current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 1v7o_A mol:protein length:165 alanyl-tRNA synthetase, from PDB1018

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .
# E-value Template Links and tools%idFirst MYSIEVRTHSALHVVKGAVVKVLGSEAKWTYSTYVKGNKGVLIVKFDRKPSDEEIREIERLANEKVKENAPIKIYELPREEAEKMFGEDMYDLFPVPEDVRILKVVVIEDWNVNACNKEHTKTTGEIGPIKIRKVRFRKSKGLLEIHFELLELENPSLELast
1 4.000e-89UniRef50_A0A2E0YAM7 Alanine--tRNA ligase n=3 Tax=Proteobacteria TaxID=1224 RepID=A0A2E0YAM7_9GAMM  ali  22  95.RRRIMLNHSATHLMHAALRNVLGSHVQQKGS-LVAPDRLRFDFSHPQPMTAEEIARVEAEVNEQIQANTPVGIEHLSYDDAMARGAMALFG----EKYGDEVRVLSMGDFSVELCGGTHVSRTGDIGVFRIVS-EGGVAAGVRRIEAVTGPGALAWID 247
2 2.000e-88UniRef50_A0A2V8BKJ9 Alanine--tRNA ligase (Fragment) n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8BKJ9_9BACT  ali  22  410VRNATRRNHTATHLLHAALREVLGGHVKQAGS-LVAPDRLRFDFAHFQPVTRDELERIERIVNEQITRNTPVTTEQRPTHEAIAEGAMALFG----EKYGDTVRVVSVPGYSMELCGGTHVSATGDIGPFVIVG-ESGVAAGTRRIEALTGAGAVAWMQ 562
3 2.000e-88UniRef50_D9TPU4 Alanine--tRNA ligase n=18 Tax=Clostridia TaxID=186801 RepID=D9TPU4_THETC  ali  23  557.RLSTARNHTATHLLHSALRKFIGDHVHQAGS-LVTPERLRFDFTHYQALTDEEIKTIENEVNEKIYENIDVSVDIMSHDEALKKGAMALFQ----EKYGDVVRVVNVSDYSKELCGGTHVDNTGNIGVFKIIS-ESGVAAGIRRIEAVTGINAVKYM. 707
4 1.000e-87UniRef50_H0DEG2 Alanine--tRNA ligase-like protein (Fragment) n=1 Tax=Staphylococcus pettenkoferi VCU012 TaxID=904314 RepID=H0DEG2_9STAP  ali  25  107.RRAIQKNHSATHLLHAALKEVLGDHVNQAGS-LVAPDRMRFDFSHFGPMKEEEIEQVERRVNEEIWNSIEVSIQEMPIEEAKEMGAMALFG----EKYGDIVRVVNMAPFSIELCGGIHVSNTAEIGLFKIVS-ESGTGAGVRRIEALTGQAAFLYLE 258
5 8.000e-87UniRef50_A0A2W4KEP9 Alanine--tRNA ligase (Fragment) n=1 Tax=Firmicutes bacterium TaxID=1879010 RepID=A0A2W4KEP9_9FIRM  ali  24  27.RKDIARNHSATHLLHRALKEVLGEHVNQSGS-LVAPDHLRFDFNHFTALTADEIRRIEDEVNSAILRNMPVSVKETTVEEAQKEGAIALFG----EKYGEKVRMVSMGDYSKELCGGTHVRSTGEIGLFKIVS-EGSVGAGIRRIEAVTGWNLLNY.. 176
6 1.000e-86UniRef50_A0A2J0N093 Alanine--tRNA ligase (Fragment) n=1 Tax=Candidatus Omnitrophica bacterium CG_4_9_14_0_2_um_filter_42_8 TaxID=1974737 RepID=A0A2J0  ali  25  191.RLDIRKNHTATHLLHNALRKVLGMHVKQAGSM-VAPDRLRFDFSHFKAVTKEELSRIEEIVNENIRKDSGVRIDELGIEEAKKKDAIALFG----EKYGDVVRMVSVGDYSKELCGGTHVKRTGEIGIFKIIS-ESSIASGMRRIEAITGRTAYEKIK 342
7 2.000e-86UniRef50_K2C6T7 Alanyl-tRNA synthetase n=9 Tax=root TaxID=1 RepID=K2C6T7_9ZZZZ  ali  22  93.RQSTRLNHSATHLLHEALRRVLGEHVMQKGS-LVEPKRLRFDFSHPQALTQDQIYSIERLVNQQIRANSELHTAEMDLDDAKKKGAMALF----SEKYADRVRVVNMGDFSTEICGGTHVARTGDIGLFKII-TETACAAGVRRIEAVTGAEALSWVE 244
8 2.000e-86UniRef50_A0A2V8FV41 Alanine--tRNA ligase (Fragment) n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8FV41_9BACT  ali  23  240.RNATRRNHTATHLLHAALRQVLGTHVKQAGS-LVAPDRLRFDFVHFQPLTRDELDRIERLVNEQIRRNAPVQTEVRTTQEAIAAGAMALFG----EKYGDKVRVVSVPDFSLELCGGTHVAATGDIGFLAIV-AEGGVAAGVRRIEAVTGAGAVEW.. 389
9 3.000e-86UniRef50_A0A1F4XGX9 Alanine--tRNA ligase (Fragment) n=1 Tax=candidate division Zixibacteria bacterium RBG_16_43_9 TaxID=1802784 RepID=A0A1F4XGX9_9BAC  ali  21  209.RKGIMRNHTATHLLHKALRETLGEHVHQSGS-LVSPNGFRFDFTHFKALTEDELEKIEYKVNQKIWENLEVNTFNTTLDEAKKLGAMALFG----EKYEDTVRVVKVDEYSMELCGGTHVKATGEIGLFRIIS-EQSIAAGMRRIEAVTGKSAYELVK 360
10 4.000e-86UniRef50_E3PRV7 Alanine--tRNA ligase n=16 Tax=Firmicutes TaxID=1239 RepID=E3PRV7_ACESD  ali  21  560LRKSTQRNHTCTHLLHKALRQVLGAHIHQAGS-LVSDTRLRFDFTHFEPITSEQLSQIENMVNEAIFKAYPVKVEVMNIEEAKKSGAMALFD----EKYEDNVRVVSVGEFSTELCGGTHVSNSSDIGMFKILS-ESGIASGVRRIEAITGSNVYQYL. 711
11 5.000e-86UniRef50_A0A1M5QPL3 Alanine--tRNA ligase n=2 Tax=Thermotogae TaxID=200918 RepID=A0A1M5QPL3_9BACT  ali  26  546.RKATMRNHTATHLLHAALRKVLGNHVKQSGS-LVAPEKLRFDFTHFAALTPEEIKEVEDIVNKEILKAQNVVIEEKTFEEAIKEGAIALFE----EKYGDYVRVVKVGLFSEELCGGTHVANTGEIGLFKIIS-EGSVSAGVRRIEAITGLKSLDYL. 696
12 7.000e-86UniRef50_A0A1I5V2J3 Alanine--tRNA ligase n=1 Tax=Parafilimonas terrae TaxID=1465490 RepID=A0A1I5V2J3_9BACT  ali  28  586.RKQTAAHHSATHLLHAALRQVLGTHVQQKGS-LVNAEHLRFDFSHFAKMTDEEIAKAEAIVNEKIRENIPVIIKEMPKDEALKLGAMALFG----EKYGDIVRVVIIPNYSVELCGGTHVGATGELGFFKI-KLETSVAAGVRRIEAVAGKPAENLIQ 738
13 9.000e-86UniRef50_A0A0B0HWU2 Alanine--tRNA ligase n=1 Tax=Paenibacillus sp. P1XP2 TaxID=1472719 RepID=A0A0B0HWU2_9BACL  ali  24  165.RRDIVKNHTATHLLHKALKEVLGEHVNQAGS-LVEPQRLRFDFSHFGSISAEELADIERRVNEQIWNAVNVNIEYKPIDEAKAMGAMALFG----EKYGDIVRVVQVGDYSLELCGGCHVGNTSEIGIFKLVS-ESGIGSGVRRIEAVTGRAAYQ... 313
14 1.000e-85UniRef50_A0A1W9RZF1 Uncharacterized protein (Fragment) n=1 Tax=candidate division Zixibacteria bacterium 4484_93 TaxID=1970780 RepID=A0A1W9RZF1_9BACT  ali  25  29.RIATARNHTATHLLQAALRELLGEHCHQSGS-LVEPERLRFDFSHSKPLTDEELLEVERLVNDSILSDIPVDIYECPYEEAMEKGAMALF----SEKYDEIVRVVEVPGVSRELCGGTHINRTGEIGMFIIIS-ETGIASGIRRIEAITGTSALEYIQ 180
15 1.000e-85UniRef50_A0A2C6MG13 Uncharacterized protein n=1 Tax=Desulfotomaculum profundi TaxID=1383067 RepID=A0A2C6MG13_9FIRM  ali  26  100.RQDTARNHSATHLLHKALKEVLGDHVNQAGS-LVEPDRLRFDFTHYAAVTPEELRRIEELVNGAVMSNLPIDIFETSLSKAKEMGAAALFG----EKYGKEVRVVKMGDYSLELCGGTHLTSTAEVGLFKIVN-ETSIGAGLRRIEAVTGPGVLKVLE 251
16 1.000e-85UniRef50_A0A2V7HEF2 Alanine--tRNA ligase (Fragment) n=2 Tax=Gemmatimonadetes bacterium TaxID=2026742 RepID=A0A2V7HEF2_9BACT  ali  21  64.RRDTERNHTATHLLHAALRKVLGEHVHQQGS-LVAPDRLRFDFSHHGPLTPQQLNEVETLVNRGILDGVQLTIEQKPQAEAKAAGAMSLF----TEKYGDIVRVVSIPGISMELCGGTHVRNTSEIGVFKIVS-ETGIAAGVRRIEAVTGRAALDYY. 214
17 1.000e-85UniRef50_Q24UT2 Alanine--tRNA ligase n=40 Tax=Firmicutes TaxID=1239 RepID=SYA_DESHY  ali  23  555LRLATARHHSATHLLQAALRAVLGEHVQQAGS-LVTPDRLRFDFTHFSALTSAELQRVEDLLNEAVLANMPVAAEEMSLDAAKASGATALFG----EKYGDTVRVVSMGDYSLELCGGTHIRATGDIGLVKIIS-EGGIGAGLRRIEAVAGAEALKYM. 706
18 2.000e-85UniRef50_A0A2X4TYG6 Alanine--tRNA ligase n=1 Tax=Serratia plymuthica TaxID=82996 RepID=A0A2X4TYG6_SERPL  ali  20  47.RNRIRLNHSATHLLHAALRQTLGEHVAQKGS-LVNDKYLRFDFSHFEAMKPEQIRVVEDLVNQQVRRNLPVQTEVMALDDAKEKGAMALFG----EKYDDSVRVLTMGDFSTELCGGTHASRTGDIGLFRIL-TESGTAAGIRRIEAVTGEGAI.... 194
19 3.000e-85UniRef50_A0A090SIP8 Alanyl-tRNA synthetase n=1 Tax=Vibrio maritimus TaxID=990268 RepID=A0A090SIP8_9VIBR  ali  22  10.RAAISLNHSATHLLHAALRQVLGEHVTQKGS-LVKPDNLRFDFSHLEAMTKAEIKQVERLVNAQIRTNHVIETNVMDIESAKAKGAMALFG----EKYDDEVRVLSMGEFSTELCGGIHASNTGDIGLFKITS-EGGIAAGIRRIEAVTGEAALDAIE 161
20 5.000e-85UniRef50_Q9I553 Alanine--tRNA ligase n=1053 Tax=root TaxID=1 RepID=SYA_PSEAE  ali  19  554VRQATALNHSATHLLHAALRQVLGDHVQQKGS-LVDSQRLRFDFSHFEAIKAEQLKALEDIVNAEIRRNTEVETEETDIDTAKAKGAMALFG----EKYGDQVRVLSMGDFSVELCGGTHVSRTGDIGLFKITS-EGGVAAGVRRIEAVTGAAALAYL. 706
21 5.000e-85UniRef50_B5YJG4 Alanine--tRNA ligase n=13 Tax=Bacteria TaxID=2 RepID=B5YJG4_THEYD  ali  28  559.RKAIKRNHTATHLLHAALRTVLGEHVKQAGS-LVAPDRLRFDFTHFEAVNDEELREIERIVNEKILENLPVKIEIKSLDEALNEGVTALFE----DKYEDTVRVVKIVGFSKELCGGTHCDSTGEIGSFYIVS-EGSVASGIRRIEAVTGIEAFKY.. 708
22 5.000e-85UniRef50_A0A1F9C2U0 Uncharacterized protein n=1 Tax=Deltaproteobacteria bacterium RBG_16_50_11 TaxID=1797841 RepID=A0A1F9C2U0_9DELT  ali  21  21.RRAITLNHTGTHLLQAVLREILGTHVHQAGS-LVAPDRLRFDFTHFAPIQREDMERIEALVNQKIRENLKVETKVLPVEEALQMGAMALFG----EKYGDRVRVIRVSDFSIELCGGTHTSRTGDIGFFKMIN-ETGVAAGVRRIEALTGEGAYRFIK 172
23 7.000e-85UniRef50_K1YHG1 Uncharacterized protein n=1 Tax=groundwater metagenome TaxID=717931 RepID=K1YHG1_9ZZZZ  ali  28  356.RFATAAHHSATHLLHAALRKVLGDHVKQAGS-LVSPDRLRFDFTHFSPLSPEEIETIELLVNERIWQNAPVKTRVLQKEEALKEGAMALFG----EKYEENVRVVAMADFSKELCGGTHVAATGSIGTFKIL-TENGIASGVRRIEALAGPAAFADIQ 507
24 1.000e-84UniRef50_A0A259RL80 Alanine--tRNA ligase (Fragment) n=5 Tax=Proteobacteria TaxID=1224 RepID=A0A259RL80_9GAMM  ali  25  127.RHSIRLNHSATHLLHAALRQVLGTHVHQKGSR-VGAESLRFDFSQPEPITDAQLREIERIVNAQIRENHPVETREMPVDEARAAGAMALFG----EKYGDVVRVVTMGPFSMELCGGTHARRGGDIGLIKIVS-ESGVASGVRRIEAVTGASALAVLE 278
25 1.000e-84UniRef50_W7BXI8 Alanine--tRNA ligase n=2 Tax=Bacillales TaxID=1385 RepID=W7BXI8_9LIST  ali  24  189.RYGVVKNHTATHLLHRALKDVLGDHVNQAGS-LVEPNRLRFDFSHFGQITDAELQKMEHIVNRKIWEQLAVDIKEMPIKEAKELGAMALFG----EKYGDVVRVVRIGDYSIELCGGLHVGNTSEIGLFNIIS-ESGIGAGTRRIEAVTGESAYRFL. 339
26 2.000e-84UniRef50_A0A2N5YWE4 Alanine--tRNA ligase (Fragment) n=1 Tax=Marinilabiliales bacterium TaxID=2053303 RepID=A0A2N5YWE4_9BACT  ali  26  70.RKKTERNHTATHLLHEALRSILGNHVEQKGS-LVNPDHLRFDFSHFHKLSDEEIENVENAVNDKIRANLNVEYRNLPMSEAEKMGAMALFG----EKYGDTVRVIQFGD-SIELCGGTHTASTGEIGLFKIVS-ESAVAAGIRRIEAITGDTAKNY.. 219
27 3.000e-84UniRef50_A0A136LFC9 Alanine--tRNA ligase n=3 Tax=Bacteria TaxID=2 RepID=A0A136LFC9_9BACT  ali  22  636.RRRITRNHTATHLLHAALRQVLGKHVTQAGS-LVAPDHLRFDFTHSKGMTPDELAEVERLVNERVLEARPVQVHDVPIAEAKKRGAMALFG----EKYGDTVRMIEVPGFSLELCGGCHVRNTAEIGLFKVL-HESSAASGVRRIEAVTGEGAYEWV. 787
