELGFTEVETPVLQAVHGGASARPFETHINAYDMDLFLRIATELHLKRLVVGGMEQVFEIGRQFRNEGADASHNPEFTSLEVYEAYSDQHGMRRLTQRIIQDAARAVHGAPIGLRPGEEFDLSGDWPVVPLATAVSRALGEEV-EVGTPATDLHAHARRIGLELDPRLGGGAVLEELYGALCEGSTTTPVFYTGFPRENAPLARPDRDDPRLAEKWDLVIQGSEQGTAYSELNDPVDQRRRLVAQSLLAAAGDPEAMAVDEDFLRVLELGMPPTGGMGMGIDRLVMNLTGL-SIRDTILFPLTKP.. 1149
232 0.000e+00UniRef50_UPI0008353433 bifunctional lysylphosphatidylglycerol synthetase/lysine--tRNA ligase LysX n=2 Tax=Corynebacterium provencense TaxID=1737425 R  ali  34  631.DEVANPVRPHRRIPEQVRVRMSTAARLREAGDPWPVAVKPTVGCGDV----------TKLDADTPVTVSGRIMARRRFGGVTFLDVQDSTGRCQILVEASRP---AATTRIHDLDLADLVQVTGTVGASRNGTVSVLADSLRIEAKALHPLPDTRSGLTDPETRLRNRHLDMTVNPQVGFRLRARAAVLKALRGVLDADAYLEVETPVLQQTHGGASARPFMTHSNAYSIDLYLRIAPELYLKRLLCGGMDRVYELGRDFRNEGADATHNPEFTVLEAYRTHSDYHDMMDLTRRLICAAAIAVHGRPAVTGPDGLVDISGQWPVVSVYEAVTAALTEELTTPGTPVEELHRVADAIDYPWRADWDHGHLFEELYGDFVESRTTLPTFYVDFPASTSPLTRPHRSIDGVVERWDLVAWGTELGTAYSELTDPLLQRERLEAQSLLAAGGDREAMEVDEDFLRALEFGMPPTGGMGIGVDRLVMLIVGGG-IRDVLAFPMTK... 1130
233 0.000e+00UniRef50_A0A1G2M645 Lysine--tRNA ligase n=18 Tax=Parcubacteria group TaxID=1794811 RepID=A0A1G2M645_9BACT  ali  38  1..........MASLEELRKTRLEKLERLKKAGNPYPSNVPRDCSVAEAITRFDELSK------KTSVSLAGRVMALRPQGGLIFLNFTDGTAMFQALLKDGETPKEALELFNETVDIGDFVSLTGTLFVTKRGEKTLQVVSWTMGAKSLLPLPEKWHGITDPEERFRLRYLDLLMTPELRALFGRREKFWDITRVFMKEKGFLEVETPTLEVTTGGAEARPFKTHHNDFDLDVYLRISGELWQKRLMAAGFPKVFEIGRAYRNEGTSAEHVQEFTNMEFYWSFANYKDGMALTRELYIAIAKGIYGTTKFTYKEHEFDLAGEWKMVDYREEIKKQTGVDITKASE--KEIKKVLESLKVSYE-GETKERLVDTL-WKHCRKTISGPAFLINHPVLVAPLAKRVNGFEELVEMFQPLIAGSEVGRGYSELNDPIDQRARFDEQQKLIEKGDEEAMMPDFEFVEMLEHGMPPTCGFGFG-ERLFAILENKP-LREVQLFPLMRPKK 484
234 0.000e+00UniRef50_A0A2E6NMB6 Lysine--tRNA ligase n=3 Tax=Planctomycetes bacterium TaxID=2026780 RepID=A0A2E6NMB6_9BACT  ali  38  5..............PELLKKREELLARNLEL---YPYSWERSHTLLDVREN-------EKELMDKDVRVAGRLLAYRGKGKMIFIDLGDLDGRMQVMLRKNEFDEDTWELIRHGLDLGDWLGISGTVFVTRMGELSVHAKSLEMLAKTVVRVPIDWNKLADPETLCRERYLHWTTDPAARQKMVQRARIISEIRTFLDGRDFLEVTTPTIEMNYGGAEARPFETAIHALGHSAFLRISPELPLKRFIVGGFPRVYTICQNFRNEGIDRSHNPEFTMLEWYEAFTDYNFQMEQVEQLVSCVAEKVCGSMKIVYGGKEIDFTPPWKRTTILESLEEAG---IAAGEMDEDALREEYKKRDIEPPXPYTWGHAVAGLFEALIEHTIEQPTFVCDHPVAISPLTKKKRGDDRLVERXEPIVMGMEIGNAYSELTDPVEQQERFIAQQSLADKDGVENHPMDTDFLKAMGCGMPPTGGVGIGIDRLVMLLTDSHSIREVIAFPLMRTRE 490
235 0.000e+00UniRef50_E5XQK4 Lysine--tRNA ligase n=21 Tax=Actinobacteria TaxID=201174 RepID=E5XQK4_9ACTN  ali  38  609.EAPSDDKRNEPRLPQQVRVRIGKLERLQAQGNPYPESEAPTSTVRDALE-------AGRSRSGRQVRVSGRVLRERDHGGVVFVDLSDSSGVAQVILEERELSPGSLAAFRKEIDLGDLISVDAAPGASRTGTASLLATGWRLDGKCLRPLPDKRRGLTDPEAKVRLRHVELMTNPQARRALSVRGSVLRALREQLWGEGFLEVETPVLQRVHGGANAEPFRTHINAYDMPLYLRIAPELYLKRLLVGGMERVFEIGRVFRNEGVDGTHNPEFTLLEAYQAHSDYRGMRDLTEQMLRACARAVGN-------DGPLAAPGPWPMIPMLTAVSHALG-DEVDENTAVPKLRQHLASRGFEFRPDWDAGQLLLELYERLVEHRTTTPTFYSDFPLSVSPLTKQHPDRPAITQRWDLVIGGMEVATAYSELNDPVEQRRRLQAQSAAAAGGDPEAMELDEDFLEALEYAMPPTGGLGVGVDRIVMLLTE-RNIRETLAFPLVKPK. 1095
236 0.000e+00UniRef50_A0A1H0CUA7 Lysine--tRNA ligase n=3 Tax=Actinobacteria TaxID=201174 RepID=A0A1H0CUA7_9ACTO  ali  36  575......STAPPRRRTKQFGSRLGSRQAMLAQGEPYPPLVQVDSSCADARD---------------YCAVAGRVLAVRNHGGVVFADLRDRSGDLQAILERSGAGADAVGRFQRLVRSGDQVMVSGKVGASRNGTRSLLVQDWAMTSKALRPLPDKRRGIRDPETRVRQRHLALIVDPREREMVVARAHAIQAVREELLARDYLEVETPILQPVHGGANARPFKTHINAYDLDLYLRIAPELYLKRLMVGGMERVFEIGRNFRNEGADATHNPEFTMLEAYQAHADYNVMKDVTRELIVAAARAALGTTVVRGREREIDLSAPWRTVSVCDAVSEGLGEQVG-PDTPVQALRAHADALAMPYDPRWEWGNLMQELYEHLAESTTVEPTFFTDFPAQTSPLTRPHRGDARLAERWDLIVFGAEVGTAYSELVDPVLQRERLTAQSLAAAGGDPEAMELDEAFLEALEQGMPPSGGLGVGLDRLVMMLTGA-SIRETIAFPLVRP.. 1058
237 0.000e+00UniRef50_A0A0G0IN59 Lysine--tRNA ligase n=1 Tax=Microgenomates group bacterium GW2011_GWC1_38_12 TaxID=1618512 RepID=A0A0G0IN59_9BACT  ali  44  2.........AEKRLEEIRKVRLEKAKKLRELGIPYPSKVKKPMPISEVRKSHSA-----KASRDDFVEVAGRIMGWREHGNVVFADLKDETGKIQLWFQKNSLGEQ--FKLLKYFDIGDFIYTKGKVTKTSAGELSVDVSDFQVLTKSIRPLPSTWHGLKDVEERYRKRYLDLILNESVKERFDIRGRVVSSIREFLDARGYKEVETPTLQPVYGGGFAKPFITHHNALDSDFYLRISDEMYLKRLIVGGFEKVYEITKVFRNEGVDYDHNPEFTMFEAM-----------------------------------------------LVEAVKEYAGIDPLSWQSF-EEAKESAKKLVVKLEHMHTIGEVAAFVFEELVEEKLIQPTFIYDYPIEVSPLAKKC-DDERFTQRFEMFAAGTEFGNNYTELNDPVDLSKRFIEEKKREKAGFEEAHQTDYDYLTAIEYGFPPTCGVAIGIDRIVMLFTDAQSLKEVILFPTMRPEK 448
238 0.000e+00UniRef50_A0A117E639 Lysine--tRNA ligase n=22 Tax=Actinobacteria TaxID=201174 RepID=A0A117E639_9ACTN  ali  39  598.EELAEPLSPREKPSDQVRVRQERLQRLYDDGDPYPVGVPPTHALADVRD-------------GDEVTVAGRVLRVRDFGGIVFVTLRDWSGDHQLALTDAD-------RFRADVDLGDLVSCTGSAGRSDKGEPTVFVHGWQLTGKCLRPLPDKRRGLTDPEAKVRLRALDLVTSPAARDTIRSRAAVVQALRSGLLERGYLEVETPMLQQIHGGANARPFTTHINAYDLDLYLRIAPELYLKRLCVGGLEKVFEMGRTFRNEGVSPKHNPEFTMLEAYQAYADYDVMLDLTRELIQGAARAAFGTPVVRKGGEEFDISGEWPVKTVYGAISEALGEEVGA-DTELSVLRRLCDRVGVPYGDGDGRGDVVLEMYERLVEERTLLPTFYKDFPTDVSPLTRQHRADPRLAERWDLVAFGTELGTAYSELTDPVEQRRRLTEQSLKAAGGDPEAMELDEEFLEALAYAMPPTGGLGIGVDRLVMFVTGL-SIRETLPFPLVR... 1078
239 0.000e+00UniRef50_F2UFY8 Lysine--tRNA ligase n=1 Tax=Salpingoeca rosetta (strain ATCC 50818 / BSB-021) TaxID=946362 RepID=F2UFY8_SALR5  ali  39  29..................................YPCLAEKLTPIQHIRDKYIANTEPGQRFRDEEFTIAGRVTSKRQSGKICFYDIEDGISNIQVVAFGKDHRGEDYEEVHAAIRRGDIARVTGYPGTSKSGELSLFAQEAQLLAPCWHNIPDS---LTDVNLQLSERPLHMLVNQNFKNTLLVRSQVLQALRSFLVSRGFVEVETPILGSQPGGASARPFWTKSNALDRDYALRVAPELYLKKLVVGGLPRVFEIGKVFRNEGIDRTHNPEFTSCELYQAYAPFEELFDLTEHLLRHVVQAVGGSLVLNVHGTPVDLSAPFQRLAFVDTIEKATGTRVVDAHTPLPALADLCEQHGISTDAPLTAASLLDRLAAHFIEPLCVQPTFVYGHPTCLSPLAKQSQTQAGISDRFELYIDGKEIVNAYNELNDPDEQRSRFREQEAERAAGDDEAQVPDEDFCRALEYGLPPTVGWGMGIDRLIMLLTDTGNIRDVIAFPM..... 496
240 0.000e+00UniRef50_A0A2I1KS28 Lysine--tRNA ligase n=7 Tax=root TaxID=1 RepID=A0A2I1KS28_9ACTO  ali  37  598...........ARVPTEVRERLASRERMLADGVPYPACVTVTSSCAAALAAGPAQPTPDDAAAGTPVTVAGRVMSLRDHGGVIFASLRDWSGDLQVLLDAGGAGQECLASFRRLVRIGDQVAVTGAPGASRNGTPSLVASSWTMTSKALRPLPNKHRGLQDPEMRVRQRHLALIISSRDRRMLVARSHAIQAVRSTLLQRGYLEVETPMLHPVHGGANARPFRTHINAYDLDLYLRIAPELYLKRLMVAGADRVFEIGRSFRNEGADATHNPEFTMLEAYQSYADYTVMKEVVQDLAVHAAKAALGTTVIRGTVHEVDLAAPWRTVSVCDAVAEHLGEPV-DASTSLGTLQAFADRLNLAYDPAWGWGTLVQHLYEHLAEGTTAQPTFFTDFPAETSPLTRPHRSLPLLAERWDLIIFGSEVGTAYSELVDPVLQRERLTAQSLAAAGGDPEAMELDEAFLQALEQGMPPTGGLGVGLDRLVMMLTGA-SIRETITFPLVRPGK 1105
241 0.000e+00UniRef50_A0A2H0RQL1 Lysine--tRNA ligase n=1 Tax=Candidatus Peregrinibacteria bacterium CG10_big_fil_rev_8_21_14_0_10_55_24 TaxID=1974791 RepID=A0A2H0  ali  41  10SGQQDAAYEEM--FGEYYRKR----KRLAEAGVPVPERFDRTLTAQQLRDMADALTADAGQMPEEIHACAGRIANIREHKRSTFIDLIEGTGRVQTLVDRQKL-EGTQQVIYENLDRGDFLGVRGFPFATRTGEPTIRAQELVFLGKTLRDVPDIGTPL-DVETQYRQRYLDLVVNPEATKRFVLRSRCISAIRRFMEENSFMEVETPIVDSLATGALAKPFGTHHNALDIDCQLRIAPEIPLKKLIIGGFERVFEIGKQFRNEGMSPEHMQEFTTMEFYWAYTNYRQLMDFTEEWFRQVVGRTLGSTQFAYEENTIDLSGPWARKTFQELILDHVGIDVDMYPEQAALEVAANAKTGGDYTGKSTRGGTIDLLYKKHVRGNLVQPTFILGHTADESPLARRNDDNPTLVDRFQVVMGGTEVVNAYSELVDPIDQRIRFEEQARAKAAGDEEAHAIDREYLRAMEHGMPPIAGWGVGVDRLIMMMTQQQNIRDVVLFPIMRP.. 506
242 0.000e+00UniRef50_A0A0G1BZU0 Lysine--tRNA ligase (Fragment) n=1 Tax=Parcubacteria group bacterium GW2011_GWD1_42_9 TaxID=1618938 RepID=A0A0G1BZU0_9BACT  ali  39  4............REEHELASRRQKLELWRQLGFSYPANFKRSHSASQVAEKSVSVLEGSEIPPGDEVSVAGRIMTVRPHGRLWFATLEDQTGKIQLGAIEEAADKKMW-QLLQAIDRGDIVGAEGVVVKTKRGEPTVFLTKLVPLAKALQPLPEKWHGLKDIEARLRHRYVDLLMDEEVRQMFVKKSNFWRTVRGHLSSAGFLEVDTPALETVAGGADANPFVTHHQALGKDFYLRISLELPLKRLLVGGFEKVFEIGKVFRNEGIDTEHLQDYEMCEFYWTYADYEDLMTFTQELYQEIVRGVTGGLETTYEGKKIDWSGKWPRLDYFELIKEHTGVNLAGMTDVNE-LQKLLTKHKVSYEKNMGAGRLIDLFWKKLVRPKVQGPLFVINHPVEVSPLAKRLPTDSSRVQRFQIIVGGTELGNGFSELNDPADQRARFEEQMKLRAAGDTEAQRLDEDFIEALEYGMP................................... 462