28 3.000e-84UniRef50_G9YIF4 DHHA1 domain protein n=1 Tax=Anaeroglobus geminatus F0357 TaxID=861450 RepID=G9YIF4_9FIRM  ali  22  48..LAIARNHTATHLLQAALRGVLGNHVNQAGS-LVEPERLRFDFTHFSPMTADELRAVEEKVNEQILKNVAVEIEEMPLDEARKKGAMALFG----EKYGDIVRVVSVPSFSCELCGGSHVPNTAVIGSFRILS-ESGTGTGIRRIEAVTGKAAHE... 195
29 3.000e-84UniRef50_A0A1F5BAI3 Alanine--tRNA ligase n=4 Tax=root TaxID=1 RepID=A0A1F5BAI3_9BACT  ali  23  560.RKAISNNHTATHLLHAALRQVLGDHVKQAGS-LVSPSRLRFDFTHFAALTREEVRRVEEIVNAKVRADIPLETRVTSLEEGIREGAMAIFE----EKYGESVRVVGIGDFSKELCGGVHVHATGEIGLFKIVS-ETSVAAGMRRIEAVTGDGAYRYVQ 711
30 3.000e-84UniRef50_A0A0T8FTV0 Alanine--tRNA ligase n=1 Tax=Streptococcus pneumoniae TaxID=1313 RepID=A0A0T8FTV0_STREE  ali  23  85.RSSVVKNHTATHLLHQALKDVLGTHVNQAGS-LVTSERLRFDFSHFGQVQADELEKIERMVNEKIWESIDVEISQKAIEEAKEMGAMALFG----EKYGDVVRVVQVGDYSLELCGGCHVDNTASIGIFKIV-AESGIGAGTRRIEAVTGKSAYELM. 235
31 3.000e-84UniRef50_A0A1W9P1Q5 Alanine--tRNA ligase n=1 Tax=Candidatus Cloacimonas sp. 4484_209 TaxID=1968525 RepID=A0A1W9P1Q5_9BACT  ali  22  535.RMDIARNHTATHLLQAALREVLGKHIHQEGS-LVAPDRLRFDFTHFSAVKGAELERVEEIVNSKILLNLSVEASEMRFDEAKKLGAIALF----NEKYGEIVRVLKIGNYSIELCGGTHVNRTGEIGLFKVIS-ESSVSSGVRRIEAVTGKGLLNYL. 685
32 3.000e-84UniRef50_A0A2N7QFC3 Uncharacterized protein n=1 Tax=Thermodesulfobacterium geofontis TaxID=1295609 RepID=A0A2N7QFC3_9BACT  ali  26  66.RFHIERHHTATHLLHAALRKILGSHVKQAGS-LVEEERLRFDFTHFQALTPRELKMVEELINKWVLENHPVETLWVKRESAEKMGAIAIFE----EKYGEIVRVVKINEVSMELCGGTHVKRTGDIGLVKLIS-ESSVASGIRRIEAVAGLKAYEWV. 216
33 3.000e-84UniRef50_A0A1Q6DHR8 Alanine--tRNA ligase n=7 Tax=Bacteria TaxID=2 RepID=A0A1Q6DHR8_9DELT  ali  23  562.RQAIACNHTATHLLHAALKQVLGDHVKQSGS-LVDEERLRFDFTHFSPISPDELKKIENIVNQAIRANSDLSVENLSREEALQSGATALFG----EKYGDTVRVVSIDTFSKELCGGTHVGATGEIGLLKII-AESGIAAGIRRIEAVTGAKALQIFQ 713
34 3.000e-84UniRef50_A0A1G1JPC5 Alanine--tRNA ligase n=1 Tax=Omnitrophica bacterium RIFCSPHIGHO2_02_FULL_51_18 TaxID=1801823 RepID=A0A1G1JPC5_9BACT  ali  24  539.REDIMKNHTATHLLHGALRKVLGGHVKQSGS-LVAPDRLRFDFTHFGAVGADKILEIENLVNVQIQKNTKLDKKLMSKDEAMKEGAIAFFG----EKYGEDVRVVCVGDFSKELCGGTHLNSTGEIGFFKITS-ESSIQAGVRRIEAVTGRWAEKLL. 689
35 4.000e-84UniRef50_A0A099CUK3 Alanine--tRNA ligase n=23 Tax=Proteobacteria TaxID=1224 RepID=A0A099CUK3_9GAMM  ali  23  671.RQAIVLNHSATHLLHAALRKVLGDHVTQKGS-LVAPDRLRFDFSHDQPVSAEQLHAIERMVNAQIRRNDAADIRHMGYQEAIDFGAMALFG----EKYGDEVRVLKMGDFSTELCGGTHVSRTGDIGLFKIVS-ESGVAAGVRRIEALTGAGAETYV. 821
36 4.000e-84UniRef50_A0A2A6AWF8 Alanine--tRNA ligase n=17 Tax=root TaxID=1 RepID=A0A2A6AWF8_9ALTE  ali  19  547.REAVKKNHSATHLLHAALREILGEHVSQKGS-LVEAQRMRFDFSHFEAVTDAQLTIIEQRVNEEIRANHSLTTELMDLDAAKASGAMALFG----EKYDEKVRVVTMGPFSVELCGGTHVSRTGDIGLFKIT-TESGIASGVRRIEAITGAAAIDYIQ 698
37 6.000e-84UniRef50_A0A101GG36 Alanine--tRNA ligase (Fragment) n=1 Tax=Bacteroidetes bacterium 38_7 TaxID=1635292 RepID=A0A101GG36_9BACT  ali  28  221.RRLTANNHSATHLLHAALRKVLGSHVEQKGS-LVDENRLRFDFSHYTRLTSDEILKIESMVNEKIWENLKLEWRNLPMEEAKKMGAMALFG----EKYGERVRVVAFPEYSVELCGGTHVQATGQIGLIKIVS-ETGIAAGVRRIEAITGAAAVSYY. 373
38 6.000e-84UniRef50_A0A2G6Q327 Alanine--tRNA ligase n=2 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2G6Q327_9BACT  ali  25  559LRNDIRRNHTATHLMHQALKDVLGLHVRQAGS-LVDAEKLRFDFNHFSPVMPEEQAEIERRVNEQIRKNTPLVTQLMDLEEARKEGAVALFG----EKYSEQVRVVSIGDYSMELCGGTHVSATGEIGLFKIVS-ERALASGIRRMVALTGKQAFDYIQ 711
39 9.000e-84UniRef50_A0A2N1P5L0 Alanine--tRNA ligase n=1 Tax=candidate division Zixibacteria bacterium HGW-Zixibacteria-1 TaxID=2013855 RepID=A0A2N1P5L0_9BACT :_  ali  23  564.RWDIMRNHTATHLLHAALRKVLGDHVKQSGS-YVGPDKLRFDFSHFNPMTPEEIKRVEEIVNSKILEGFDVGTVEDDLEKAKKSGAMAIFG----EKYGSKVRVVSVADFSKELCGGTHVQNVSQIGPFMIT-LETAVASGIRRIEAVTGREAVAYM. 714
40 1.000e-83UniRef50_K8C1Y4 Alanine--tRNA ligase n=8 Tax=Proteobacteria TaxID=1224 RepID=K8C1Y4_9ENTR  ali  22  109.RDRIRLNHSATHLMHAALRQVLGTHVAQKGS-LVNDKGLRFDFSHFEAMKPEEIRKVEDLVNAQIRRNLPIETNVMDLEAAKAKGAMALFG----EKYEDRVRVLSMGDFSTELCGGIHASRTGDIGLFRIVS-ESGTAAGVRRIEAVTGEGALSLV. 259
41 1.000e-83UniRef50_A0A2M7JQ74 Alanine--tRNA ligase n=2 Tax=unclassified Deltaproteobacteria (miscellaneous) TaxID=122706 RepID=A0A2M7JQ74_9DELT  ali  20  333.RKAIALNHTGTHLLQAVLREVLGDHVHQAGSF-VSPERLRFDFTHFASMEKKELERVEAIVNQKIRENLKVETKIMDVEEALQTGAMALFG----EKYGEKVRVVMVSDFSIELCGGTHTSRTGDIGFFKIVS-ESGVAAGVRRIEALTGEEAYRFIK 484
42 1.000e-83UniRef50_A0A1V9FJM4 Alanine--tRNA ligase n=8 Tax=Bacteroidetes TaxID=976 RepID=A0A1V9FJM4_9BACT  ali  27  593.RARTAVHHSATHLLHAALRKVLGTHVAQKGS-LVNDEYLRFDFSHFAKMTADEIAKVEAIVNEKIRANIPVVIKEMPKEEALKLGAMALFG----EKYGDVVRVVVIDPYSVELCGGTHVGATGELGMFK-LKHESAVAAGVRRIEAICGIAAEQYI. 744
43 2.000e-83UniRef50_A0A2H6EW66 Alanine--tRNA ligase n=2 Tax=Bacteria TaxID=2 RepID=A0A2H6EW66_9BACT  ali  24  551.RKSIARNHTATHLLHKALRAVLGEHVHQAGS-LVAPDRLRFDLTHFERITPEQLDEIERRVNEAVRTNYRVEVLTLPYDEAKKLGATALFG----EKYGDVVRIVKIDDYSMEFCGGTHLNYTGEIGYFRIVS-ESGVAAGVRRLEAVTGAAADELL. 701
44 2.000e-83UniRef50_A0A068NQ92 Alanine--tRNA ligase n=1 Tax=Fimbriimonas ginsengisoli Gsoil 348 TaxID=661478 RepID=A0A068NQ92_9BACT  ali  25  586.RDRIRRNHTATHLLQAALRQTLGTHVAQAGS-YVGPDNLRFDFTHSKAMTPEEIERVERSVNEQALANTEVTTYVLPIDEARAKGAMALFG----EKYGDRVRMVEIGDFSRELCGGIHVRTTGEIGLFKIVS-ESSAASGVRRIEAITGEGAYEWV. 737
45 2.000e-83UniRef50_Q8ZBT8 Alanine--tRNA ligase n=2875 Tax=root TaxID=1 RepID=SYA_YERPE  ali  21  557.RNRIRLNHSATHLLHAALRNVLGEHVAQKGS-LVNDKYLRFDFSHFEAMKPEQIRLVEDLVNEQIRRNMPVQTEVMELDAAKEKGAMALFG----EKYDDQVRVLTMGDFSTELCGGTHASRTGDIGLFRIL-TESGTAAGIRRIEAVTGEGAIALL. 707
46 2.000e-83UniRef50_A0A0T7T4A9 Alanyl-tRNA synthetase n=2 Tax=root TaxID=1 RepID=A0A0T7T4A9_STREE  ali  23  14.RHRVMKNHTATHLLHAALHNILGNHATQAGS-LNEVEFLRFDFTHFQAVTAEELRAIEQQVNEKIWEALEVKTVETDIDTAKEMGAMALFG----EKYGKEVRVVTIGDYSIELCGGTHVGNTSEIGLFKIVKEE-GIGSGTRRILAVTGKEAFEAY. 164
47 2.000e-83UniRef50_UPI000BB63539 alanine--tRNA ligase n=1 Tax=Neisseria meningitidis TaxID=487 RepID=UPI000BB63539  ali  22  629IRNANMRNHSATHLMHKALRDVLGEHVEQKGS-LVTAESTRFDISHPQAVTAEEIAEVERRVNEAILANVAVNAAIMSMEDAQKTGAMMLFG----EKYGDEVRVLQMGGFSTELCGGTHVSRTGDIGLFKIIS-EGGIAAGVRRIEAITGLNALKWAQ 781
48 2.000e-83UniRef50_Q97IG3 Alanine--tRNA ligase n=1038 Tax=root TaxID=1 RepID=SYA_CLOAB  ali  23  561.RKDICKNHTATHMLQAALKKVVGSHINQSGS-YVDNERLRFDFTHFTALTDEEILKVEAMVNDEIMAAYDVKTDIMSVDEAKKTGAMALFD----EKYGNRVRVVSVGDFSRELCGGTHVNNSGEIGLFKIIS-ESGVAAGIRRIEAITGKEAVRYTE 712
49 2.000e-83UniRef50_A0A1V5R620 Alanine--tRNA ligase n=2 Tax=Acidobacteria TaxID=57723 RepID=A0A1V5R620_9BACT  ali  23  571.RARIRAHHTATHLLHAALREVLGTHVKQAGSV-VDPERLRFDFTHFAPLEPEQVKEIERLVNEQTLRTAPTKVEHMGIEDALAAGAMALFG----EKYGEEVRVVSVPGFSRELCGGTHVANTGEIGCVKIVS-EGAVAAGVRRLEAVAGMAAVERLQ 722
50 2.000e-83UniRef50_B1HUK4 Alanine--tRNA ligase n=1240 Tax=root TaxID=1 RepID=SYA_LYSSC  ali  23  589.RNLIIKNHTATHIMQRALKDVLGDHVNQAGS-YVGPDRLRFDFSHFGQVTKEELQQIERIVNEKVWDDIEVVIEEMAIDQAKAKGAMALFG----EKYGDVVRVVSIGDYSIELCGGIHVKRSSEIGFFKIVS-EGGIGAGTRRIEAVTGKVAYEVVK 740
51 2.000e-83UniRef50_E0S2J3 Alanine--tRNA ligase n=71 Tax=Firmicutes TaxID=1239 RepID=E0S2J3_BUTPB  ali  22  564.RAKTCRNHSATHLLQKALQMVLGDGVEQAGSYQ-DPDKTRFDFSYHQAMTADEIKKVEDIVNSKILEALPVVTKEMSIEDAKKTGAMALFG----EKYGETVRVVNMGDFSIELCGGTHVANTSHIGLFKILS-ESGVAAGVRRIEALTGDNARAYYK 715
52 2.000e-83UniRef50_B0VFU1 Alanine--tRNA ligase n=17 Tax=Bacteria TaxID=2 RepID=B0VFU1_CLOAI  ali  25  549.RKSIARNHTATHLLHKALREVLGEHTVQKGS-LVHSDYLRFDFAHFRALTLEEIRKVEDIVNQAVLDNRKVKTTVKNIEEAKKEGAIALFG----EKYSEKVRVVCVENFSQELCGGTHISSTGEIGLFKIIS-ESSSAAGIRRIEAITGISALKWVQ 700
53 3.000e-83UniRef50_O67323 Alanine--tRNA ligase n=5 Tax=Bacteria TaxID=2 RepID=SYA_AQUAE  ali  23  552.RWDIMRNHTATHLLHAALRNVLGEHVRQAGS-LVADKYLRFDFTHFSALTEEELKRVEELVNEKIRENLPVNVMEMAYDEALKTGAIAIFE----EKYGERVRVISCGEFSKELCGGTHVSATGDIGYFKIIS-ESSVGAGVRRIVAQTGRWSVE... 700
54 3.000e-83UniRef50_E5UIB6 Alanine--tRNA ligase n=59 Tax=Betaproteobacteria TaxID=28216 RepID=E5UIB6_NEIMU  ali  22  644IRNANMRNHSATHLMHKALRDVLGEHVEQKGS-LVTAESTRFDISHPQAVTAEEIAEVERRVNEAILANVAVNAAIMSMEDAQKTGAMMLFG----EKYGDEVRVLQMGGFSTELCGGTHVSRTGDIGLFKIIS-EGGIAAGVRRIEAITGLNALKWAQ 796
55 3.000e-83UniRef50_A5ZQA6 Alanine--tRNA ligase n=2 Tax=Firmicutes TaxID=1239 RepID=A5ZQA6_9FIRM  ali  22  363.RRDTEKNHSATHLLQKALKTVLGSHVEQKGS-LVTPDRLRFDFAHFQAMTPEEIAQTETLVNKEIQAALPVVTDVMDIEEAKKSGAMALFG----EKYDQKVRVVSMGDFSKELCGGTHVKNTSSIMLFKIVS-EAGIAAGVRRIEALTGNGVIEYYK 514
56 3.000e-83UniRef50_A0A1F4QI81 Alanine--tRNA ligase (Fragment) n=4 Tax=Bacteria TaxID=2 RepID=A0A1F4QI81_9BACT  ali  20  465.RRMMAKNHTATHLLHAAMRHTLGDHVKQAGS-LVAPDRLRFDFTHFSPLTPQEIDRIEEAVNAQIWENRGVATRVMSLDEALATGAVALFG----EKYGERVRVVSVREFSTELCGGTHVGATGEIGLFKIVSQ-GGVAAGVRRIEAVTGPGAYQHVK 616