243 0.000e+00UniRef50_A0A1V5TQE2 Lysine--tRNA ligase n=24 Tax=cellular organisms TaxID=131567 RepID=A0A1V5TQE2_9ARCH  ali  39  1..........MGREEQIISERIRKLEELRKEGIPYPNKYDKKQTCLE----------CSKSKIKSKVKTAGRLMTKRDLGKIAFCVLRDGTGDIQLVIQEKETPEKFREFFKKYLDSGDFVGVEGEIIKTKTGEISILVKKIEIISKSILPLPEKWKGLQDEEERYRKRYLDILMNKDVKEMFVKKAKFWNSIRNFLLEKGFLEVETPVLESSAGGAAAKPFITHHNALDLDVYLRISGELWQKKLMVAGYEKTFEIGRQFRNEGMDMEHLQDYTQMEFYWSYANYQDGMKLVEEMYKKVSKEVFGKMKFDIHGYKVDFSKKWEIYDFETLIKKETKXXXXXXXXXXXXXXX--XXXXXXYNPSVDKWRLVDQL-WKYCRKKISGPGFLTGQPVELSPLAKRNPEDKRKVEQFQVIIAGSEVGNGYSELNDPLDQEERFKEQSKQKEAGDEESMEHDKGFVEALKYGMPPTCGFGLS-ERLFAFLMG-KTLRECVIFPLMKPE. 480
244 0.000e+00UniRef50_A0A063YHQ5 Lysine--tRNA ligase n=70 Tax=Bacteria TaxID=2 RepID=A0A063YHQ5_9MOLU  ali  42  2..........ERKFTEQETNRRNKIPSLAEQNIAFNSTVKPTITCIEIEEKYQNFTREELEKKAINVILNGRVIAQRGP----FLVIQDKRTTMQIYCDKKNINEQS-QIILKQLDLGDIISVEGSVSKTHTNALVVKANNIILLTKALKPLPDKFHGLIDIEDRYRHRYVDTIVNEKARNTFILRTKIIKLIREYFDNLDYLEVDTPVLHPILGGAAAKPFVTFYNALNHNFYLRIATELPLKKLIVGGYERVYEIGRIFRNEGVDTTHNPEFTSIEFYEAYSDVWGMMDRTEELFRFITKKLNIST-VNFNGEKISFASPFKKLNIVEALNEKLGIDLRKLND--KDAKELAKKHNIKWQSYYKLGHLINELFEKYIEETLIQPTFVYGHPIEISPLAVKDPEDPRFTLRAELFINKKEFANMFTELTDPIDQXXXXXXXXXXXXXXXXXXXXXDWDYINALEYGLPPTGGCGIGIDRLIMLLTQNDSIREVLLFPQLK... 485
245 0.000e+00UniRef50_F9NXQ3 Lysine--tRNA ligase n=105 Tax=Bacteria TaxID=2 RepID=F9NXQ3_9ACTN  ali  38  613..EERTPTLPQRRLPEQVRTRMATRERLIESGVAYPPDCQPDHRPGDVV----------GELTGQKMTVSGRVGACRDHGGVIFVDLFDWTGACQLVMERDAVGVDSLRDFRHAVSLGDHLVAAGTVGASRNKTLSLETTSWRLAAKSLRPLPPRRSGFNDPEAKVRQRYLDLIVNPGARDQLRARSNAIRAVRETLLSHDYIEVETPILQTIHGGANARPFRTHINAYDLDLYLRIAPELYLKRLMVGGAGRVFEIGRNFRNEGADATHNPEFTMLEAYQAYGDYVQMRHLTREMILSAARNAIGGTVVRGRDHEVDLANEWHVVTVNEGISRGLGEEV-TADTPKETLMGYANKLGIATLPKWSRGDVVLELHEHLSEHVTVEPTFFCDFPTDVSPLTRQHRDDPRLAEKWDLIIFGSEVGTAYTELVDPVIQRERFTAQSLLAAGGDPEAMELDEDFLEALEYAMPPSGGMGMGLDRLVMMLTNA-SVRETISFPLVRP.. 1106
246 0.000e+00UniRef50_M8BR39 Lysine--tRNA ligase n=1 Tax=Aegilops tauschii TaxID=37682 RepID=M8BR39_AEGTA  ali  39  1...........MDPTQYYENRLKTLDVLKAGGNPYPHKFLASISVPGYIEKYKGLNEGEKLADVTE-CLAGRIMNKRSSSKLLFYDLYGDGVKVQVMADASELEDTEFSSFHSGVKRGDIVGICGIPGKSNRGELSVFPRKFVVLSPCLHMMPRQKYVLRDQETRYRQRYLDLMVNHEVRHIFKTRSKIVSFIRRFLDGLDFLEVETPMMNMIAGGAAARPFVTHHNDLNMKLYMRIAPELYLKELVVGGLDRVYEIGKQFRNEGIDLTHNPEFTTVEFYMAYADYNDLMELTEAMISGMVKELTGGYKIKYHPIEIDFTPPFRRIDMIEGLEAMAKLEIPKDDETNKYLIDACAKYDVKCPPPQTTTRLLDKLVGHFLEETCVNPTFIINHPEIMSPLAKWHRSRPGLTERFELFVNKHEVCNAYTELNDPVVQRQRFEEQLKDRQSGDDEAMALDETFCTALEYGLPPTG................................ 515
247 0.000e+00UniRef50_A0A087SF48 Lysine-tRNA ligase n=1 Tax=Auxenochlorella protothecoides TaxID=3075 RepID=A0A087SF48_AUXPR  ali  41  32....EAGPDRTPSEEDIRSVRIGKAQALRDAGEPYAYSFDRSASAAQLQAAHAELPAGQEDREA-RVSIAGRITLRRVLGKLAFARLNDESGAIQLYFDKGTLGQPAFARVKDVLDIGDIVGAEGHMKRTDKGELSVVVTSWTMLTKAIQPLPDKWHGLADVEARYRRRYVDMIVTPGVTNTLRARSKTISALRRALEDRGFLEVETPVLETAAGGADARPFLTYHNVMQRQLSLRIATELHLKRLVVGGLERVFEVGRIFRNEGVSSRHNPEFTS--------------------------AVTGSAAITYQDTAIDLGAPFRRATMHSLVQEATGVDFGGFSTADTAAAIEAAELATAIAAATSPGLVVNLLFEALVESTLEQPTFVLDHPVEVSPLAKRHRDNPALTERFELYVAGRELANSFTELNDPLEQRARFEAQLASPGAGPDVDYELDEDFLSALEVGLPPTGGMGMGIDRLVMLLTDSPSIRDVIAFPLMK... 538
248 0.000e+00UniRef50_A0A175JW60 Lysine--tRNA ligase n=8 Tax=Entamoeba TaxID=5758 RepID=A0A175JW60_ENTHI  ali  39  4...............QLFLNRCKDVEEYQKAGNPWPHKFNVSITVPEFIAKYSGLEKSQVS--DDIVSVAGRVLSKRSSSSLMFIDLHDSQTKLQIMLNKSYENKEDFVSLTKMIYRGDICGFTGHPTRTKTGELSLIPISGMILSPCLHMLPSMHYGLGDQETRFRKRYLDLIVNPESVKNFVLRTKVVKAVRKYLDDKGFLEVETPILNTIPGGATARPFITHHNQLDIQMYMRIAPELYLKELVVGGINRVYEIGRLFRNEGIDQTHNPEFYMAEPIPRPFNSAECSKVIEKHCTELNYYYDGNNEVTEKKMVLDFTAPFKRISYVHALEEKFGEKIPRPLDGPEFLKKQAIRFNAICAEPQTTARVMDKLFGDLIEVDLVQPTFVCDQPQLMSPLAKYHRSEPELTERFELFILKREIANAYTELNNPIVQRSNFEQQAKDKAAGDDEAQLVDEVFLDAIEHAFPPTGGWGLGIDRLAMLLADVDNIKEVILFPTMRP.. 561
249 0.000e+00UniRef50_A0A2E5WMG3 Lysine--tRNA ligase n=1 Tax=bacterium TaxID=1869227 RepID=A0A2E5WMG3_9BACT  ali  37  1...........MSQPKEVQDRLKKVQELRDMGIPYQDRGKQTHFNKDLLTI-ENLPDIDNVSTDQNISICGRLLLFREHGKISFGKLRDESAEIQICFMRDFLDED-YKFAKKYLDLGDYIEAQGDMFLTHKGEPTLLVRKFKLISKAIRPLPEKFHGVSDIEIQYRKRYLQTSTDRQAFERFRKRTILVQKIRDFLNENRFMEVTTPTLSSSASGALAKPFTTFHNATKSDFYLRIAPETALKKAVACGFERVYEFAINFRNEGLDPSHLPEFMMLEFYASYWNYEDLMDFTEKMIKKVIQETCGTLKIQHQGKTIDFSGEYPRVSMRDLIFKDCGIDIYVEKDIESLKKAILDKIKVKDFDNLGYGNLIDNLYKKVSRPKIINPIFLINHPVELSPLARMNDENPEIVDRFQLVCNTWEILNAYSELTDPVDQKQRFMQQAEYKTQGDDEAMMIDFSFLDAMEHGFPPMAGFGMGIERLLCLLLDQENLRDVVLFPMTK... 490
250 0.000e+00UniRef50_A0A2H6GR26 Lysine--tRNA ligase n=1 Tax=bacterium BMS3Abin15 TaxID=2005723 RepID=A0A2H6GR26_9BACT  ali  38  2THEKAKKSLTEASINNEKIVRRNHLSCLKKAGIPYPEKFNKRHFAAQVNKKLLRSGDDVQASPRKTVSVAGRIITLRRHGKIIFSDLQDETGKIQICFKRDLIDDKSFSLLSNCVDQGDFIGVSGEPFITKQGKLAILCVKYFFLGKSLRPLPGKFYGFEDIEKRYRQRYLDTVINHNVFQIFLVRSRLVQGIREWLSKHNFVEINTRVLQPQEGGAMAKPFKTHHNALNHDFVLRISPELDLKMAIIGGFERVFEFAISFRNEGIDPSHLQEFQMLEWYCAYENFEHGMQWTEKILKYSVPKALGRSIFTVYDQEVNINCKYHRIKFSKLLSEY-GIDMFAPKD---KLVALAMQNGIKKEEKRSQGNLIDDIYKKLILPNIIQPTFITHYPSDLLPLARPNDSQPELADSYQLVIASREIAKGYSELTDPIIQRKALEEQARAREMGDDEAMAVNEEYLAAMEHGMPPITGCGIGIDRLVALINGQKNMRDCVFFPLLKPDK 513
251 0.000e+00UniRef50_UPI000D70FD34 lysine--tRNA ligase n=1 Tax=Geodermatophilus normandii TaxID=1137989 RepID=UPI000D70FD34  ali  41  476...QGQGPAEAAGRDDQRAQRLRKLQALQER-RALPYRYPTDASAAELHSRHAGLPPD--SRTTDRAHVAGRLERVRRQGHLTFATLRDRTGTVQLFVDSSVLGAARHAEF-DDVDRGDWLGAEGTVVTTRRGELSVCVEDFAVLGKALLPPPDAHRGLPDVETRYRQRYTDLAANERTREVFRIRHTAVRAIRRHLEDRGFTEVEGPVLQSIQGGASARPFVTHHNALDLDLYLRIALELHLKRLIVGGMERVFEIGRVFRNEGIDTRHNPEFTLLEAYQAFADYTDMMDLTEVVTAAARAALGDDLTVHHGGHAIDLGAPWPRRRFADMIAEVTGAAMHPAMPVGEA-RAVLDRLGVPYEAGWGPGRLMKEVYDERVQHSIVGPVFCVDHPREVSPLARTHRDDPAYVERFELIVAGFELCNAYSEQNDAVEQLAAFEAEARAKEHGDPEAGDVDLDYVRALERGMPCTGGLGIGIDRLVVLLAGVDSIREVILFPTLRPES 973
252 0.000e+00UniRef50_A0A2M8KID3 Lysine--tRNA ligase n=10 Tax=Parcubacteria group TaxID=1794811 RepID=A0A2M8KID3_9BACT  ali  36  1..........MAKLEELKQIKQKKLVALKKAGIPYPDTVGNFIAIKDLLTDFKCLT-----QKQKKVFLVGRIMLWRPQGGLIFGQLRDQSGQIQFFVSKKDIGEKEFALW-QNLEIGDFLRLGGKLFLTKRGERTVNVSDFKILSKALTPLPEKWAGLQDMEKRLRQRYLDLLLNQKAGEIFKRKTLFWQSAREFLTKQGFLEVETPILEMVPGGAEAEPFLTHYNALGQDLYLRISLELPLKKLLVGGLEKVFEIGRVFRNEGMDAEHLQDYTSLEFYWAYHNLADLQKIVQEFFRFIIKKTVGRLQHQYQGQKISWAKNFAQIDYFALFQKNVGLDLSNASDADLRAKIKLLKLKTGLDNKLGRGRMIDLLYKKICRPKIIQPSFLLGHPVEVSPLAKRDPQKPGRVLRLQPVAGGVELGNGFAELNDPLEQRQRFEQQMKLRQAGDKEAQILDDDFLTALEYGMPPAAGFGFS-ERLFAFLLD-KSVRETTIFPAVKNKE 488
253 0.000e+00UniRef50_C0VYH9 Lysine--tRNA ligase n=1 Tax=Actinomyces coleocanis DSM 15436 TaxID=525245 RepID=C0VYH9_9ACTO  ali  37  595.........PDRKVSQQVAQRMTKRADMLTGGAPYPASFTRDQRVGEVIS----------ASPGTSVRCAGRVVARRDHGGVIFLDVQDWTGTVQLLASAAQVGADTMRILRRDLSIGDHLGFWGAVGTSANGTFSVLLEGAQITSKALQPIPALWQGLTDEQMKVRRRYLDLIVNPVARERVRVRSQVIQSIRQTLLDDTFLEVETPLLQTIHGGANARPFRTYINAYNLDLYLRIAPELYLKRLMVGGADRVFEIGRNFRNEGADATHNPEFTMLEAYQAYGDYNSMRELTQRIIVNAAKTALGTTVIRGQIHEVDLAQPWRVITVHQGIAEACGRDV-TVDTPVSELLEIAAEHGLEVDPGISRGQLILDLHEELAEQHTIAPTFYCDFPTEVSPLTRQHREDERIAEKWDLICFGAEVATAYSELVDPVVQRERLLAQSLLAANGDPEAMEVDEDFLLALEYAMPPSGGMGMGVDRLVMMLT-QTSIRETIIFPLVKPQK 1083