57 3.000e-83UniRef50_W3AT12 Alanine--tRNA ligase n=18 Tax=Firmicutes TaxID=1239 RepID=W3AT12_9FIRM  ali  22  580.RMDTCRNHSATHLLQKALREVLGTHVEQAGSFQ-DAGRTRFDFSHFQAMTKEELQKVEDIVNQKIREGLSVRTEVMTLEEAKKTGAMALFG----EKYGSEVRVVRMGDFSTELCGGTHVENTLQIGQFKIVS-EAGVAAGVRRIEALTGENVRKYYE 731
58 3.000e-83UniRef50_G5QN80 Alanyl-tRNA synthetase (Fragment) n=3 Tax=Enterobacterales TaxID=91347 RepID=G5QN80_SALRU  ali  21  123.RARIRLNHSATHLMHAALRQVLGTHVAQKGS-LVSDKVLRFDFSHNEAMKPSEIRQVEDLVNAQIRRNLPIETNIMDLDAAKAKGAMALFG----EKYDERVRVLSMGDFSTELCGGTHASRTGDIGLFRIIS-ESGTAAGIRRIEAVTGEGAM.... 270
59 3.000e-83UniRef50_A0A2V9LBF3 Alanine--tRNA ligase (Fragment) n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V9LBF3_9BACT  ali  19  126.RLQTMKNHTATHLLHEALKRVLGPHVKQAGS-LVAPDRLRFDFTHYAPLTPGEIRKVEQEVNEQIWQDIHVKTHIMELDQALESGAVALFG----EKYMDQVRVVEVPGYSKELCGGTHVPSTGTIGIFKIVSQES-VASGVRRLEAITGPAALERF. 276
60 3.000e-83UniRef50_Q3AEN8 Alanine--tRNA ligase n=9 Tax=Clostridia TaxID=186801 RepID=SYA_CARHZ  ali  24  557.RMSTARNHTATHLLHKALKMVLGEHVNQAGS-LVTPERLRFDFTHFEGVSDEDLRKIENIVNEAILRNLLVQIDYTTLDEARKAGVIALFD----EKYGDLVRVVKIGEFSAELCGGTHVSSTGVIGFFKILG-ESSIGAGVRRIEALTGLGALEYV. 707
61 3.000e-83UniRef50_Q8Y722 Alanine--tRNA ligase n=2961 Tax=cellular organisms TaxID=131567 RepID=SYA_LISMO  ali  21  559.RRETIKNHTATHLLHRALKDTLGEHVNQAGS-LVSPDRLRFDFSHFGQITEEELTKMEEIVNEKIWEQINVVIEEMPIAEAKELGAMALFG----EKYGDIVRVVQVGKYSIELCGGVHVRNTADIGLFKIVS-ETGIGAGTRRIEAVTGKEAYRFV. 709
62 4.000e-83UniRef50_S0ETC3 Alanine--tRNA ligase n=6 Tax=Bacteria TaxID=2 RepID=S0ETC3_CHTCT  ali  19  586.RLDIMRNHTATHLLQAALRQVLGTHVYQKGS-LVAPDRLRFDFTHTAPMTDDELRQVEELVNAEILNDVELEVHWVPLEEAKARGAMALFG----EKYGERVRVIEIPGFSIELCGGTHLQRTSQVGLFRIVS-ETGIASGVRRIEAVTGRAAWQY.. 736
63 4.000e-83UniRef50_T0MM17 Alanine--tRNA ligase n=3 Tax=FCB group TaxID=1783270 RepID=T0MM17_9BACT  ali  23  553.RKAIMKNHTATHLLHKALRELLGEHVHQAGS-LVAPDRLRFDFSHFKELTDEELSQLEFDINQRIWENMEVSIFDVPLKEALAMGAMALFG----EKYGGKVRVIKIGDYSLELCGGTHTKTTSEIGIFRIVS-ETGVASGVRRIEAITGEKAYQLMQ 705
64 4.000e-83UniRef50_A0A2J0KQ01 Alanine--tRNA ligase n=1 Tax=Candidatus Omnitrophica bacterium CG07_land_8_20_14_0_80_50_8 TaxID=1974742 RepID=A0A2J0KQ01_9BACT :  ali  21  542.RADIMKNHTSTHLLHSALRKVLGDHVKQSGS-LVAPDRLRFDFTHFSALAPESLAAVEKLVNEQIQKNVLLDKKEMPKAEAIREGAIAFFG----EKYGDKVRVVQVGDFSKELCGGTHLDATGQIALFKIVS-ESSVQAGVRRIEALTGRYAL.... 689
65 4.000e-83UniRef50_A0A117CNP8 Alanine--tRNA ligase n=3 Tax=Bacteria TaxID=2 RepID=A0A117CNP8_STREE  ali  23  180.RHRVMKNHTATHLLHAALHNILGNHATQAGS-LNEVEFLRFDFTHFQAVTAEELRAIEQQVNEKIWEALEVKTVETDIDTAKEMGAMALFG----EKYGKEVRVVTIGDYSIELCGGTHVGNTSEIGLFKIVKEE-GIGSGTRRILAVTGKEAFEAY. 330
66 4.000e-83UniRef50_A0A2G6ER79 Alanine--tRNA ligase (Fragment) n=1 Tax=Gammaproteobacteria bacterium TaxID=1913989 RepID=A0A2G6ER79_9GAMM  ali  23  165.RNSIKRNHSATHLLHAALRRVLGKHVEQKGS-LVTDERLRFDFSFDAAVSREQLEEIERLANADILANYPVQAELMSQEQAKDKGAMALFG----EKYGDVVRVLTMGPNSIELCGGTHVERTGDIGQVIITS-ESGVAAGIRRLEAVTGWGAINY.. 314
67 4.000e-83UniRef50_A0A0H8S9U3 Alanine--tRNA ligase n=1 Tax=Vibrio cholerae TaxID=666 RepID=A0A0H8S9U3_VIBCL  ali  24  341.RAAISLNHSATHLLHAALRKVLGEHVAQKGS-LVRAETLRFDFSHLEAMTAAEIKEVERLVNQEVRRNHSIETNIMNIDEAKAKGAMALFG----EKYDDQVRVLSMGDFSTELCGGIHASNTGDIGLFKIIS-EGGIAAGIRRIEAVTGEGALDYLD 492
68 5.000e-83UniRef50_A0A2H6FMG8 Alanine--tRNA ligase n=3 Tax=Bacteria TaxID=2 RepID=A0A2H6FMG8_9BACT  ali  23  589LRHATMRNHTATHLLHRALKDVLGDHVKQSGS-LVSPVRLRFDFTHFYALQQDEIEKVEEIVNEKILEDLPVRTEVMSVDDAIEQGAVALFD----EKYGNSVRVVSAGDYSKELCGGTHCRSTGEIGPFVIIS-EGSVASGIRRIEALTGRQAFRFL. 740
69 5.000e-83UniRef50_A0A1V2M5Z9 Alanine--tRNA ligase (Fragment) n=2 Tax=Epulopiscium TaxID=2383 RepID=A0A1V2M5Z9_9FIRM  ali  24  411.RLSIMRNHSATHLLQYALREVIGNHIEQAGSN-VTPDRLRFDYTHFQPLSSEQIIEIENLVNNEILNGYDVNIEEMPINEARKKGAMALFG----EKYSETVRVVNIGTKSIELCGGTHVANTTEIGTFKIVS-ETGVASGVRRIEAITGFATLAYYQ 562
70 6.000e-83UniRef50_A0A1G1KHP5 Alanine--tRNA ligase n=1 Tax=Omnitrophica bacterium RIFCSPHIGHO2_02_FULL_63_14 TaxID=1801824 RepID=A0A1G1KHP5_9BACT  ali  21  524.RLDIMKNHTATHLLHAALRKVLGEHVKQSGS-LVAGDYLRFDFTHFGAVDPRSLARVEEMVNAEIRKDTPLSKKEMGRDEALKEGAIAFFG----EKYGDLVRVVSVGDFSKELCGGTHLESAGQIGLFKIVS-EGSIQSGVRRIEAVTGHAARELME 675
71 6.000e-83UniRef50_A0A2P5N9J2 Alanine--tRNA ligase (Fragment) n=10 Tax=Proteobacteria TaxID=1224 RepID=A0A2P5N9J2_METSP  ali  19  238IRKAVERNHSATHLLHAALRSVVGEHVQQKGS-LVDSEKLRFDFSHFEPMTDAQKAGVEHLVNQQIRANNAVCAQIMAKDDAVKAGAMALFG----EKYGDEVRVLTMGEFSTELCGGTHVQRTGDIGVFKII-AETGVAAGVRRVEAVTGEGALAWI. 389
72 6.000e-83UniRef50_F6A988 Alanine--tRNA ligase n=43 Tax=Proteobacteria TaxID=1224 RepID=F6A988_PSEF1  ali  22  554VRTATGLNHSATHLLHAALRQVLGEHVQQKGS-LVDSQRLRFDFSHFEAIKPEQLKELEEIVNREVRRNTPVQTEEMDIESAKAKGAMALFG----EKYGDSVRVLTMGDFSVELCGGIHANRTGDIGVFKIVS-EGGVAAGVRRIEAVTGAAAFAYL. 706
73 7.000e-83UniRef50_X1TQ94 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X1TQ94_9ZZZZ  ali  22  64.RAAVRRNHTATHLLHHALRRVLGRHADQAGS-LVAPDHLRFDFTHVEAMTRDQIERVEDLVNERIRQNAGLSTRQTTVAEAKKEGAMALFG----EKYGERVRMVSIGDFSKELCGGLHCAATGDIGLFRIVS-EQSVAAGVRRIEAVTGPGAVDF.. 213
74 7.000e-83UniRef50_A0A1Q7QIX5 Uncharacterized protein n=1 Tax=Armatimonadetes bacterium 13_1_40CM_3_65_7 TaxID=1805024 RepID=A0A1Q7QIX5_9BACT  ali  18  88.RWDIMRNHTATHLLHQALREVVGEHARQAGS-LVAVDRLRFDFVHLAALTPQQRDAVERRVNEQILADLPVRARWMSYAEATRLGAMALFG----EKYGDRVRVISIGGYSRELCGGTHLSRTGQMGLFKIT-AEGGVAAGVRRIEAVTGRGAYELV. 238
75 7.000e-83UniRef50_A0A1W9NU05 Alanine--tRNA ligase (Fragment) n=1 Tax=Epsilonproteobacteria bacterium 4484_20 TaxID=1968526 RepID=A0A1W9NU05_9PROT  ali  19  39.RAEIEKHHSATHLLHAGLRAILGDHIAQAGS-LNDDRRLRFDFSHPKAMTAEEIQKVEEWVNDKISRAIPRKTEIMSVDEAKNSGAVALFG----EKYGDEVRVVSMGDASIELCGGTHVDNTSQIGLFMITK-ESGVSAGVRRIEAICGNAAIDAV. 189
76 8.000e-83UniRef50_A0Q151 Alanine--tRNA ligase n=282 Tax=root TaxID=1 RepID=SYA_CLONN  ali  23  559.RENIGKNHSATHLLHAALRKVVGEHVHQSGS-YVDEDKLRFDFTHFESLTHEELKKVEDLVNDTIESVWDVVTKEMTIEEAKNSGAMALFD----EKYGDKVRVVKMGDFSTELCGGTHISNVGKIGLFKIVS-ESGIAAGTRRIEAVTGHKALEFIE 710
77 8.000e-83UniRef50_A0A257D1J7 Alanine--tRNA ligase (Fragment) n=7 Tax=Proteobacteria TaxID=1224 RepID=A0A257D1J7_9PSED  ali  19  238VRQATARNHSATHLLHAALRQVLGEHVQQKGS-LVDSQRLRFDFSHFEAIKPEQLKALEDIVNREIRLNSAVETEETDIETAKAKGAMALFG----EKYGDNVRVLSMGGFSVELCGGIHAARTGDIALFKITS-EGGVAAGVRRIEAVTGAPALAWL. 390
78 9.000e-83UniRef50_A0A2X1U8Q4 Alanyl-tRNA synthetase n=4 Tax=Neisseria meningitidis TaxID=487 RepID=A0A2X1U8Q4_NEIME  ali  22  670IRNANMRNHSATHLMHKALRDVLGRHVEQKGS-LVTAESTRFDISHPQAVTAEEIAEVERRVNEAILANVAVNAAIMSMEDAQKTGAMMLFG----EKYGDEVRVLQMGGFSTELCGGTHVSRTGDIGLFKIIS-EGGIAAGVRRIEAITGLNALKWAQ 822
79 9.000e-83UniRef50_Q835J8 Alanine--tRNA ligase n=223 Tax=Bacteria TaxID=2 RepID=SYA_ENTFA  ali  23  560MRTRILKNHTATHLLHRALKDVLGEHANQAGS-LVAPGHLRFDFTHFGQVTSEELARMEAIVNEKIWEAIPVVTIETDIDTAKNMGAMALFG----EKYGKEVRVVNIGDYSIELCGGTHVANTEDIGIFKIVS-ESGIGAGVRRIEAVTSKEAYQLLQ 712
80 9.000e-83UniRef50_H1D626 Uncharacterized protein n=1 Tax=Fusobacterium necrophorum subsp. funduliforme 1_1_36S TaxID=742814 RepID=H1D626_9FUSO  ali  21  23.RAAVSKNHTATHLLHKALREVLGTHVQQAGS-LVDSEKLRFDFSHYEAMTEEQIKLVEERVNEKISEAIAVEISHKSMEEAKACGAMMLFG----DKYGDTVRVVDVPGFSTELCGGIHVENIGHIGLFKIVS-EGGIAAGVRRIEAKTGYEAYRFVE 174
81 1.000e-82UniRef50_O34526 Alanine--tRNA ligase n=1594 Tax=cellular organisms TaxID=131567 RepID=SYA_BACSU  ali  26  558MRSGVIKNHTATHLLHQALKDVLGTHVNQAGS-LVTENRLRFDFSHFGQVTKEELEQIERIVNEKIWASIPVSIDLKPIAEAKEMGAMALFG----EKYGDIVRVVQVGDYSLELCGGCHVRNTAEIGLFKIVS-ESGIGAGTRRIEAVTGQGAY.... 706
82 1.000e-82UniRef50_A0A258YJ06 Alanine--tRNA ligase (Fragment) n=2 Tax=Sphingobacteriia TaxID=117747 RepID=A0A258YJ06_9BACT  ali  27  52.RLFTCYNHTATHLLHAALRKVLGTHVAQKGS-LVNEESLRFDFSHFARLTEEEITEVEHIVNEKIRQNIPVVITEMPKEEALKLGAMALFG----EKYGNTVRVVVAPNYSVELCGGTHVMHTGMIGLLKIT-AESAVAAGVRRIEALTGSNAFHFL. 203
83 1.000e-82UniRef50_T0NF16 Uncharacterized protein n=1 Tax=Clostridium sp. BL8 TaxID=1354301 RepID=T0NF16_9CLOT  ali  22  23.RENICKNHTATHMLHEALKEVLGEHVNQAGS-YVDDDRLRFDFTHFAALSEEEITRVENILNREIMKVYNVYTNVMSIDEAKSSGAVALFD----DKYKEDVRVVSVGDYSKELCGGTHVNNSGEIGLFKILS-ETGVAAGIRRIEAITGEKSVKYVE 174
84 1.000e-82UniRef50_B9KZ15 Alanine--tRNA ligase n=10 Tax=Chloroflexi TaxID=200795 RepID=B9KZ15_THERP  ali  22  554.RAAIRRNHTATHLLHAALRRVLGEHAVQAGS-LVAPDRLRFDFSHHESVSPEQLRRIEEMVNEQIVRDLRVEVRYLPLRDALAEGAIALFG----EKYGDTVRVVSIDGFSKELCGGTHVSHTGEIGAFLIT-DETSVASGIRRIEAVTGLAAAR... 702