254 0.000e+00UniRef50_A0A1F9V9P1 Lysine--tRNA ligase n=2 Tax=unclassified Elusimicrobia TaxID=1797919 RepID=A0A1F9V9P1_9BACT  ali  41  8..SQNEPWDQNLDPT-LIQNKKEKLLKIKSLINPFPAKLQKRVSTLQIKEQFKTIEKEESE---ENVHLCGRMIRRRDMGKASFAHIQDFYGQLQIYVRQDLVGEPEYEMFSKNFDLGDILSVEGKMFRTKTGELSLKTKKIVLLAKSLRPLPEKWHGLKNIELCYRYRELDLISNPESRTLFEMRAKIIQSLRSLLYKEGYLEVETPMIQALAGGAVARPFETFHHALNQKFYLRIAPELYLKRCLVGGFEKVFELGRVFRNEGIDTLHNPEFTILEAYEAYGNMESMMELTQRLIVETAKNVSS-------PNLNLLKTPFESYTLGELFQKHVGSE--EAIWVKEQNWKKFSEKYSNEFKEIEDYKIFDRLFSEKIAPHLVNPTFVTEFPADFSPLAKCVEGSTQLADRFELYIQGEELANAYSELNDPMEQKLRIEKQNKTKKENSDEGVVLDTSFIESLEIGMPPAGGLGIGVDRLVMFLTGQNSIRNVLLFPTLK... 507
255 0.000e+00UniRef50_A0A1F5EK61 Lysine--tRNA ligase n=1 Tax=Candidatus Campbellbacteria bacterium RIFCSPLOWO2_02_35_12 TaxID=1797580 RepID=A0A1F5EK61_9BACT  ali  37  6..............DKFREDSLAKLEILKKAGNPYPSKSKRNKKIAVFLDNFNK---------EENAILAGRIRSIRSHGKIGFADIEDESGKIQIFFQSENL--DNFELLLETLIIGDIIEIKGKPYLTKAGQQSIQAENIKILSKSIASWPVEHFGIKDKEERFRKRYLDISLNSEVKKYFIQKTKIIKAIRDYLEKADFTEVSTPVLQTIAGGTMAKPFKTHLDAFDMDLYLRIAPELYLKRLLIGGFERIYEIGPIFRNEGIDREHNPEFTMMELYHTYQDWEWLINFTENMLK---------NVFEIAEKPLLKDNKWRNIEFSKLIKEKTGLDYEQ--DLKEDFEKFAEKSNINIAEYFSKGKIADEIFKKLIRIDIKEPTFVTKIPIDISPLSKQLEDESKKTARFLLIINGMELVNGFSELNDPIEQAKRFESQMEMRKKGDKEIQEYDKDFIEALEYGMPPTAGLGLGIDRLVMLLTGASNLREIIEFPLMKRK. 473
256 0.000e+00UniRef50_A0A293NF82 Lysine--tRNA ligase n=1 Tax=Phycisphaerae bacterium TaxID=2026778 RepID=A0A293NF82_9BACT  ali  41  11.......SPEATDASSLVAARRDKLRRWRELGEPYGHRVDGLISLDEARGIFDPSAHDAWAAAQEVVKVAGRCVQHRAMGKLVFMVLRDHTGDLQVSLSKXEMEPAAFK-LASKLDYGDVVVAEGRMGMTRKGEICVWASDFQVHAKSLAPPPEKYHGLTDQEARYRRRYVDMYTNPETMQVFYGRSRIISCIRRFMEARDFVEVETPMMQAIAGGAAARPFITHHNALDMQLFMRIAPELYLKRLLVGGMPKVFEINRNFRNEGLSRRHNPEFTMLEAYQAFGDCETTLELVXSMCREVATMLADSMVRPWGDLEIDWSKPFARRXYEDLVREGAGVEMRXXX----AVRXAAAAXGIXDAXTRXHWLLVEALFESRGEPLLDPPTYVTGFPXAVSPLTRPDADDPVVSHRAELFVAGMELGNFYTELNDPAVQLARFEDQLDGADDEVNAFRAMDRDFIDALEVGMPPAGGVGVGIDRLVMLMTNQSSIRDVVLFPLMKPE. 517
257 0.000e+00UniRef50_A0A0G0FNI4 Lysine--tRNA ligase n=9 Tax=root TaxID=1 RepID=A0A0G0FNI4_9BACT  ali  41  5........DTELSIQGDYESRLEHARKLEVLGIPFPAKFRATHTSQELISQYSLLE-------GSQVSIAGRLQSKREHGKIIFGHVEDRAGQIQIVMNQRIL-DGQFPIIKDLYDTGDFVGAKGELKATNRGEISIWAKEMTMLTKALRGAPRK---IADAEIMQRQRYLHTLVDPDARDRFRIRSKIVQSMRDYFDSLGALEVETPVLDTTYGGALAKPFITNHNALDTEMYLRISNELYLKRMTVGGFSEVFEFSRDFRNEGMDRTHNPEFTQVELYMPFWDYNNMMDMTEDLMSGIARQLHGTTEVPYKEVGIDYKTPWRRVSIYEGIREMLGIDPSNISDSR--LRTIAHQYEID---TYTRGDVLVELFEKVWEKDLIQPTFVMDYPADTSALTKRHRTNPDLTERFEIFVAGMEVGNSYSELNDPRDQRTRFETEKLKREHGDKEAMPFDEDFILAMEYGMPQQAGIGISIDRWTMLLTDTNHIRHVIYFPPVRPKQ 497
258 0.000e+00UniRef50_A0A2M8NKV2 Lysine--tRNA ligase n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2M8NKV2_9CHLR  ali  42  1..........MSKLESIIKQRRAIRDRLIAEGAPYPQDGRRSHTNAEALA----------EPEGASVTVGGRVRALREMGKIAFAKIEDETGMIQIVLRK---GDTADFERLKDIEIGDFMRATGSRMVTKTGEQSVLAARFELLAKALRPLPDSYYGLANEEQRYRRRYLDLIMNKDVAEVFRKRSIIISSVRRTLERHGFLEVETPTLQPLYGGANARPFITHINAYDMPMYLKISDELYLKRLLIGGFDKVYEIDKDFRNEGISYRHNPEFTMMECYAAYWDYTDIMRLVEEIYRDAAIAATGSDIVPYQRVELNFRDPWERLTMKDGIRRHLAIDVDELSDAELAAELNRRRPAPGDAEPFNRGKAIAELFE-FTEDHYIQPTFIIDFPRETTAFCKPHRDDPTLIERLEPYIARMEVGNGYTELNDPVLQRQFMMDE------RGDDAQPLDEDFIQAMEYGMPPAGGLGLGIDRMVMLLTNQSKIRDVLLFPTMKPLS 490
259 0.000e+00UniRef50_A0A1S8VXC3 Lysine--tRNA ligase n=1 Tax=Batrachochytrium salamandrivorans TaxID=1357716 RepID=A0A1S8VXC3_9FUNG  ali  36  76..ESTLPTSPDAD-EEYHALRMQQLSLLNE--NPYPLAVDPSHSHPAFISTFDDLPPETWLDDSYQASITGRVVLRRDASKLIFLVIERQGIQVQAIMNRRVWPVEQWDAFSNAIGLGDIVFIHGQPGRTKAGQLSLRANSVVILAPCLHFYPKKHVLLLDENVRFRQRYLDMLVHPNTVQVFKKRSKIITEIRSFLDRRDFIEIETPVLSATSGGANAKPFKTRMDAMKLDLEMRIAPELYLKQLVIGGIERVYEIGKQFRNEGIDKTHNPEFTTCEFYQAFGTVEGAMKLTEDMIRGIAQSVNGSTIVSWEMVEIDMSPPFRKIAILPALEEALGQSLPDVNDPISQLLEICKEKNITLRAPFTVPRILDRLISHFIEPRCVQPTFLTGHPICMSPLAKAG-TQEGIADRFELFIGTKELANAYLELNDPVEQRRRFVAQRLQRDQGDMEAQSMNEEFCVALEYGLPPTVGWGLGIDRMCMLLTQSTRIREVIPFPILRPIE 589
260 0.000e+00UniRef50_E3B9M5 Lysine--tRNA ligase n=23 Tax=Actinobacteria TaxID=201174 RepID=E3B9M5_9MICO  ali  36  604.EELLTPARPVQRLTEQQRVRHAKLDVLREAGMPYPVDVPYTMTVDLARK---AIVEGNGVDAG-VVSLSGRVRALRDLGGVVFAFIEEHDVRLQVVLEAGAVDPQLMRLWRRTVDVGDHVSVTGTLGHSRRGEPSLLASSWCMASKSLRPIPSDHTGFTNPEARVRQRYLDLIVNKDSANLLRARSRGVSALRRAFEERGYMEVETPMLQAVHGGASARPFRTHINAYNADLYLRIAPELFLKELAVGGMDRIFELNRNFRNEGADATHNPEFTSVEAYAAHGDYNTMRVLTRELVLEVATAIHGEPVAVRPDERLRLDHEWPVVPVHEAVSQATGTTL-TSNTPLEEVRAVADAHDVHWAETMTAGEVVLELYDELVEGQTTMPVFYTDFPLETSPLTRTHRTDPKLSERWDLVAFGAEIGTAYSELVDPVDQRNRLTEQSFKAAAGDPEAMEVDENFLAALEYAMPPTGGLGIGVDRLIMMLTG-NNIRATLAFPFTRPNE 1106
261 0.000e+00UniRef50_A0A0G1YKA2 Lysine--tRNA ligase n=3 Tax=Candidatus Peregrinibacteria TaxID=1619053 RepID=A0A0G1YKA2_9BACT  ali  40  9..................EFRLKKAETLRKKGPPYAATFDRTHMLGE----------GRNLSDGTKIRAAGRVMLFREMGGMIFATLQDHTGRLQVAWKADEIPEEEFRNVLEFVDLGDIIGISGERFTTKKGEPTILVKEWTMLSKALRQPPEKWHGIADQETAWRQRYLDLMSNRETYDRFLFRSLFLRRLREFYWAHDFIEVETPVLTNAASGALATPFVTHHKGYDLDVFLRIAGETFQKECLVGGVDRTFEVARCFRNEGLDPSHLQDFTMVEHYAAYWDYEQNMAFTEEMLSIILKDLMGTTKLQIPNREVDFKPPWPRASIAELIQHDCGIDIRSTATADDLRKEIRKKIHLEVDASLERGNLIDQLYKKVSRPKIVQPTFLTNHPTDLSPLARLNDDDPAITDRFQLVVGGWEIVNAYSELIDPVDQARRFEEQAKARAKGDTEAHRKDDEFVKALEYGCPPCSGLGMGIDRIVALLT.................. 475
262 0.000e+00UniRef50_UPI0002485DF2 bifunctional lysylphosphatidylglycerol synthetase/lysine--tRNA ligase LysX n=1 Tax=Corynebacterium nuruki TaxID=1032851 RepID=  ali  35  629.EETANPPRPARRVPEQVAVRIATAQRMRDAGEPWPVTTAPTAGCGDISDR--------SAGPGTTVTVAGRVMGRRRFGGVVFLDLQDLTGRCQILLERDR--PASLAGLRD-LDLADLVQVTGTVGTSRTGTPSVLADTVTVEAKALHPLPDTRSGLTDPETRLRNRHLDMTVNPELSRRLRARGAVLGAIRSELGGDGYLEVETPILQKTHGGAAARPFLTRSNAYNMDLYLRIAPELYLKRLLCGGLDRVYELGRDFRNEGVDATHNPEFTVLEAYRTHSDYRDMMDLTRRLIQAAAAAVHGSPKVVGDGDLVDISGDWPVVSVYGALTDALPGWQLTPSTPVEELRAIADIIGFDYRTEWDHGYLVEELYGDYVEDRTTTPTFYADFPVSTSPLTRPHRSIAGVVERWDLVAWGTELGTAYTELTDPLLQRERLEAQSLLAAGGDPEAMEVDEDFLRALEFGMPPTGGMGIGIDRLIMLIVG-GSIRDVLAFPTTR... 1130
263 0.000e+00UniRef50_UPI0006899BBE lysine--tRNA ligase n=1 Tax=Bryobacter aggregatus TaxID=360054 RepID=UPI0006899BBE  ali  38  9................IRNVRLQKIASLRELGNPFPSKSHRSHMAAAITSDYD-------AKEGQQVTVAGRLMSWRKMGGMAFGNVQDQSGQIQIALRRGEMGTLGFENF-NLLDVGDVVECTGKVGKTKTGEISVIADSLRILTKSLRPFPDKHFGIKDREIILRKRYLDTTVNPENRTHFEQIALMLFEIRRFLNLKGFLEFNTPIIQPQYGGGTAKPFLTRVNALSTDMYLAISHELYLKRLITAGFDKVFIIGRHFRNEGIDRSHHPEFVMLETMTAYENYEYNMRLIEEMFRHIAVNVFQRTTFQVKGHEVDFAHDWPRIRMTDAVRDATGIDF-TAITDVEVANAKLAEIGIHDPQP-SVGNALVRAFEEKVEKTLIQPTFIYGHPIEISPLAKPMQEDPRYVERFEIFIAGMECGDNWTEQNDPVQLLSTWKKAFKPEDRDEGEFHPLDYDFVETLEHAMPPTTGIGPGLERMAMIFTGQEDIYDVIFFPMMKPL. 493
264 0.000e+00UniRef50_A0A1Y2GZ51 Lysine--tRNA ligase n=1 Tax=Lobosporangium transversale TaxID=64571 RepID=A0A1Y2GZ51_9FUNG  ali  36  66......................ARLGELERQGIPYPYQSPRTIPVKEVIAKYQDKIEVGTKDKSKKISINGRIYSKRDSSKLIWFDLIQDNQSIQAVFNRRNYNDQEFEKAAKNFQRGDIVQLTGHIGKTKTGELSVFITEFELLSPCLHAIPMR-SGLKDPEKRFRNRHLDFLVNRDALEILKKRRDVIKFIREYLDSRNFLEVETPILSTQAGGANAKPFTTRANALDMEMQMRVAPELYLKQLVIGGVDRVYELGKQFRNEGIDADHNPEFTTCEFYQAYANLEDLFEMTEDMLQEMAKTITGSTTISTNPIELSFEKPFRRINIMEFLEQKLGAPLPDLEEPIAELLELCKEHNLFVPAPHTIPRIMDKLISFFIEPECVQPTFLWGHPIIMSPLAKDIQLDSGRAGRFELFVAGKEIVNAYEELNNPVQQRDRFVKQQRDKENGDEEAQPMDLAFCGALEYGLPPTAGWGMGVDRVCQILTGSQHIRDVLAFPTMR... 558