85 1.000e-82UniRef50_A0A2N1Y4F2 Alanine--tRNA ligase (Fragment) n=1 Tax=Gammaproteobacteria bacterium HGW-Gammaproteobacteria-2 TaxID=2013798 RepID=A0A2N1Y4F2_9G  ali  20  286.RQAIVINHSATHLLHAALREVLGEHVSQKGS-LVAPDRLRFDFSHFQPVSGEQLTQIETLVNAQIRGNAEAEVQQMDMQQALDSGAMALFG----EKYGERVRVLRMGAFSTELCGGTHVRHTGDIGLFKILS-EGGVAAGVRRIEAVTGAAALAHV. 436
86 2.000e-82UniRef50_A0A1V6DMR5 Alanine--tRNA ligase n=1 Tax=Candidatus Cloacimonetes bacterium ADurb.Bin117 TaxID=1852837 RepID=A0A1V6DMR5_9BACT  ali  21  549.RQDIMRNHTATHLLHKALRTVLGEHVQQKGS-LVGPDYLRFDFTHMQALTPVEINSIESIVNAAIRDNLPVSVELKNIAEARSEGAIALFG----EKYSEQVRVVSVSDYSKELCGGTHVSASGEIGLFKIVS-ESSSAAGIRRIEALTGRAAEQFV. 699
87 2.000e-82UniRef50_Q8P9X0 Alanine--tRNA ligase n=340 Tax=Bacteria TaxID=2 RepID=SYA_XANCP  ali  21  563.RGKTILNHSATHLLHAALREVLGTHVQQKGS-LVAPDRLRFDFSHFQPITAEELAVIERKVNAEVRTNHSVEVHNMAMQEALDFGAMALFG----EKYGERVRVLKMGGYSTELCGGTHVSRTGDIGLFKITS-EGGVSSGVRRIEAVTGQGALDYV. 713
88 2.000e-82UniRef50_A0A160XJ66 Alanine--tRNA ligase n=1 Tax=Clostridioides difficile TaxID=1496 RepID=A0A160XJ66_CLODI  ali  21  362IRMSAARNHSATHLLHKALKEVLGDHVNQAGS-LVTPERLRFDITHFEAISNEELKVIEEKVNNVILSSLDIKCDIMNIKEAKEKGATALFG----EKYGDEVRVVSMGDYSTELCGGTHLTNTSQVGMFKILS-EGGVAAGVRRIEAITGKAVYEYLK 514
89 2.000e-82UniRef50_A0A2V8RZY7 Alanine--tRNA ligase n=4 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8RZY7_9BACT  ali  24  588.RDATRRNHTATHLIHAALREVLGAHVKQAGS-LVAPNRLRFDFTHYQPLTRDEIAELERLVNYQILRNTPVETKVLPIEQAMQSGAMALFG----EKYAEMVRVLTVPGFSQELCGGTHVRATGDIGLFKIIKDES-IASGTRRIEAVTGADAFTRFQ 739
90 2.000e-82UniRef50_A0A1M7TDC2 Alanine--tRNA ligase n=2 Tax=Bacteria TaxID=2 RepID=A0A1M7TDC2_9DELT  ali  19  570.RIASARNHTCTHLLHAALRSVLGTHVKQAGS-LVTPERLRFDFTHIQALTADELLKVEELVNKAILADTPVNSRETSYDDAVANGAMALFG----EKYGDKVRMVKVGDFSTELCGGTHLKSSGEAGSFVILS-EAGVAAGTRRIEAATGLNALHYLQ 721
91 2.000e-82UniRef50_A0A2J6WIJ4 Alanine--tRNA ligase n=1 Tax=Mesoaciditoga sp. TaxID=2060323 RepID=A0A2J6WIJ4_9BACT  ali  25  552.RKSIARNHTATHLLQAALQKVLGDHVRQFGS-YVGPEKLRFDFTHNSPLTPEEIEKIIMMVNDEILKAIDVKTKIMPLEEAKKIGAMALFG----EKYSDTVRVVFVDDFSKELCGGTHVSNTGEIGIFMITS-ERGVSAGVRRIEATTGTNVLK... 700
92 2.000e-82UniRef50_A0A1Y1QDV8 Alanine--tRNA ligase (Fragment) n=3 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A1Y1QDV8_9GAMM  ali  22  11.RQAIILNHSATHLMHAALRQVLGTHVEQKGS-LVTPDRLRFDFSQPDPVSTEQIAEVEAIVNREIRANAATSAQVMNMEAAKQAGAMALFG----EKYGDEVRVLKIG-FSTELCGGCHVNRTGDIGLFKIVS-EGGVAAGVRRIEAVTGANALTWL. 160
93 3.000e-82UniRef50_A0A1I7N8P2 Alanine--tRNA ligase n=6 Tax=Bacteroidetes TaxID=976 RepID=A0A1I7N8P2_9BACT  ali  28  561.RQKLMLNHSATHLLHAALRQVLGHHVQQKGS-LVHPDYLRFDFSHFNKLSIQEIQEVEALVNAKIRENIPVQIQYLPREEALRMGAMALFG----EKYGEQVRVVTMDPFSIELCGGTHVRYTGEIGFF-IITAETAVAAGVRRIEALTGEAAWQYV. 712
94 3.000e-82UniRef50_A0A2V9K6U7 Uncharacterized protein n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V9K6U7_9BACT  ali  22  138.RDAIRRNHTGTHLLHAALHEVVGTHAKQAGS-LVAPDRLRFDFTHYAALSEQDLLDIEDLVNQHVLGNEEVHTEVTELEKAIESGAMALFG----EKYGDKVRVVSIGGFSKELCGGTHVRRTGDIGLFKIVS-ESSVSAGTRRIEALTGTGVLEHL. 290
95 3.000e-82UniRef50_A0A1G0WLK4 Alanine--tRNA ligase n=2 Tax=Bacteroidetes/Chlorobi group TaxID=68336 RepID=A0A1G0WLK4_9BACT  ali  27  537.RRNIMRNHSATHLLHEALRQVLGEHVKQAGS-LVAPDYLRFDFNHFEKVNDDDLKKIESVVNEKIFQNIDVRTDVLPIEEAKKTPGIKMFFG---DKYGDIVRVVKMDEFSQEFCGGTHVKNTSEIGFFKIIS-ESSIAAGVRRIEAITGKSIEEF.. 688
96 3.000e-82UniRef50_A0A1V5JXR7 Alanine--tRNA ligase n=1 Tax=Candidatus Aminicenantes bacterium ADurb.Bin508 TaxID=1852832 RepID=A0A1V5JXR7_9BACT  ali  23  94LRWSTRKNHTSTHLLHKALRETLGPHVKQSGS-LVSPQRLRFDFTHFQPLTAEEIGWVEEMVNEKVQADLPVTTEVLLLDEAIKRGATAIFE----EKYGEHVRVVSVEGFSQELCGGTHVGRTGEIGAFKILS-ESSVSAGVRRIEAVTGFNTLHRFQ 246
97 3.000e-82UniRef50_A0A2I0NEJ0 Alanine--tRNA ligase n=1 Tax=Spirochaetae bacterium HGW-Spirochaetae-6 TaxID=2013838 RepID=A0A2I0NEJ0_9SPIR  ali  24  549.RLATQKNHTATHLLHKALQEVLGDHVQQSGS-QVDPERLRFDFSHFQKVSSEELVRIERLVNENIQRAVALDINFMPLDAAKEKGAMALFG----EKYGNVVRVVDIPGYSLELCGGTHVDNTGEIGMIKIIS-ESSVASGIRRMEAITGLKAAALL. 699
98 3.000e-82UniRef50_A0A1F5UUV6 Alanine--tRNA ligase n=1 Tax=Candidatus Firestonebacteria bacterium RIFOXYC2_FULL_39_67 TaxID=1817861 RepID=A0A1F5UUV6_9BACT  ali  26  550.RKAIMRNHTATHLLHWALGKVLGEHIRQAGS-YVGPEYFRFDFNHFKAVSREELDKIENLINEKIIESSNVTVTELPVAEAKKTGAVALFG----EKYGDLVRVVSVEGVSKEFCGGTHVKNIGKIGVVKITS-ESSVASGIRRIEAVSGLGAYKIIK 701
99 3.000e-82UniRef50_A0A1V5JYX7 Alanine--tRNA ligase n=1 Tax=Firmicutes bacterium ADurb.Bin506 TaxID=1852895 RepID=A0A1V5JYX7_9FIRM  ali  21  25IRAATAANHSATHLLHAALRAVLGSHVQQAGSA-VDSERLRFDFSHHTALTRQQLDEVEAMVNRWVLRNLPVNVSYGSIDEAKKQGAMALFD----EKYGHTVRMVRMGDVSFELCGGTHVSKTGDIGMVKIV-AEGGIAAGVRRIEAVTGMGALEYV. 176
100 4.000e-82UniRef50_F8E8T1 Alanine--tRNA ligase n=3 Tax=Bacteria TaxID=2 RepID=F8E8T1_FLESM  ali  25  558.RKAVEKNHTSTHLIHKALREVLGDHVRQSGS-LVDSEKLRFDFTHFSPLSREEIVEIENIVNKKIQENLPVKKEITDIDSAIQKGAMAIFG----EKYGDTVRVVSVNDFSKELCGGCHVNYTGEIGLFKIT-TETSVASGIRRIEALTGIKAFEEL. 708
101 4.000e-82UniRef50_W4L817 Alanine--tRNA ligase (Fragment) n=1 Tax=Candidatus Entotheonella factor TaxID=1429438 RepID=W4L817_9BACT  ali  19  347.REAIRKNHTATHLLHAALRQILGDHVKQAGS-LVAPDRLRFDFTHFTRLSERELERIERLVNEQLWHNTAVQDEVTSLDNALASGAMALFG----EKYGEDVRTIEVPGFSKELCGGTHVRATGEIGFFTITS-EGGIGSGVRRIEALTGPGAYDYVK 498
102 4.000e-82UniRef50_A0A2W4QHI1 Alanine--tRNA ligase (Fragment) n=1 Tax=Firmicutes bacterium TaxID=1879010 RepID=A0A2W4QHI1_9FIRM  ali  21  128.RKDTQKNHTATHLLHKALREVLGTHVQQAGS-LVAPDRLRFDFTHTGPMTPEQIAAVEEMINSKIEAAEPVTWTEMPLAEAKALGAMALFG----EKYGEIVRVVTVGDWSRELCGGCHVRNTSEIQYFKILS-ESGIGGGVRRIEAATGAGVIRH.. 278
103 5.000e-82UniRef50_UPI0009081AF2 hypothetical protein n=1 Tax=Klebsiella variicola TaxID=244366 RepID=UPI0009081AF2  ali  21  285.RQRIRLNHSATHLMHAALRQVLGTHVAQKGS-LVNDKALRFDFSHFEAMKPEEIRAVEDLVNAQIRRNLAIETNIMDIDAARASGAMALFG----EKYDDRVRVLQMGDFSTELCGGTHAARTGDIGLFRITS-ESGTAAGVRRIEAVTGEGAIAML. 435
104 5.000e-82UniRef50_A9M198 Alanine--tRNA ligase n=282 Tax=Proteobacteria TaxID=1224 RepID=SYA_NEIM0  ali  22  554IRNANMRNHSATHLMHKALRDVLGGHVEQKGS-LVTAESTRFDISHPQAVTAEEIAEVERRVNEAVLANVAVNAAIMSMEDAQKTGAMMLFG----EKYGEEVRVLQMGGFSTELCGGTHVSRTGDIGLFKIIS-EGGIAAGVRRIEAITGLNALKWAQ 706
105 5.000e-82UniRef50_A0A2V9JKI2 Alanine--tRNA ligase n=2 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V9JKI2_9BACT  ali  19  558.RLQTMKNHTATHLLHEALKRVLGPHVKQAGS-LVAPDRLRFDFTHYAPLTPGEIRKVEQEVNEQIWQDIHVKTHIMELDQALESGAVALFG----EKYMDQVRVVEVPGYSKELCGGTHVPSTGTIGIFKIVSQES-VASGVRRLEAITGPAALERF. 708
106 5.000e-82UniRef50_I0QMA8 Alanine--tRNA ligase n=23 Tax=Bacteria TaxID=2 RepID=I0QMA8_9GAMM  ali  22  557.RDRIRLNHSATHLLHAALRQTLGKHVAQKGS-LVNDNYLRFDFSHFEAMKPEEIRQVEDLVNAQIRRNLPIETKIMALDDAKEKGAMALFG----EKYEDNVRVLSMGDFSTELCGGIHASRTGDIGLFRIQS-ESGTAAGVRRIEAVTGENAIN... 705
107 7.000e-82UniRef50_B2V709 Alanine--tRNA ligase n=27 Tax=Bacteria TaxID=2 RepID=SYA_SULSY  ali  24  561.RENIMRHHTATHLLHAALRNVLGDHVKQAGS-LVSDEYLRFDFTHFESMTDEELKAVEELVNREIMKNEEVVCQEMQYEEALKSGAMAIFE----EKYADVVRVISAG-ISKELCGGTHVKRTGDIGYFKILS-ESAVSSGTRRIEAVAGIKAVE... 708
108 7.000e-82UniRef50_A0A2N2IL08 Alanine--tRNA ligase (Fragment) n=1 Tax=Deltaproteobacteria bacterium HGW-Deltaproteobacteria-20 TaxID=2013748 RepID=A0A2N2IL08_9  ali  25  50.RQATRRNHSATHLLHYALRTVLGTHAAQKGS-LVGPDRLRFDFTHGKAVTVEELQRIEDLVNAKVLRNAPVETRILPIDEARKLGAMAIFG----DKYGDTVRVLTITPDSIELCGGTHARASGDIGLFKILS-EGGIAAGVRRIEAATGFNAVAYV. 200
109 8.000e-82UniRef50_UPI0004E1E95B alanine--tRNA ligase n=1 Tax=Bryobacter aggregatus TaxID=360054 RepID=UPI0004E1E95B  ali  28  540.RSASMRHHTATHLLQAALQKVLGRHVKQAGSV-VEPNRLRFDFTHYAALSAEEKAEIEALVNAEVLENIDVATNVMSLDEALQSGAMALFG----EKYGDNVRVVRIGDFSKELCGGTHVKRTGDIGGVKIV-YEGSSSAGVRRIEAVAGPRVTEYFE 691
110 9.000e-82UniRef50_A0A2J6XUI6 Alanine--tRNA ligase n=1 Tax=Dictyoglomus sp. NZ13-RE01 TaxID=2010949 RepID=A0A2J6XUI6_9BACT  ali  24  547LRFATQRHHTATHLLHSALRRVLGEHVSQAGS-LVSPDFLRFDFTHYKPLTDEELREVERLVNESILENHLVEKFVTTIDKARDMGAIALF----TEKYQRDVRVIKIDSVSMELCGGTHVNRTGDIGLFLITKEE-GIGSGIRRIFAVCGMKAWEYV. 698
111 9.000e-82UniRef50_B5Y7R1 Alanine--tRNA ligase n=4 Tax=Coprothermobacter TaxID=68335 RepID=B5Y7R1_COPPD  ali  27  555.RKAMQRAHTATHLLHAALRRVLGDHVRQGGSK-VGPDWFRFDFSHFESMSPAQIQEVERLVNEQVLENKEVNIFFTSLDEAKKMGAMALFG----EKYGETVRVVEVPDWSMELCGGTHAKRTGDIGLFHIIS-ESASSQGIRRIEAITGKKALEHL. 705
112 9.000e-82UniRef50_H1Y9T1 Alanine--tRNA ligase n=7 Tax=Bacteroidetes TaxID=976 RepID=H1Y9T1_9SPHI  ali  27  609.RKATNNNHSATHLLHAALKEVLGSHVNQKGS-LVNNEYLRFDFSHFSKVTDEEIARIEAIVNERIRENILVDIQELPKEEAIAMGANALFG----EKYGDTVRVVTMDKFSIELCGGTHVQSTGQIGFFKII-AESAVAAGVRRIEAITGVAVEQYF. 760
113 1.000e-81UniRef50_A0A1J4VEE0 Alanine--tRNA ligase n=1 Tax=Candidatus Omnitrophica bacterium CG1_02_40_15 TaxID=1805284 RepID=A0A1J4VEE0_9BACT  ali  24  547.RLNIRKNHTATHLLHNALRKALGLHVKQAGSM-VAPERLRFDFTHFKQVTDEELSRIEDIVNENIRKDNVVKIDNLSLEEAKKIDVIALFG----EKYGDVVRMVSVGDYSRELCGGTHVTRTGEIGIFKIIS-ESSIASGVRRIEAITSKFAYEKIK 698
114 1.000e-81UniRef50_A0A1W9PKK9 Alanine--tRNA ligase (Fragment) n=1 Tax=candidate division KSB1 bacterium 4484_219 TaxID=1968530 RepID=A0A1W9PKK9_9BACT  ali  23  1...AIARNHTCTHLLHKALREVLGKHVNQAGS-LVAPDRLRFDFTHFEKISESQLDEVERRVNEIIRANFAVEVLHKTFDEAKLMGATALFG----EKYADVVRVVKIDDYSLELCGGTHLDFTGEIGYFRIT-TESSVAAGIRRIEAVTGEAADK... 147
115 1.000e-81UniRef50_A0A023DYI9 Alanine--tRNA ligase n=3 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A023DYI9_9PROT  ali  24  423.RKKVQSNHSATHLLHSALRSILGQHVSQKGS-LVTPERLRFDFSHPAAVSEEELCQIEAWVNDKIWENLPVKFAVMPQEAALKAGAMALFG----EKYAQEVRVVSIGKLSIELCGGTHVEHTGEIGLFKIL-QESSIGSGVRRIEAVTQQEAFKYVQ 578
116 1.000e-81UniRef50_A0A1F2UX85 Alanine--tRNA ligase n=35 Tax=Bacteria TaxID=2 RepID=A0A1F2UX85_9BACT  ali  21  573LRDATRRNHTATHLLHAALRKVLGAHVKQAGS-LVAPDRLRFDFVHFSAITPEEMLQIERLVNAAIQNNEAVNTAVRNTQDAIASGAMALFG----EKYGDKVRVVAVGDFSTELCGGTHVRATGDIGAFLIT-EESGVAAGVRRIEAVTGMGAID... 724
117 1.000e-81UniRef50_A4NX67 Alanine--tRNA ligase n=16 Tax=Bacteria TaxID=2 RepID=A4NX67_HAEIF  ali  21  425.RHNTSLNHSATHLLHAALRQILGLHVVQKGS-LVSDKALRFDFAQPEAITKEQLSEIETLVNQKIRANFPVQTDIMDIDSAKAKGAMALFG----EKYGDKVRVLTMGDFSIELCGGIHAKRTGDIGLFKII-TENAVAAGIRRIEAVTGQNAIDWL. 575
118 1.000e-81UniRef50_A0A117LBL3 Alanine--tRNA ligase (Fragment) n=1 Tax=Thermacetogenium phaeum TaxID=85874 RepID=A0A117LBL3_9THEO  ali  22  1..LATARNHTATHLLHRALREVLGEHVQQMGS-LVAPDRLRFDFSHFAPLSPEEIERVEELVNEKILDNLIVNTFEAGRDDPRVRDAIALFG----EKYGDVVRVVEIGNFSKELCGGTHVRRTSELALFKITS-EGGIGTGVRRIEALTGEALLHF.. 149
119 2.000e-81UniRef50_A0A2H0P3F0 Alanine--tRNA ligase (Fragment) n=1 Tax=Deltaproteobacteria bacterium CG11_big_fil_rev_8_21_14_0_20_49_13 TaxID=1973976 RepID=A0A  ali  21  222.RADTKRNHTATHLLHKTLRETLGEHVKQAGS-LVGPSRLRFDFSHFHAMTDEEISNVEADVNDAIRKNFKVNVNEMPHEEAIKKGALAFFG----EKYGARVRLVEVEGFSMELCGGTHVSRSGDIGMFKILS-ESSVASGVRRIEAVTGAGVEAYV. 372
120 2.000e-81UniRef50_UPI00094F2151 alanine--tRNA ligase n=1 Tax=Colibacter massiliensis TaxID=1852379 RepID=UPI00094F2151  ali  23  550..LAIARNHTATHLLQAALRKVLGSHVNQAGS-LVAPDRLRFDFTHFSPLTADEIAAVEREVNTQIWKNISLEIEEMPIDEAKKKGAMALFG----EKYGHIVRVVTVPGFSCELCGGSHVTNTSVIGFFRIVG-ESGTGTGIRRIEAVTGQAAYE... 697
121 2.000e-81UniRef50_K2CB25 Uncharacterized protein n=1 Tax=groundwater metagenome TaxID=717931 RepID=K2CB25_9ZZZZ  ali  19  41.RRATMRNHTATHILHKALRQVLGDHVKQAGSM-VSPDRLRFDFTHFESIGATELEKIETIVNQQILAAHNVHVDEKSYDEAVKTGAVALFG----EKYGDRVRIISVGNYSKELCGGTHIGNSAEIGLFSIAS-ESSIAAGVRRIEAVTGESSLDVL. 191
122 2.000e-81UniRef50_A0A1F9IMQ8 Alanine--tRNA ligase n=2 Tax=unclassified Deltaproteobacteria (miscellaneous) TaxID=122706 RepID=A0A1F9IMQ8_9DELT  ali  27  566.RRRIQNHHSATHILHAALRQVLGTHVRQAGS-LVEPGRLRFDFSHFEPVDPEELRRIEDLSNEAIRSNHSVTKATLSYEEAMKKGALAFFE----EKYGDQVRVVKMGDYSCELCGGSHVEATGEIGLIKIIN-ESSVAAGVRRIEAVVGEDGFQYL. 716
123 2.000e-81UniRef50_A7ZQC5 Alanine--tRNA ligase n=5729 Tax=root TaxID=1 RepID=SYA_ECO24  ali  22  557.RARIRLNHSATHLMHAALRQVLGTHVSQKGS-LVNDKVLRFDFSHNEAMKPEEIRAVEDLVNAQIRRNLPIETNIMDLEAAKAKGAMALFG----EKYDERVRVLSMGDFSTELCGGTHASRTGDIGLFRIIS-ESGTAAGVRRIEAVTGEGAI.... 704
124 2.000e-81UniRef50_A0A1G3BMN2 Alanine--tRNA ligase n=2 Tax=unclassified Planctomycetes TaxID=473814 RepID=A0A1G3BMN2_9BACT  ali  26  561.RSGISRSHTATHILHHVLRQVVGEHAEQAGS-LVMPDRLRFDFNHFQALKKDEISRVEDLVNEKIREDSPVEADEMPLEEAKKRGAIALFG----EKYGEKVRLVNIGDFSLELCGGIHLRRTGEIGLFKIVG-EGSVAAGIRRIEALTGPAAL.... 708
125 2.000e-81UniRef50_A0A1Q3SHF4 Alanine--tRNA ligase n=1 Tax=Chloroflexi bacterium 54-19 TaxID=1895928 RepID=A0A1Q3SHF4_9CHLR  ali  20  570.RLDTARNHTGTHILHRALKDVLGDEVGQAGS-LVAPDRLRFDFTYHEPITEEQLQRIQQIVNAKIRDDLPVTIREMALDDAKKSGAVMMFG----EKYGDRVRVISIGDYSTELCGGTHLRRSGQIGLMVITN-EGSVSSGVRRVEAVTGRGAEKYVQ 721
126 3.000e-81UniRef50_UPI00056E0E83 alanine--tRNA ligase n=1 Tax=Thermorudis peleae TaxID=1382356 RepID=UPI00056E0E83  ali  22  554.RAAIRRNHTATHLLHAALKQVLGEHAQQAGS-LVAPDRLRFDFTHPTALTEEQLYAITRRVNEEILRDLPVDIAYKPYREAIAEGAIALFG----EKYGDTVRVVSIPGFSKELCGGTHVARTGEIGLFLIT-DESSVASGVRRIEAVTGTRSVE... 702
127 3.000e-81UniRef50_A0A1B8NWX2 Alanine--tRNA ligase n=1 Tax=Halomonas elongata TaxID=2746 RepID=A0A1B8NWX2_HALEL  ali  24  163LRAATVRNHSATHLLHQALRMVLGDHVQQKGS-LVTPERLRFDFSHFEPMTAEQLAEVERLVNEQVLANAPTRIEHMTLDEAKEKGAAALFEA----KYADSVRVLTIGDFSIELCGGTHVARSGDIGCCHIV-AEAGIASGVRRIEAITGEGALAYF. 316
128 3.000e-81UniRef50_UPI0009B0AB02 alanine--tRNA ligase n=13 Tax=Bacilli TaxID=91061 RepID=UPI0009B0AB02  ali  23  561.RKLIERNHTATHLLHQALKDVLGDHANQAGS-LVSPDQLRFDFTHFGQVTEQELKQMETLVNQKIFDAVPVSTVVTSIEEAKKLGAMALFG----EKYGDQVRVVMIGEYSKEFCGGTHVTNTSDIGLFKIVS-ESGIGAGTRRIIAKTSEGYYKWME 712
129 4.000e-81UniRef50_X0RUP2 Uncharacterized protein (Fragment) n=2 Tax=marine sediment metagenome TaxID=412755 RepID=X0RUP2_9ZZZZ  ali  21  466.RKAIARNHTATHLLHRVLRDVLGEHVKQSGSAANN-HHLRFDFNHFAPLTMEEIEKIENLVNEKILDELKVETKISTFDKAKEMGAVALFG----EKYGEQVRVVKIGEFSLELCGGTHLNSTSNIGLFKILNEE-GIGSGIRRIEAVTGERALKYI. 616
130 4.000e-81UniRef50_E8N5J6 Alanine--tRNA ligase n=36 Tax=Chloroflexi TaxID=200795 RepID=E8N5J6_ANATU  ali  20  587.RRDIMRNHTATHLLHAELQEVLGEHARQAGS-LVAPDRLRFDFTHPEPLTPEQLERIEAGVNRAILENIPLQTRVKPLQEAIAEGAMALFG----EKYGEVVRTVMIGETSYELCGGTHVHETGDIGLFLIVS-EGSAAAGVRRIEAVTGRGAYELVQ 741
131 4.000e-81UniRef50_A0A0T8P4A4 Multifunctional fusion protein n=11 Tax=Bacilli TaxID=91061 RepID=A0A0T8P4A4_STREE  ali  23  315.RSSVVKNHTATHLLHQALKDVLGTHVNQAGS-LVTSERLRFDFSHFGQVQADELEKIERIVNEKIWESIDVEISQKAIEEAKEMGAMALFG----EKYGDVVRVVQVGDYSLELCGGCHVDNTASIGIFKIV-AESGIGAGTRRIEAVTGKSAYELM. 465
132 4.000e-81UniRef50_X0Y2J6 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X0Y2J6_9ZZZZ  ali  23  38.RRSLSKNHSATHLLHSSLRQILGDHVKQSGS-LVSPFRLRFDFTHFNSITTHEIKAIESQVNEKIQENIPITTRVTSYERAIKEGAVAIFE----EKYKEDVRVVTVRDFSKELCGGSHVENTGNIGLFKIIS-EGSIAAGIRRIEALTGLKAVEYVQ 189
133 5.000e-81UniRef50_D5AI85 Alanyl-tRNA synthetase, class IIc n=4 Tax=Lactobacillales TaxID=186826 RepID=D5AI85_STRGZ  ali  22  85.RKGVEKNHTATHLLHAALHNIIGEHATQAGS-LNEQDFLRFDFTHFEAVTAEELRRIEEEVNEQIWNAIPVVTVETDIDTAKEMGAMALFG----EKYGKEVRVVTIGDYSVELCGGTHVGNTAEIGIFKILKEE-GIGSGTRRIIAVTGREAF.... 232
134 5.000e-81UniRef50_A0A2V7EHN3 Alanine--tRNA ligase n=1 Tax=Gemmatimonadetes bacterium TaxID=2026742 RepID=A0A2V7EHN3_9BACT  ali  19  630.RRDTERNHTATHLLHAALRRVLGEHVHQAGS-LVAPDRLRFDFTHHGPLTPQQLAEIENLVNREILDGVPLTFEQKSYDEAVANGAMHLF----SEKYGDVVRVVSIPGISSELCGGTHVRNTAEIALFKIVS-ETGIAAGVRRIEAVTGRGALDLF. 780
135 6.000e-81UniRef50_A0A0S8AH49 Alanine--tRNA ligase (Fragment) n=1 Tax=Nitrospira bacterium SG8_35_4 TaxID=1704025 RepID=A0A0S8AH49_9BACT  ali  24  252.RKAIKRNHTATHLLHAALKAVLGDHVKQAGS-LVAQDRLRFDFTHFFAVNSRELNEIERIVNEKIIGNMRVDVAETSLDDAIAQGVVALFG----EKYGERVRVVRAGDFSAELCGGTHCDATGDIGPFKIIS-EGSVAAGIRRIEAITGFSALEYL. 402
136 6.000e-81UniRef50_A0A220RYV5 Alanine--tRNA ligase n=1 Tax=Neisseria sp. 10023 TaxID=1853278 RepID=A0A220RYV5_9NEIS  ali  22  644VRNANMRNHSATHLMHRALRDVLGSHVEQKGS-LVTAESTRFDISHPQAVTAEEIVEVERRVNQAILANVAVSAQSMSMEDAQKTGAMMLFG----EKYGDEVRVLQMGEFSTELCGGTHVARTGDIGLFKIIS-EGGIAAGVRRIEAITGLNALNWAQ 796
137 6.000e-81UniRef50_F7KQ94 Alanine--tRNA ligase (Fragment) n=1 Tax=Lachnospiraceae bacterium 5_1_57FAA TaxID=658085 RepID=F7KQ94_9FIRM  ali  22  210.RMLSANNHSATHLLHKALRMVLGNHVEQAGSS-VNADRLRFDFTHFSALTEEELKKVEAIVNEQIMNCLNVKVQNMPIEEAKKTGAAALFG----EKYGSIVRVVSMGDFSIEFCGGTHVANTGVITAFKILS-ETGVAAGVRRIEALTSKGLLKYYD 361
138 7.000e-81UniRef50_A0A2M7WIZ9 Alanine--tRNA ligase n=1 Tax=candidate division Zixibacteria bacterium CG_4_9_14_3_um_filter_46_8 TaxID=1975520 RepID=A0A2M7WIZ9_  ali  22  207.RGHIKRNHTATHLLHKALRGILGDHATQAGS-YVGPDRLRFDFTHYKALTDEEINQIETMVNRAIMADYQVNSENVPLEEAKKEGAMALFG----EKYGEKVRVIRIKNYSIELCGGTHVNRTGEIGSFVIMS-ESAIAAGMRRIEALTGGGAIEYLK 364
139 7.000e-81UniRef50_A0A0U0GR07 Alanine--tRNA ligase n=4 Tax=Streptococcus TaxID=1301 RepID=A0A0U0GR07_STREE  ali  23  545.RHRVMKNHTATHLLHAALHNILGNHATQAGS-LNEVEFLRFDFTHFQAVTAEELRAIEQQVNEKIWEALEVKTVETDIDTAKEMGAMALFG----EKYGKEVRVVTIGDYSIELCGGTHVGNTSEIGLFKIVKEE-GIGSGTRRILAVTGKEAFEAY. 695
140 7.000e-81UniRef50_X1A1M7 Uncharacterized protein (Fragment) n=3 Tax=root TaxID=1 RepID=X1A1M7_9ZZZZ  ali  19  189.RKAIARNHTATHLLHRTLRDVLGNHVKQSGSS-VNDDHLRFDFNHFAPLTKDELDKIEDLLNNKILDNLKVETQFTTFDKAKEMGAMALFG----EKYGEQVRVVKIGEFSLELCGGTHLDSTSNIGLFKILN-EQGIGSSLRRVEAVTGAKALKYVK 340