265 0.000e+00UniRef50_A0A2N5ZU33 Lysine--tRNA ligase n=1 Tax=Candidatus Parcubacteria bacterium TaxID=2053309 RepID=A0A2N5ZU33_9BACT  ali  36  9................EFEERKIKLNTIREKGIPYTSKNNRTNHISEVLDDFD-----ENLVKSITFVLSGRLKSKRTHGNLTFANLEDSSASIQIAFSKKEIGDDSYKDFVKLIDMGDFVEVGGSCFLTHKNEKSIMVSEWRVLSKAIRPLPEKWHGLQDDDKKQRFRELEMISDRRAYERFKKRFEATRAIREYMWANKFVEVETPILQNVYGGTYAKPFTTYYHGLDQDFYLRIAPEMFLKRTVAGGFERIFEIGKCFRNEGMGPAHLQEFTMFEFYWPYVDYNFLMDFTENLIKEVVEKVYKNFVVKYGDNEINFQPPFPRKTFDELLKENLGVGVKDLDTEEKVEKFVMEKNKVNVKDKIGWPAKIDELYKKTVRNKLINPVFVTDYPKELMALAKTKEEEPEKVATFQLVINTWEMIKAYNELNDPIDQRERFEAQERLVIEGDEEAMPFDHDFVESMEYGMPPMAGWGMGLDRFFALLEGEENIRDMVMFPTMKRLQ 495
266 0.000e+00UniRef50_A0A2P5YG81 Uncharacterized protein n=7 Tax=Mesangiospermae TaxID=1437183 RepID=A0A2P5YG81_GOSBA  ali  41  84.................RAIRLKKVEQLRSKGEPYGYKWDRSHSAKELQEIYKDLNNGEELDSESHVSIAGRIVARRAFGKLAFLTLRDDSGTIQLYCEKERLLNDQFEQLKTLVDIGDILGASGSIKRTEKGELSVKVVSFSILTKSLLPLPDKFHGLTDIDKRYRQ-YVDMIANPEVADIFRK-----------------------RAKGAAGGAEARPFVTYHNSLGRDLYLRIATELHLKRMLVGGFEKVYEIGRIFRNEGISTRHNPEFTTIEMYEAYSDYQSMMDMAEEIVTQCALEVNGKLTIDYQGTEIQLQRPWRRETMHNLVKEVTGVDFTELEDDLKVAKDVVLKAKSSIEACPSLGHLLNEVFEIFVEPKLLQPTFVLDYPIEISPLAKPHRRHAGLTERFELFICGRELANAFSELTDPLDQESK-----KNIDEDSMYEVTLDDDFLTALEYGMPPASGMGLGIDRLVMLLTDSASIRDVIAFPVLK... 549
267 0.000e+00UniRef50_Q7VEV7 Lysylphosphatidylglycerol biosynthesis bifunctional protein LysX n=609 Tax=Bacteria TaxID=2 RepID=LYSX_MYCBO  ali  38  679..........ERRLPEQVRVRFDKLEKLRSSGIAFPVGRPPSHTVAQALA----------ADHQASVSVSGRIMRIRNYGGVLFAQLRDWSGEMQVLLDNSRLDQGCAADFNAATDLGDLVEMTGHMGASKTGTPSLIVSGWRLIGKCLRPLPNKWKGLLDPEARVRTRYLDLAVNAESRALITARSSVLRAVRETLFAKGFVEVETPILQQLHGGATARPFVTHINTYSMDLFLRIAPELYLKRLCVGGVERVFELGRAFRNEGVDFSHNPEFTLLEAYQAHAGYLEWIDGCRELIQNAAQAANGAPITRHHLEPVDISGIWPVRTVHDAISEALGERI-DADTGLTTLRKLCDAAGVPYRTQWDAGAVVLELYEHLVECRTEQPTFYIDFPTSVSPLTRPHRSKRGVAERWDLVAWGIELGTAYSELTDPVEQRRRLQEQSLLAAGGDPEAMELDEDFLQAMEYAMPPTGGLGMGIDRVVMLITG-RSIRETLPFPLAKP.. 1171
268 0.000e+00UniRef50_A0A061HDR9 Lysine--tRNA ligase n=4 Tax=Dikarya TaxID=451864 RepID=A0A061HDR9_BLUGR  ali  42  5................................................................................KLVFYDVRSEGVKVQVMCQLQEAKEPSFTEQHEHLRRGDIIGIVGFPARTEEGELSIFATEITLLTPCLHQLPDEYYGFKDQEQRHRKRYLDLIMNDPTRKVFITRSKIISYIRRYLDKMDFIEVETPMMNSIAGGATAKPFKTHHNDLNMDMFMRVAPELYLKMLVVGGLNRVYEMGRQFRNEGIDLTHNPEFTTCEFYMAYADVDDIMVITEDLVSELVLHITGGYTTKFHEFEVNWAAPWRRIEMIPALEEATGEDQLHTAETNEFLKQILLKTKVECSPPLTNARMLDKLVGEFIEEKCINPTFITGHPQMMSPLAKYHRSYPGLCERFEAFVCKKEIVNAYTELNDPFDQRLRFEEQARQKEQGDDEAQLIDENFCASLEYGLPPTGGWGMGIDRLVMFLTDHYSIKEVLAFPFLK... 446
269 0.000e+00UniRef50_A0A2H0BFV6 Lysine--tRNA ligase n=2 Tax=candidate division WWE3 TaxID=422282 RepID=A0A2H0BFV6_9BACT  ali  38  69.......DDSTQPIEIIRSEKLKKIAAIRDLGNPYPAVLEFKIT---------PISTATQSTDGESAHVAGRLTSIRGHGGIKFADIADETGTIQLAFKDDILSPTQ-RELLGLMDPADFVEVSGELFTTKAGELTIKVTAFNLLSKAIRPLPDNHEGIKDKEVRYRKRYLDLMINPETRRIFSIRHKIVKGIRTFLDEKGLTEVETPVLQPLYGGANAKPFTTHINALDTDAYLRIASELYLKRLVVGGIEGVYDIAKDFRNEGIDQTHYPEFSMLETYIPYIDYHGMMDVMEEMMRYLAFDVLDMNSVTVHDTQVNLKGVWKRVVMTDLIQQKLNLDPLTK--TQKELEVFARENHLEFANTITKGELIFLIFDKLCADSLIDPTWVIDYPQEMSPLSKQHREKEGFVERFELYIGGVEIMDGWSEINDPIEQRARFEAEAYRNLGDGEQAQPIDEDFLEAMEHGLPPFAGIGTGIERLTMFFTNNWSIQEVILFPFKKPL. 553
270 0.000e+00UniRef50_A0A2E3WL56 Lysine--tRNA ligase n=4 Tax=Bacteria TaxID=2 RepID=A0A2E3WL56_9BACT  ali  46  5..............NEYIEKRKEXIRLLRXLGXPFSNQXXRTNXVXDILVKYKXIXPESFQPXNINYRISGRVIAIRXFGKSAFXKIVDXMERIQIFISNNSAGKXKMDFFKKFVDVGDFIGIXGHCFFTKTQEXSIEAKDXEILTKSINTLPEKWHGXTNVETRXRQRYVDLISNDEVKQIFLQRSQIVNXIRNFXVNKGFLEVETPXLHTVAGGAAAKPFKTYHNTLDMDLILRIAPELHLXRLVVGGMEKVFEIGRNFRNEGISTQHNPEXTMIELYEAYSNYEXMMXMIEELVXSCVXLYSNDRKIVYQEKEIDFXGPWXRVHMIXWLSEKLGYSVXXNSDXILKXADKMKINHFDLP-----GKAITEIFEEKXLKGVLXPVFVYGFPIDVSPXARRNNDXPMIAXRFELFVNEKEIANAFSELNDPEDQFDRXNKQLELKSKGDDEASDMDEDYINAXRFGMPPTAGAGLGIXXLVMLLTDSPSIREVILFPHMRNE. 489