141 8.000e-81UniRef50_A5D3F4 Alanine--tRNA ligase n=29 Tax=Terrabacteria group TaxID=1783272 RepID=SYA_PELTS  ali  23  557.RAATCRNHSATHLLHKALKEVLGGHVNQAGS-LVEPERLRFDFTHYAAATPEELQKVEELVNRMVLSALPVEAFETSLAEARKMGAAALFG----EKYGERVRVVKMGDFSLELCGGTHLRNTAEVGLFKLLG-ESSVGAGLRRIEAVTGEGALSYVK 708
142 8.000e-81UniRef50_A0A2W4TUI6 Alanine--tRNA ligase (Fragment) n=3 Tax=Proteobacteria TaxID=1224 RepID=A0A2W4TUI6_9PROT  ali  24  151.RSAIRANHSATHLIHEALRQVLGSHVAQKGS-LVAPDRLRFDFSHPKPMTAEELKKVEDLANSIVAQNVPVETHLMSLEEALETGAMALFG----EKYGDEVRVVSMGPWSMELCGGTHVKRTGDIRIIRIIS-EGASAAGVRRIEALTGDGARAYL. 309
143 1.000e-80UniRef50_A0A117M9I9 Alanine--tRNA ligase n=2 Tax=Candidatus Marinimicrobia TaxID=62680 RepID=A0A117M9I9_9BACT  ali  21  553.RLDTARNHTGTHLLHAALRNVLGPHVRQAGS-YVGPDNLRFDFNHPRKVSSDEQKKIQSLVNEAILHNIPLTVKYMSYHDAVNKGAIALFG----EKYGQEVRTIKIGDISFELCGGTHVQATGDIGYFIILN-ESSIASGIRRIEAVTGHKAREYL. 703
144 1.000e-80UniRef50_A0A1G3C6T2 Alanine--tRNA ligase n=1 Tax=Planctomycetes bacterium RIFCSPLOWO2_12_FULL_40_19 TaxID=1801983 RepID=A0A1G3C6T2_9BACT  ali  25  286.RAAIKRNHSATHLLHYTLRQVVGQHAEQSGS-LVAPERLRFDFHHFEGIKKDEIARIEELMNERIMENAPVITEEMTLDKARNAGATALFG----EKYGENVRVVNIGDYSQELCAGTHVSSTGEIGLFKIIS-ESSIAAGIRRIEAITGNEALARI. 436
145 1.000e-80UniRef50_A0A191HV63 Alanine--tRNA ligase n=1 Tax=endosymbiont `TC1` of Trimyema compressum TaxID=243899 RepID=A0A191HV63_9FIRM  ali  26  561.RKTIMRSHSATHLLHRALQEVLGKHASQKGS-YVDEHYLRFDFSHFELLSNEELIEIEDLVNDYILSFSPVTIEVLSIAEAKNKGAMAIFG----EKYGDQVRVVTMGDISMEFCGGTHIDNTGEIGAFKILS-EGSVGSGLRRIEAITGKNVIKYMQ 712
146 1.000e-80UniRef50_A0A1Q7T8S4 Alanine--tRNA ligase (Fragment) n=3 Tax=Candidatus Rokubacteria TaxID=1752708 RepID=A0A1Q7T8S4_9BACT  ali  23  223.RLGLRQHHTGTHLLHAALRKVLGTHVSQAGS-LVAPDHLRFDFSHGGGVKDREIEQIEELVNEQVQANTPVTHREMDLKEALAAGAMALFG----EKYGDRVRVVKIGEFSTELCGGTHLDATGQIGFFK-VAEEGAVASGVRRIEAVAGTAAVEAV. 373
147 1.000e-80UniRef50_A0A2P8DC62 Alanine--tRNA ligase n=1 Tax=Taibaiella chishuiensis TaxID=1434707 RepID=A0A2P8DC62_9BACT  ali  26  614.RMLTSYNHTATHLMHAALRQVLGNHVAQKGS-LVNNEVLRFDFSHFAKMTDEEIRRVEEIVNEKIRQNIPVVIKEMPKEEAIAMGAMALFG----EKYGNTVRTVVIDPYSIELCGGTHVGHTGMIGVFTITS-EGAVAAGVRRIEALTGPEAIRHF. 765
148 1.000e-80UniRef50_A0A2W4LUR7 Alanine--tRNA ligase n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2W4LUR7_9CHLR  ali  23  255.RRAIMRNHTATHLLHRALRDVVGEHAAQAGS-LVAPDRLRFDFTHTRQLTPEQLREIERRVNAWVRADAPVDWQEMGYQEAIDRGAIALFG----EKYGDRVRVVHVGDFSRELCGGTHVSRTGEIGFFRIVG-ESSVAAGVRRVEALTGAGAEQWVE 429
149 1.000e-80UniRef50_A0A2V8HQV6 Alanine--tRNA ligase n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8HQV6_9BACT  ali  22  534.......NHTATHLLHAALRQVLGPHVKQAGS-LVAPDRLRFDFVHFTALTREQLRNIEQIVNKHVLKNTPVETVVKPTQEAIAAGAMALFG----EKYGDKVRVVSVPGVSMELCGGTHVHATGDIGLFAIVS-ESGVAAGTRRIEAITGNESLELFE 679
150 2.000e-80UniRef50_A0A0B0HRZ6 Alanine--tRNA ligase n=2 Tax=cellular organisms TaxID=131567 RepID=A0A0B0HRZ6_9BACI  ali  24  1.............MLHQALKDVLGVHVNQAGS-LVAPDRLRFDFTHFGQVKQEELEQIEAIVNEQIWRNLPVNIDYKPLDEAKAMGAMALFG----EKYGDIVRVVQVGDYSLELCGGCHVTNTAEIGLFKIVS-ESGIGAGTRRIEAVTGKAA..... 135
151 2.000e-80UniRef50_A0A271IZU3 Alanine--tRNA ligase n=2 Tax=Rubrivirga marina TaxID=1196024 RepID=A0A271IZU3_9BACT  ali  22  652.RQRIMRHHTATHLLHAALRETLGTHVQQKGS-LVAPDRLRFDFSHFERLTDEERRTVEDRVNALVLRNIPKEARDVPLDEARARGAMALFG----EKYGERVRVITFGDVSVELCGGTHVASTGEIGLFKLTS-EGSVASGVRRVEAVAGEAALAWLD 805
152 2.000e-80UniRef50_W1UQB5 Alanine-tRNA ligase (Fragment) n=1 Tax=Veillonella sp. DORA_B_18_19_23 TaxID=1403933 RepID=W1UQB5_9FIRM  ali  19  127.RAAMARNHTATHLLHAALKQILGEHVNQAGS-LVTPDYLRFDFTHFSPVTQEELDQIEALVNEEILKATDLAIAEMSMDEAKAKGAMALFG----DKYGDVVRVVEVPGFSVELCGGSHVGNTAFIGSFRLTS-EAGIGSGVRRIEAITGRAALDAAK 278
153 2.000e-80UniRef50_A0A259DPT4 Uncharacterized protein n=1 Tax=Thiotrichales bacterium 17-46-47 TaxID=1970602 RepID=A0A259DPT4_9GAMM  ali  20  5LRKAIVAHHSATHLLHAALREVLGAHVEQKGS-LVNADGLRFDFSHGEPITAEQMMRVEAIINVNVMRNLPVVIEQMSIDAAKAKGAMALFG----EKYGDVVRVVDMGDASIELCGGIHVQRTGEIGFIKVVSD-GAVASGIRRVEAVAGVKALAYVQ 157
154 2.000e-80UniRef50_A0A254QS81 Alanine--tRNA ligase (Fragment) n=1 Tax=Armatimonadetes bacterium Cent15-Ar3 TaxID=1987502 RepID=A0A254QS81_9BACT  ali  24  113.RSKTQRHHTATHLLQASLRHHLGTSVNQAGS-YNGPDNLRFDFTHGKALSQEEISKVEQTVNEEILKNTTVVTYDLPIAEAKAKGAMALFG----EKYGDKVRMVEIGEFSKELCGGTHVRTTGEIGLFKIVS-ESSAASGVRRIEAVCGEAAYALV. 264
155 2.000e-80UniRef50_A0A2E4QC56 Alanine--tRNA ligase n=1 Tax=Legionellales bacterium TaxID=2026754 RepID=A0A2E4QC56_9GAMM  ali  20  547VRNQTMKNHTATHILHAALRSILGEGVFQKGS-LVEPNRLRFDFSHGSALSQQQINSVEQWVNACIQQNLDVMSQEMPLEVAKEKGVMALFD----EKYDDQVRVLSIGSVSHELCGGTHVDNTGSIGYFKVIS-ESSVASGVRRIEAVTGLGAYRWLD 699
156 2.000e-80UniRef50_A0A127SBB0 Alanine--tRNA ligase n=9 Tax=root TaxID=1 RepID=A0A127SBB0_9BACT  ali  19  66LRAATMRNHSVTHLMHHALHTVLGEHVQQKGS-LVNAERTRFDFTHNAPVTPAQIAQIEALVNAEILANTATAARVMDIEAAKATGAMMLFG----EKYGETVRVLDIG-TSRELCGGTHVQRTGDIGLFKIV-AESGVAAGVRRVEAVTGLNALTYLQ 217
157 2.000e-80UniRef50_A0A2I0MZK1 Alanine--tRNA ligase n=1 Tax=Clostridiaceae bacterium JG1575 TaxID=1658742 RepID=A0A2I0MZK1_9CLOT  ali  22  557.RLSIARNHTATHLLHRALKKVLGDHVQQAGS-LVEADKLRFDFNHFSPLTVEELQAVEDEVNGQILAAQPVTTKVMSLEEAKACGAMALFEA----KYGENVRVVCAGEESVELCGGTHVKNTGEIGSFLIVS-ETGIAAGIRRIEALTGRQSL.... 704
158 2.000e-80UniRef50_A0A2V9LZF8 Alanine--tRNA ligase n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V9LZF8_9BACT  ali  21  633.RDAIRRNHTGTHLLHAALRTVLGTHVKQAGS-LVAPDRLRFDFSHYAALSEQDRLDIEDLVNEHVLKNEEVVTNVMELDKAVESGAMALFG----EKYGDQVRVVSIGSFSKELCGGTHVRRTGDIGLFKIIS-ESSVSAGTRRVEALTGTGVLGYL. 785
159 2.000e-80UniRef50_R5Z9V8 Alanine--tRNA ligase n=2 Tax=Coriobacteriia TaxID=84998 RepID=R5Z9V8_9ACTN  ali  18  176.RGFLRRNHTATHLLDAALKQVLGEHVSQAGS-LVTPEHLRFDFTHFEALSSEQLKAVEDLVNQQIFASKPVVTRVMGIDEAKAAGAVALFG----EKYGDVVRVVSVGPFSRELCGGTHAANTAEIGLFKIIS-ESSTGSNVRRIEAVTSKGALDYM. 330
160 2.000e-80UniRef50_K0VCB0 Alanyl-tRNA ligase (Fragment) n=2 Tax=Rhizobiales TaxID=356 RepID=K0VCB0_9RHIZ  ali  24  55.RSRLRANHSATHLLHEAMREVLGTHVAQKGS-LVAPERLRFDVSHPKPMSAEELKVVEEMANEIVLQNAPVTTRLMSVDDAIAEGAMALFG----EKYGDEVRVVSMGPYSVELCGGTHVSATGQIGLVRILG-ESAVGAGVRRIEAVTGESAREYL. 215
161 3.000e-80UniRef50_A5UY81 Alanine--tRNA ligase n=7 Tax=Chloroflexi TaxID=200795 RepID=SYA_ROSS1  ali  20  562.RAAIMRNHTATHLLHRALRDVLGEHAAQAGS-LVAPDRLRFDFTHTRPLTPEQLHEIERRVNAWIRADTPVVWQELSYQAAIEAGAIALFG----EKYGDVVRMVTIGGFSRELCGGTHVGRSGEIGLFRIIS-ESSVAAGVRRIEALTGPEAEAWVD 735
162 3.000e-80UniRef50_A0A2N1UH79 Alanine--tRNA ligase n=4 Tax=unclassified Bacteria TaxID=2323 RepID=A0A2N1UH79_9BACT  ali  20  554.RRATMRNHTATHLLHKALQQVLGDHVKQAGSM-VSPDRLRFDFTHFAGISAADLEKIETLVNQQILAAHNVHVDEKSYEEALKTGAMALFG----EKYGDRVRIISVGNYSKELCGGTHIGNSAEIGLFSIAS-ESSIAAGVRRIEAVTGESSLD... 702
163 3.000e-80UniRef50_A0A1V4R6Q4 Alanine--tRNA ligase (Fragment) n=1 Tax=Candidatus Cloacimonas sp. 4484_143 TaxID=1956164 RepID=A0A1V4R6Q4_9BACT  ali  21  78.RMDIARNHTVTHILHKALKSVLGEHIQQKGSYL-HPDHLRFDFTNFKQVDRHELDIIERAVNAEIRKCMPVTTEVKNIEDAKKEGAVALFG----EKYGETVRVVSIGDYSKELCGGTHIRFTGEIGLFKITS-ESSIAAGIRRIEAITGVQAEKYVK 229
164 3.000e-80UniRef50_A0A2V8T2U2 Uncharacterized protein n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8T2U2_9BACT  ali  24  42.RRRIKANHTGTHLLHAALREVLGPHVKQAGS-LVAPDRLRFDFTHYAPLGEDEIAEIERLVNGEVLHNRALETQVKPLEEALKSGAMALFG----EKYASDVRVVSVPGFSTELCGGTHVQATGDIGPLKIISD-SSIAAGVRRIEAITADAAIARFQ 193
165 3.000e-80UniRef50_A0A2E8GEE1 Alanine--tRNA ligase n=7 Tax=Bacteria TaxID=2 RepID=A0A2E8GEE1_9BACT  ali  21  563.RFDTMRNHTATHLLHAALREILGTHAKQLGS-LVAPDRLRFDFSHIAPLTESERDDAEHLVNEWIRENIAVQPQEMSKDEAIARGALAFFG----DKYGEKVRMVKIGDASKELCGGTHCKRTGDIGAFRLIN-ETGIAAGVRRLEAVTGQGADDYAK 714
166 4.000e-80UniRef50_A0A0E4G9K8 Alanine--tRNA ligase n=4 Tax=Firmicutes TaxID=1239 RepID=A0A0E4G9K8_9FIRM  ali  23  559.RMDISRNHTATHLLHQALRMTLGEHAQQKGS-LVEPERLRFDFSHLQALNEEDLQKIEGIVNEAILEMYDVNSSQKSLEQARKMGATALFG----EKYGDEVRVVEVDDFSKELCGGAHVNNTGQIGLFKIIS-EGSVGSGLRRIEAMTGRHALAYL. 709
167 4.000e-80UniRef50_A0A109KQ59 Alanine--tRNA ligase n=258 Tax=Bacteria TaxID=2 RepID=A0A109KQ59_PSEFL  ali  21  552VRHATALNHSATHLLHAALRQVLGEHVQQKGS-LVDSQRLRFDFSHFEAIKPEQIKALEDIVNAEIRKNTPVETEETDIETARNKGAMALFG----EKYGDEVRVLSMGGFSVELCGGIHANRTGDIGLLKIIS-EGGVASGVRRIEAVTG........ 697
168 4.000e-80UniRef50_A6TQZ4 Alanine--tRNA ligase n=31 Tax=Firmicutes TaxID=1239 RepID=SYA_ALKMQ  ali  20  559.RHNTERNHTATHLLHKALKGIIGEHVEQAGS-LVTPEKLRFDFSHFEGLSSADLSKVELEVNQEILNALNVDTVEASLEEAKKMGAMALFG----EKYGDDVRVVKTGDYSVELCGGTHVKNSSEIGTFLILS-ETGVAAGVRRIEAVTGQEAYHHIK 710
169 4.000e-80UniRef50_A0A1G0E435 Alanine--tRNA ligase n=1 Tax=Gammaproteobacteria bacterium GWE2_37_16 TaxID=1798261 RepID=A0A1G0E435_9GAMM  ali  23  646.RTAIKLNHSSAHLLHRALQEVLGDHATQRGS-LVDAKKLRFDFAHFSALTTEELHKIESIVNAQIRANLIVKTTIMSLEEAKKAGAVALFG----EKYGDKVRVVKMGDFSSELCGGTHVNQTGEIGILQITS-ESGVASGIRRIEAITGANALEWI. 796
170 4.000e-80UniRef50_A0A0S8HAJ6 Alanine--tRNA ligase n=4 Tax=Gemmatimonadetes TaxID=219685 RepID=A0A0S8HAJ6_9BACT  ali  22  554.RRDTQRNHTATHLLHAALRTVLGEHVTQAGS-LVAPDRLRFDFTHSGPMSEGELEEVERLVNEQIWADKEVMKQFVPYRDAIDRGAMALFG----EKYGDRVRVVEVPGFSLELCGGCHVKTTGEIGLFRIVS-ETGSAAGVRRIEAVTGSHAYARVK 705
171 4.000e-80UniRef50_A0A2H5Z8A6 Alanine--tRNA ligase n=4 Tax=Bacteria TaxID=2 RepID=A0A2H5Z8A6_9BACT  ali  23  554.RAAIRRNHTATHLLHAALRRVLGEHALQAGS-LVAPDRLRFDFAHHEAVQPDQLRTIEELVNEQIVRDLPVEVRYQPLREALSEGAIALFG----EKYGEIVRVVSIDAFSKELCGGTHVSRTGEIGYFLIT-DETSVASGIRRIEALTGPAAVRA.. 703
172 4.000e-80UniRef50_Q129G8 Alanine--tRNA ligase n=59 Tax=root TaxID=1 RepID=SYA_POLSJ  ali  23  560VRAATVRNHSATHLMHKALREVLGEHVQQKGS-LVNAERTRFDFAHNAPVTDDQIREIEARVNAEILSNVATDASVMDMEAAQKTGAMMLFG----EKYGDKVRVLSIGS-SKELCGGTHVTRTGDIGLFKIV-AESGVAAGVRRVEAVTGENALAYLQ 711
173 4.000e-80UniRef50_A0A1G1IT55 Alanine--tRNA ligase n=1 Tax=Omnitrophica bacterium GWA2_41_15 TaxID=1801814 RepID=A0A1G1IT55_9BACT  ali  25  542.RLDIRKNHTATHLLHNALRKVLGLHVKQAGSM-VAPERLRFDFTHFKRVTDEELFMIEDIVNESIRKDSAVRIDELSLEEASKRDVIALFG----EKYGDVVKMVSVGDYSRELCGGTHVTRTGEIDIFKIVS-ESSIASGVRRIEAITSKPAYEKIK 693
174 5.000e-80UniRef50_P61698 Alanine--tRNA ligase n=13 Tax=Proteobacteria TaxID=1224 RepID=SYA_BDEBA  ali  23  574.RRNTAANHSATHLLHAALRKVLGTHVTQAGS-LVDSQKTRFDFTHNKPVSSEEIKKIEDLVNEQIARCNPVQTEMMSHKAALEKGAMALFG----EKYASDVRVLTMGDFSCELCGGTHVKNTSEIRLFKIVS-EAGVSSGVRRIEAITADNALQYM. 724
175 5.000e-80UniRef50_A0A1V6ALH8 Alanine--tRNA ligase n=2 Tax=unclassified Firmicutes sensu stricto (miscellaneous) TaxID=84086 RepID=A0A1V6ALH8_9FIRM  ali  19  548.RKSTERNHTATHMLQYALREVLGNHVHQAGS-YVDQHKLRFDFTHFSAMDDDQIKKVQDIVNSIILEDIDVFKEVMDIDTARKKGATALFG----EKYSNTVRVISINPYSMELCGGTHIARTGEAGMFKIIS-ENAVASGVRRIEALTGTNTYDYMQ 699
176 5.000e-80UniRef50_A0A1C6JER5 Alanine--tRNA ligase n=5 Tax=Firmicutes TaxID=1239 RepID=A0A1C6JER5_9FIRM  ali  25  556.RHATARNHTATHLLQKALRDVVGSHVEQAGSS-VNENMLRFDFTHFEGVTPEQLEQVEELVNQKITEFLPVDICETSMKHAQEMGAMALFG----EKYGEEVRVVSCGDWSVELCGGTHVANTGQIGALKIVS-ESGVASGVRRIEAVTGTGVL.... 703
177 5.000e-80UniRef50_A0A2E5GYN6 Alanine--tRNA ligase n=15 Tax=Bacteria TaxID=2 RepID=A0A2E5GYN6_9BACT  ali  24  561VRSNTQRNHTATHLLHAALRETLGQHVVQRGS-LVAPDRLRFDFTHDAPITDEECARIEERVNQAIWSNHQLNIEDRLYSEALEAGAMALFG----EKYSEVVRVVEIEGISQELCGGTHVNSTGEIGLFKIMS-ETGVASGVRRIEACTGPGAMQHME 713
178 6.000e-80UniRef50_I3IHG8 Alanine--tRNA ligase n=22 Tax=root TaxID=1 RepID=I3IHG8_9BACT  ali  23  561.RNDIRKNHSATHILHYALRRVIGQHAEQAGS-LVAPDRIRFDFHHFSALTKEEITRIEDLVNEKILENVPVSAKELTIQQAKNAGALALFG----EKYGELVRMLSMGDYSKELCGGTHVDSSGEIGLFRIVS-ESSVAAGIRRIEAVTGMSTLK... 709
179 6.000e-80UniRef50_UPI000A07A116 alanine--tRNA ligase n=2 Tax=Gammaproteobacteria TaxID=1236 RepID=UPI000A07A116  ali  23  526.RAAISLNHSATHLLHAALRQVLGEHVAQKGS-LVKAENLRFDFSHLEAVTAAELKEVERLVNAQIRRNHAIETNIMDIESAKQKGAMALFG----EKYDDEVRVLSMGDFSTELCGGIHASNTGDIGLFKITS-EGGIAAGIRRIEAVTGEAA..... 672
180 6.000e-80UniRef50_UPI00061BCB57 alanine--tRNA ligase n=1 Tax=Streptococcus pneumoniae TaxID=1313 RepID=UPI00061BCB57  ali  23  866.RHRVMKNHTATHLLHAALHNILGNHATQAGS-LNEVEFLRFDFTHFQAVTAEELRAIEQQVNEKIWEALEVKTVETDIDTAKEMGAMALFG----EKYGKEVRVVTIGDYSIELCGGTHVGNTSEIGLFKIVKEE-GIGSGTRRILAVTGKEAFEAY. 1016
181 6.000e-80UniRef50_A0A1Y1RGI4 Alanine--tRNA ligase n=1 Tax=Candidatus Cloacimonetes bacterium 4572_55 TaxID=1971726 RepID=A0A1Y1RGI4_9BACT  ali  22  557LRRASMRNHTATHLLHGALHQVLGNHAQQAGS-LVSPDYLRFDFTHYEQVKSHQLEEIKAIVNEHTLRNEPVRWKYCSLDEARRDGAMALFG----EKYGDTVRVVRIGDFSMELCAGTHLSSTGGIGLFVITS-EGGIAAGVRRIEALTGEAAYQYF. 708
182 6.000e-80UniRef50_A0A2E3HXI5 Alanine--tRNA ligase n=7 Tax=unclassified Bacteria TaxID=2323 RepID=A0A2E3HXI5_9BACT  ali  28  564.RQKIALSHTATHILHNALRKVLGDHVSQAGS-LVEPERLRFDFTHYEAVSSSQIREIEAFVNQKIRTNSQIAIAEMPLQEAKDRGALAFFG----DKYGDIVRMVEIGDYSIELCGGTHINTTGEIGLVKIIS-ESSIAAGTRRIEALTGESAY.... 711
183 7.000e-80UniRef50_A0A1F4NCM7 Alanine--tRNA ligase n=31 Tax=root TaxID=1 RepID=A0A1F4NCM7_9BACT  ali  21  557.RFLTMYNHTSTHLLHEALRRVLGKHVEQAGS-LVSPDRLRFDFTHYKKIEREELFLIESIVNEQIRRNSPLDIFYTDFNKAKEMGARALFG----EKYSDQVRVVIVDDFSKELCGGTHVSHTGQIGSFIIL-QETSIASGVRRIEAITGPRAVEFAQ 708
184 7.000e-80UniRef50_B6Y943 Alanine--tRNA ligase n=12 Tax=Wolbachia TaxID=953 RepID=B6Y943_9RICK  ali  21  552.RQDLRRNHSATHLLHFALRKILGDHVTQKGS-LVAPNRLRFDFSHNKPVTQDQLSSVEDIVNSLIRENLSTSTKVQGMDEAIDEGAMALFG----EKYGDNVRVVKIGD-SKELCGGTHVERTGEIGLFKI-AAECSVASRVRRIEALTGQEAINYV. 701
185 8.000e-80UniRef50_A0A2M6GIC8 Alanine--tRNA ligase (Fragment) n=1 Tax=Cytophagales bacterium CG18_big_fil_WC_8_21_14_2_50_42_9 TaxID=1973956 RepID=A0A2M6GIC8_9  ali  24  49.RNLIRKNHSATHLLHAALKQVLGSHVNQKGS-LVSEKLLRFDFSHFTKVTADQLREIESIVNERIRQNIPLEQRNVPLEEAKALGAMALFG----EKYGNFVRVITFDNFSVELCGGIHVPGTGEIGFFKIT-AESSVAAGVRRIEAVTAIGAEEYVQ 202
186 8.000e-80UniRef50_A0A1F2RRQ8 Alanine--tRNA ligase n=1 Tax=Acidobacteria bacterium RIFCSPLOWO2_02_FULL_60_20 TaxID=1797179 RepID=A0A1F2RRQ8_9BACT  ali  21  608.REATKRNHTATHLLHAALRQVLGTHVKQAGSV-VEPGRLRFDFSHFASVSEDELQEIEKLANDEIVKNIAVETAVMELDQALETGAMAFFG----EKYPDRVRVVAVPGFSKELCGGTHVSRTGDIGLLKIT-HEGSISAGVRRVEAISGQGALEDYQ 759
187 9.000e-80UniRef50_A0A2S7URZ4 Alanine--tRNA ligase n=1 Tax=Psychrosphaera saromensis TaxID=716813 RepID=A0A2S7URZ4_9GAMM  ali  20  555.RDAIKQNHSATHLLHAALRTVLGDHVGQKGS-LVEADKFRFDFSHYEGVTAAQLQQAERLVNEQIQQNHDLTTDLMQIDAAKEKGAMALFG----EKYDDEVRVVSMGPSSIELCGGTHVSRTGDIGLCKIIS-EAGIAAGIRRIEAVTGMAAIEAL. 705
188 1.000e-79UniRef50_A0A1F2QPM2 Alanine--tRNA ligase n=8 Tax=unclassified Acidobacteria (miscellaneous) TaxID=305072 RepID=A0A1F2QPM2_9BACT  ali  21  564.REATMRNHTGTHLLHAALRQVLGPHVKQSGS-LVAPDRLRFDFSHYAALDPEELKEIERLANQAILRDAPVSEERMDIDAALKSGALAFFGDKYPEK---NVRVITVADFSKELCGGTHVRHTGQIGVLKITS-ESSIAAGVRRVEALTGAGALEQYQ 723
189 1.000e-79UniRef50_A0A2G6EZG4 Uncharacterized protein n=1 Tax=Fusobacteriales bacterium TaxID=2044942 RepID=A0A2G6EZG4_9FUSO  ali  22  44IRKDIAKNHAATHLLHKALKEVVGAHVQQAGS-LVDDEKLRFDFSHYEGLTEEQILKIEEIVNEKIRENIEISVQYCSMDEAKKLGATMLFG----DKYGDVVRVVTVKDFSIELCGGTHIDNIGKIGLFKIIS-EGGIAAGVRRIEAKTGYGAF.... 193
190 1.000e-79UniRef50_A0A1E3YH53 Alanine--tRNA ligase n=4 Tax=unclassified Acidobacteria (miscellaneous) TaxID=305072 RepID=A0A1E3YH53_9BACT  ali  22  575VRDATRRNHTATHLLHAALRARLGTHVRQKGS-LVAPGRLRFDFDHFQPMTAEDRLEVERAVNAQVYRDTPVVTEEKSTDEAVKAGAMALFG----EKYGDRVRVVQIAGYSTELCGGTHVRATGEIGPFVLT-EETGVAAGIRRIEALTGAEAVTYLQ 727
191 1.000e-79UniRef50_A1TRL4 Alanine--tRNA ligase n=8 Tax=Proteobacteria TaxID=1224 RepID=SYA_ACIAC  ali  24  630LRAATMRNHSVTHIMHKALREVLGSHVQQKGS-LVNAERTRFDFAHNAPVTDAQIREIERRVNEEILANTPTGARVMDIESAQKTGAMMLFG----EKYGETVRVLDIG-TSRELCGGTHVARTGDIGLFKVVG-ESGVAAGVRRIEAVTGAGALAYLQ 781
192 1.000e-79UniRef50_X1LPS9 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X1LPS9_9ZZZZ  ali  25  214VRKESARAHTATHLLHAALRRTLGEHARQEGSF-VEPGRFRFDFTHFKPLSDDEINAIENLVNEKILKNLLVEKFNTTLNEAKKLGAMAIFG----EKYGNEVRVVKISDYSIELCGGIHLDNTGEIGLFKIVSQEAA-AAGIRRVEAIVGLRLFEYL. 365
193 1.000e-79UniRef50_UPI000829EFAC alanine--tRNA ligase n=2 Tax=Murdochiella TaxID=1161127 RepID=UPI000829EFAC  ali  19  554.REDIRRNHSATHLLHRALREVLGDHVHQAGS-LVEPDRLRFDFTHYQAMTEEEKQNVEKIVNRAIFDSYPVQTRVLPLQEAMAEGAIGLFE----DKYHDAVRVVSMGDFSKELCGGTHVENTAQLQVFTLLS-EQGVSSGVRRIEAVTGRNALQGMK 705
194 1.000e-79UniRef50_Q7MHR6 Alanine--tRNA ligase n=81 Tax=root TaxID=1 RepID=SYA_VIBVY  ali  23  556.RAAISLNHSATHLLHAALRQVLGEHVAQKGS-LVKAENLRFDFSHLEAVTAAELKEVERLVNAQIRRNHTIETNIMDIESAKQKGAMALFG----EKYDDEVRVLSMGDFSTELCGGIHASNTGDIGLFKITS-EGGIAAGIRRIEAVTGEAA..... 702
195 1.000e-79UniRef50_A0A101HUQ4 Alanine--tRNA ligase (Fragment) n=1 Tax=Pelotomaculum thermopropionicum TaxID=110500 RepID=A0A101HUQ4_9FIRM  ali  20  108.RTAVCRNHTATHLLHKALREVLGDHINQAGS-LVDPERLRFDFTHFTAVTAEELQKVESVVNNTILSNLPVEAFETSLDEARAMGAAALFG----EKYGERVRIIKIGEFSLELCGGTHLKSTAEAGLFKLAG-ESSVGAGLRRVEAFTGENALRHVK 259
196 1.000e-79UniRef50_A0A1J5EJW0 Alanine--tRNA ligase n=1 Tax=Fibrobacteres bacterium CG2_30_45_31 TaxID=1805149 RepID=A0A1J5EJW0_9BACT  ali  24  557LRKDTRRNHSATHLLQAALREVLGTHVAQQGS-HVAPEGLRFDFSHFSGMTAEQIAQVEDLVNVQVMATLPITTKVMKLEDAQATGAMALFG----EKYENDVRVVSMGDFSKELCGGLHASNTGEIGMVKIL-AETSVSAGVRRIEAVTGRGALKLL. 708