271 0.000e+00UniRef50_A0A1F6RXH6 Lysine--tRNA ligase n=1 Tax=Candidatus Moranbacteria bacterium RBG_13_45_13 TaxID=1801635 RepID=A0A1F6RXH6_9BACT  ali  39  2.............LDEIKEIKLKKLEILRQAGDPYPEKSERSMANQEALAGFDQLQ-------GKEVVLAGRVRSLRPMGGSTFSHIEDESGKIQIFLNVDKLGPEKYKLFTESVEIGDFVELGGKLFKTKTGETTLEVLSWKMLAKSLSPVPTEYFGLKDTEELLRRRYLDLMMNPETRVIFRKKNIFWQTIRNFLVAEGFLEVQTPVFEHVPSGAEAEPFVTHYNALDQDFFLRISLELPLKRLLVGGYEKVFEIGRVFRNEGIDREHLQEYDHMEFYAAYWDTEKGMKFSEDLFRKIVFEVTGGYETKHEGHKINWKKDFRLVDYFTEFKKETGIDLNEDVDVAD-LIKKAEELGIKYEKKYGKGRMIDTIYKKTVGKKLIQPCILFGLPVEVSPFAKRDPQNPKKTLRFQIIAGGIELYNAFAELNDPIDQKNRFLEQMKLRAAGDREALMIDEDFVEALEYGMPPAFGVGMS-ERFFAFIMN-KSVRETVIFPPMKEKQ 483
272 0.000e+00UniRef50_A0A1F5Z233 Lysine--tRNA ligase n=1 Tax=Candidatus Gottesmanbacteria bacterium RIFCSPHIGHO2_01_FULL_42_12 TaxID=1798377 RepID=A0A1F5Z233_9BAC  ali  40  2..........AQAIDEIIRLRIEKLEKLKNLGIPYPSKFQPKISCASALTQ-----------LGAKVSVTGRLMSVREHGNMIFANLKDESGKIQIWFQKETLKDK--FSLLKLLDVGDFIGVTGAVVKTKTEEITVNVEAFEVLSKSLRPIPDLWFGIKDEETRYRQRYLDLLLDENLRSLFYKKALFWNSMREYLAKNGFLEVETPVLETTAGGADAQPFITHHNALDIDLYLRISGELWQKRLMVAGFEKTFEIGRQFRNEGISREHLQDYTQMEFYWAYANFDDSMRLVEEMYKYVIEKTFGTLKFQVGDYSLDFSGTWERIDYVETIKKLAGVDITKMSD----------------------GREVDGI-WKGVRKQIAGPVFLTGHPVLVSPLAKRMEKNPDYVERYQVIIAGSELGNGYSELNDPIDQSERFKIQQEARDKGDEEAQMNDTEFVKALEYGMPPVSGFGVS-ERLFSFLCNLP-IRETVLFPLLRPEE 460
273 0.000e+00UniRef50_A0A1V5R544 Lysine--tRNA ligase n=1 Tax=Parcubacteria group bacterium ADurb.Bin326 TaxID=1852943 RepID=A0A1V5R544_9BACT  ali  41  5..................................YRDSYQRTHLIGALLEKFDELLNERA-----VVSTAGRVMSRRKMGKVLFFNLADGEGNIQVFADISGLGQEEFSRLSNDVRIGDIVGVSGIVFKTRTEEKTIKCQSFSLLTSCLRSLPEKFHGLSDVETRYRQRYLDLIVNAETRNVFRKRSHIIKLMRKHLESNGFMEVETPIFQKNPCGASANPFVTHHDAKDIDLYLRISPETFLKQLIVGGMDRIYEIGKNFRNEGVDASHLQEFTMLEFYASYWNYCDNIEFVKWLIQQVLLGVMGSLELEYQGMSFDFRQ-WQTVEYRDLVLNDCGIDILNFETVDGLLAEITKQGVGEIDPGISLGSLIDKLYKRVSRPRLIQPTVLLHHPAVLIPLARPNDQDPRVIDAFQILVNGWEIAKGYSELGDPILQRRLLEDQLALRHQGDSEAMFVDTDFLTSLEYGMPPVSGVGIGIDRLTAIATNQRNLADVVLFPLM.... 466
274 0.000e+00UniRef50_A0A2I1PCQ8 Lysine--tRNA ligase n=1 Tax=Kytococcus schroeteri TaxID=138300 RepID=A0A2I1PCQ8_9MICO  ali  36  614......ASARRARLPEQTRVRIAAVEAAREAGEPWPVAERPTHTTAQALA----------AGEGERVSVAGRVLAVRDLGGVRFVRLRDGQGDLQVVLERQHLSAQDHRDFMVLVDVGDLVAFEGVRGASRSGEPSLLAHSWRMEAKCLHPLSPVRTGLVDPEAKVRQRHVDLAVSQEARDTLRARSAVVRALREGLQDRGYLEVETPVLQTVHGGANARPFATRINAYSMDLFLRIAPELYLKRLCVGGVDRVFEMGRAFRNEGVDATHNPEFTLLEAYAAHEDYRSMMDTTRELVQAAAVAVHGRCEVPGDGTMVDLSGEWPVVTLHDAVSEALGGQPVGPQSTAAEMHQAARRAGVEVRPDLDAGEVALELYEELVEGSTVRPTFYCDFPSSVSPLTRGHRSTPGVAERWDLVAFGMELGTAYSELTDPLEQRARLTAQSVAAAAGDPEAMSLDEDFLQALEYGMPPTGGLGLGVDRVVMLVTG-RTVRETLAFPLVRP.. 1103
275 0.000e+00UniRef50_A8BEL5 Lysine--tRNA ligase n=6 Tax=Giardia intestinalis TaxID=5741 RepID=A8BEL5_GIAIC  ali  38  47..EPVEGAPEEIDPTKYFENRKNELLALQKSGNPWPHKFVVEMTLAEFRRRYEGKCS-LGEMAEEQVSVAGRIHSIRTSGKLVFYTIHGDNDRLQIFAHVPKEDEFDWDTIVSTLHRGDIVGVKGYPTTTKSGELSIIPVQLVLLSPCLHMIPNSPSALTDINARFRQRYLDFIIN-NTGQKIVQRSGIINFIRRFMDQRNYLEVETPMLQTVHGGAAAQPFVCKSNDLGHDVYLRIAPELFLKRLVVGGLNRVFEINKNFRNESSDQTHSPEFTMMEAYSAYDDLEDMCDLIEGLVSRLVRWYNITYNHVRLPDEIDFSRPWRRVPIIETLEQLLSIKFPRPLDGEEFLVSLLERLDLECKPPLTTARMLDKLVERYLETLTPNPIFLMYHPVLMSPLAKPHRSIPELAERFEVFISCFEVSNAYTELNNPIIQRENFQAQIRDKAAGDMDAMEYDEDFCKCLDYGLPPTGGIGIGIDRLVMLLTNSSTIREVIAFPLM.... 571
276 0.000e+00UniRef50_A0A2V5NF39 Lysine--tRNA ligase n=2 Tax=Bacteria TaxID=2 RepID=A0A2V5NF39_9BACT  ali  41  5............PLTEIRKTRLQKAASLRSLGIPYPSQSRRTHNAKTILDDYEILQ-------GKEVTVAGRLMSWRKQGALAFGHVHDQTGRIQLFFRRQDAGKLGYSE-TNLLDLGDIIEATGKVTKTERGEISVLVESLRLLTKAIRPLPDQWSGLKDREQILRKRYLDTILDRVSFDRFATIGKMVTAIRAFLNDRGFLEFQTPVIQPQYGGGTAKPFKTHVNALGCEMYLAISHELYLKRLIVAGYEKV