197 1.000e-79UniRef50_A0A2G6R4R1 Alanine--tRNA ligase (Fragment) n=1 Tax=Draconibacterium sp. TaxID=1965318 RepID=A0A2G6R4R1_9BACT  ali  25  34.RDDIKKNHSATHLMHFALRQVLGDHVQQKGS-LVTDSHLSFDFSHFQKMTDEEIAAVEAIVNELIRKNSTLNEEQLPIEEAKKRGAMALFG----EKYGDIVRLIQF-DKSVELCGGTHVSATGEIGAFKITS-ESSIASGVRRIEAVTGRGAMDFFD 184
198 1.000e-79UniRef50_A0A1V5CPZ6 Alanine--tRNA ligase n=10 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A1V5CPZ6_9DELT  ali  23  559.RKGVSRNHTATHLLHYALRTVLGEHVKQSGS-LVERDRLRFDFTHFQGLTDDELQKAEDIVNEKIMESINVTTEERQKEDAIREGATALFE----EKYGDTVRVLKIGDFSTELCGGTHVKNTGEIGSFYIVS-EGSLAYGVRRIEAVTGKGAVLY.. 708
199 1.000e-79UniRef50_X1A8Q6 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X1A8Q6_9ZZZZ  ali  25  156.RLAAARNHTATHLLQGSLKKVLGKHVRQTGSF-VSFDRLRFDLTHFAPLTDEQLSRVEEMVNEKIRENIKIEAKMMDFGEAKKRGAIFLAG----EKYGRKVRTIKIGDFSLELCGGTHVKATGEIGLFKLVS-ESGVAAGVRRIEALTGKGACRFVK 307
200 2.000e-79UniRef50_A0A2E3UTB6 Alanine--tRNA ligase n=1 Tax=Zetaproteobacteria bacterium TaxID=2026807 RepID=A0A2E3UTB6_9PROT  ali  26  587.RHAIMKNHSATHLLHAALKKALGSHVNQQGS-YVGYDRLRFDFTHHKGLSKDELEQIETTVNEKIQENLPVKTDILPLEQAKSSGAEALFG----EKYDDFVRVLSMEDFSHELCGGTHVKATGEIGVFQILS-EVSIAAGIRRVEAITGNVAIKNIQ 738
201 2.000e-79UniRef50_A0A1Z9SWM7 Uncharacterized protein n=1 Tax=bacterium TMED264 TaxID=1986658 RepID=A0A1Z9SWM7_9BACT  ali  17  43.RDKIRNNHTATHLLHKALKNILGDHVNQAGS-LVHPDYLRFDLTHFEKITKNQIAEVENMVTDQILENKKLEVSIKSFDDAKIQGAEALFG----EKYGEEVRVIKVGEYSMELCGGTHVNRTGDIGMFKIT-EESSLASGVRRIVALTGSDALEEIQ 194
202 2.000e-79UniRef50_A0A2H5YR49 Alanine--tRNA ligase n=9 Tax=Bacteria TaxID=2 RepID=A0A2H5YR49_9BACT  ali  22  555.RAAIKRNHTATHLLHAALRQVLGEHAQQAGS-LVAPDRLRFDFTHLEALKPEQLRAIQELVNEHVLRDEPVLAEYKPFREAIAEGAIALFG----EKYGELVRVVSIPGFSKELCGGTHVNHTGEIGLFLIT-DESSVASGVRRVEAITGMRSAEF.. 704
203 2.000e-79UniRef50_A0A1J4Z7A3 Alanine--tRNA ligase n=3 Tax=unclassified Candidatus Omnitrophica TaxID=1047005 RepID=A0A1J4Z7A3_9BACT  ali  21  532.RLDIARNHTATHLLHGALRKTLGEHVHQAGS-LVASERLRFDFAHFKALTPEQIKRVEELVNQDIQKDFAVSTKEMDLKEANKSGAQALF----TEKYSDTVRVVSAGDNSRELCGGTHLENTGAIESFKIIS-ESSVSAGMRRIEAVTGIFVSDVIK 683
204 2.000e-79UniRef50_A0A2N2H125 Alanine--tRNA ligase (Fragment) n=1 Tax=Deltaproteobacteria bacterium HGW-Deltaproteobacteria-21 TaxID=2013749 RepID=A0A2N2H125_9  ali  22  247.RRAIALNHTATHLLHAALREILGDHVKQAGS-YVGPERFRFDFSHFTQVGSEQLREVENMVNAYIRQNHSLAVQELPRDEAMKTGAMAIFE----ERYGERVRIVSVGDVSKELCGGTHTDRTGDVGIFKIVS-ESAVGANVRRIEALTGGAALEYVQ 399
205 2.000e-79UniRef50_A0A0W8FYS6 Alanyl-trna synthetase n=1 Tax=hydrocarbon metagenome TaxID=938273 RepID=A0A0W8FYS6_9ZZZZ  ali  25  516.RWDIMRNHSATHFLHKALREVLGNHVQQSGS-YVGPDRLRFDFTHFEKVKSEELEQIEKIVNQKLLQNIPIHHKDTPFEEAKMMGALMFFG----DKYGDKVNVVQFGDYTMEFCGGTHVNNSSQIGLFKIIS-ESSIASGVRRIEAITGHGVEEF.. 666
206 3.000e-79UniRef50_A0A257BA03 Alanine--tRNA ligase n=1 Tax=Chloracidobacterium sp. CP2_5A TaxID=2012633 RepID=A0A257BA03_9BACT  ali  25  556.RRRTMLNHSATHLLHAALREVLGAHVKQAGSE-VAPDKLRFDFTHYAALSPDEIAEIERLVNAQIRRNASLAKREMPLDAAVAAGAMALFG----EKYGDVVRVVEVPGFSLELCGGTHVAATGDIGLFKIAS-ESSIAAGVRRIVAVTGEAAFERFQ 707
207 3.000e-79UniRef50_UPI00047BAC1B alanine--tRNA ligase n=1 Tax=Geothrix fermentans TaxID=44676 RepID=UPI00047BAC1B  ali  25  562.RRRVRAHHTATHLLHAALREVLGTHVKQAGSV-VDEQHLRFDFTHFAPLEADQIAEIERLATRQALNSVPTRVKEMDIEEALASGAMALFG----EKYGDVVRVVQVPGFSTELCGGTHVANTGEIGVVKIVS-ESAVAAGVRRIEAVAGELALELLQ 713
208 3.000e-79UniRef50_A0A2K9NMD2 Alanine--tRNA ligase n=3 Tax=Oligoflexia TaxID=1553900 RepID=A0A2K9NMD2_9PROT  ali  24  559.RALTMRNHSATHLLQSALIKVLGAHVKQAGSV-VTSEKLRFDFTHLQAMTKEEIQKVEDLVNQEIQKAHSVSADHMSMDEAQKKGAMALFG----EKYGNVVRVLTMGDFSTELCGGTHVRNTGDIGLITILS-ESSLATGVRRIEATTSETAVNYL. 709
209 3.000e-79UniRef50_UPI0008EC6520 alanine--tRNA ligase n=1 Tax=Peptostreptococcaceae bacterium pGA-8 TaxID=1520829 RepID=UPI0008EC6520  ali  25  547.RNSTARNHTATHLLQKALREVIGSHVEQAGSS-VNENMLRFDFTHFESVKEEELFMIENLVNQKIAEFLPVKVAEMSMDEAKAQGATALFG----EKYGDTVRVVNSGNWSIELCGGTHVANTGEVGVFKILS-ESGIASGVRRIEAITGIGVLNRL. 697
210 3.000e-79UniRef50_UPI00025565AC alanine--tRNA ligase n=1 Tax=Succinivibrionaceae bacterium WG-1 TaxID=758828 RepID=UPI00025565AC  ali  21  277.RKQTCANHSATHLLQAALRKVLGDHVAQKGSS-VNSEHLRFDFSHGEPLTQEQLDLVEQMVNAEICKNVPVITKVMDLESAKSLGAMALFG----EKYDATVRVVSMEDFSCELCGGTHVTATGDIGLLKIVSD-TGIAAGVRRIEAVTNKGAVLYVQ 428
211 3.000e-79UniRef50_A0A2E8Q5H2 Alanine--tRNA ligase (Fragment) n=1 Tax=Nitrospinae bacterium TaxID=2026769 RepID=A0A2E8Q5H2_9BACT  ali  23  355.RQATALNHTATHLLQAALKEVLGDHVKQAGS-LVEKNRFRFDYTHFSPLTSREKEKIEEIVNQKIMENIPVQKKTMPIDEAIKEGATAIFG----EKYGDEVRVVNVEGFSKELCGGTHVNATGEVGFYRIVS-EGGIAAGGRRIEAITGKKAFQRTK 506
212 3.000e-79UniRef50_A0A2M9A8X9 Alanine--tRNA ligase n=13 Tax=Fibrobacteraceae TaxID=204431 RepID=A0A2M9A8X9_9BACT  ali  21  556LRDDIRANHSATHLLQAALRQVLGSHVAQQGSR-VEPGFLRFDFSHFQAMTKEEIQQVEDIVNDKIRATLPVNTDVMDVDAAKASGAMALFG----EKYGEEVRVVKMGEFSKELCGGLHVKNTGAIGMFKIVS-EASVSSGVRRIEALTGRGAMALF. 711
213 4.000e-79UniRef50_A0A2A5G1J0 Alanine--tRNA ligase n=1 Tax=Flavobacteriales bacterium TaxID=2021391 RepID=A0A2A5G1J0_9FLAO  ali  25  624.RLLTESNHSATHLLHQALREILGEHVQQKGS-LVHPDYFRFDFSHFQKVTDEELAKIEALANQRIRENIELEKQNTPMEEAKKMGAMALFG----EKYGDTVRVIQFGE-SIELCGGCHVSATGKIGLFKITS-ESAIAAGIRRIEAITAETAEKYV. 774
214 4.000e-79UniRef50_A0A2H5XE92 Alanine--tRNA ligase n=1 Tax=bacterium HR17 TaxID=2035412 RepID=A0A2H5XE92_9BACT  ali  21  572.RQALRRAHTATHLLHAALRNILGEHVFQAGSV-VEPDRLRFDFTHPKPLTPEETQAIEDAINRHILAAYPVEPFETSLHEARAMGAMALFG----EKYGERVRVIKIDGVSVELCGGTHLANTAEIGLLKIVS-ETSVGANIRRIEAYTGERARRWYE 723
215 4.000e-79UniRef50_A0A1F3RUS7 Alanine--tRNA ligase n=3 Tax=unclassified Bdellovibrionales TaxID=404130 RepID=A0A1F3RUS7_9PROT  ali  19  587IRALTARNHTATHILHWALREVLGKHVKQSGS-LVGPELLRFDFSHFQAMTEQELTRVENLVNERVWGGEAVLKKEMNKEEAIASGAIAFFG----EKYGDTVRVIKVGGFSTELCGGTHVDHSSDIHLFKIAN-ESGIAAGVRRIIAYTSKGAFEYL. 738
216 4.000e-79UniRef50_Q8RFJ8 Alanine--tRNA ligase n=92 Tax=Bacteria TaxID=2 RepID=SYA_FUSNN  ali  19  549.RLDTAKNHTATHLLHKALREIVGTHVQQAGS-LVDSEKLRFDFSHYEALTEEQLSKIEDIVNKKIREGIEVVVSHHSIEEAKKLGAMMLFG----DKYGDVVRVVDVHGFSTELCGGTHIDNIGKIGLFKITS-EGGIAAGVRRIEAKTGYGAY.... 696
217 4.000e-79UniRef50_A0A1F5RIB5 Alanine--tRNA ligase n=1 Tax=Candidatus Edwardsbacteria bacterium GWF2_54_11 TaxID=1817851 RepID=A0A1F5RIB5_9BACT  ali  21  560.RLSTARHHTATHLLQAALQQVVGKHVQQQGSM-VSPEHLRFDFTNFAALDPMQLDEVEHLVNRKIMDNIPVTDQHMKLAEAQKTGAMALFG----EKYGEEVRVISCGDFSKELCGGTHVKHSGELGLFKIVREE-AIASGVRRIEAVTGEAAYRLAK 711
218 4.000e-79UniRef50_A0A2H0LVI2 Alanine--tRNA ligase n=6 Tax=unclassified Candidatus Omnitrophica TaxID=1047005 RepID=A0A2H0LVI2_9BACT  ali  21  537.RLDTARNHTATHLLQASLRKVLGGHVRQQGSF-VCEEYLRFDFTHFKALNKEEFFRVEEMVNQYIRDNDLVSKEEMTFLKAREAGALAFF----AEKYADKVRVVSCGDYSKELCGGIHLDNTGQIGLFKIVS-ESSISSGIRRIEALTGKHAYKKLQ 688
219 5.000e-79UniRef50_A0A0U0K4Z4 Alanine--tRNA ligase n=4 Tax=Streptococcus pneumoniae TaxID=1313 RepID=A0A0U0K4Z4_STREE  ali  23 1108.RHRVMKNHTATHLLHAALHNILGNHATQAGS-LNEVEFLRFDFTHFQAVTAEELRAIEQQVNEKIWEALEVKTVETDIDTAKEMGAMALFG----EKYGKEVRVVTIGDYSIELCGGTHVGNTSEIGLFKIVKEE-GIGSGTRRILAVTGKEAFEAY. 1258
220 5.000e-79UniRef50_C2KVV6 Alanine--tRNA ligase n=2 Tax=Oribacterium TaxID=265975 RepID=C2KVV6_9FIRM  ali  20  218.RALTARNHTATHLLQKALKETLGSHVEQAGAYY-DDKRLRFDFTHFTALTKEELEKVENLVNEEIARADVVLTREMPIEEAKKSGATALFG----EKYGDTVRVVSVGDFSIELCGGTHVENSSSIQAFKILS-EQGVAAGVRRIEAITSQNLFDYF. 368
221 5.000e-79UniRef50_D9PFR3 Alanyl-tRNA synthetase (Fragment) n=1 Tax=sediment metagenome TaxID=749907 RepID=D9PFR3_9ZZZZ  ali  20  115VRMQTAKHHSATHLLHAALREILGSHIAQAGS-LVEENRLRFDFSHPQALNNEELDMIEAWVNDKIDKSIPSITNVMDIQSAKDKGAMALFG----EKYGDEVRVVEFSDSSIELCGGIHVENSSQIGQFIILK-ESGVSAGVRRIEAICGKEAINF.. 265
222 5.000e-79UniRef50_A0A2N2KRZ5 Alanine--tRNA ligase n=3 Tax=unclassified Candidatus Cloacimonetes TaxID=1047068 RepID=A0A2N2KRZ5_9BACT  ali  21  549.RKDVARNHTATHLLHKALRNVLGTHVQQKGS-LVNSDYLRLDFTHFKGLSHDELKAVEQSVNIAILDNLTLNTTIQSIESAKSDGAMALFG----EKYSDEVRVVNVEGFSKELCGGTHVNATGEIGLFKIIS-ESSSAAGIRRIEAYTGKSALAYID 700
223 5.000e-79UniRef50_U2E7V8 Alanine--tRNA ligase protein n=5 Tax=Gammaproteobacteria TaxID=1236 RepID=U2E7V8_9GAMM  ali  19  66.RQAIELNHTATHLLHAALRETLGTHVRQKGSM-VAPDRLRFDFAHFESVTPETLADIEAQVNARVRENIQGQFYTRSYDDAIAEGALAFFG----EKYGDEVRVVRFGDYSVELCGGTHVPASGAIGLVKIT-EERGVAAGVRRLEAVTGAHALKWVQ 217
224 5.000e-79UniRef50_D8K228 Alanine--tRNA ligase n=11 Tax=Chloroflexi TaxID=200795 RepID=D8K228_DEHLB  ali  23  551.RYDTARNHTATHLLQAALIEVLGEHIQQRGSV-VAPDRLRFDFSHLKAVTPEELIRVEAIVNERIRENHPVTAAETGYRDALKSGVTALFG----EKYGETVRVLSIGSVSAELCGGTHIRATGEIGYFKIIS-ESSVGAGLRRIEAVTGRGAEAWL. 704
225 6.000e-79UniRef50_Q8KG04 Alanine--tRNA ligase n=28 Tax=Bacteria TaxID=2 RepID=SYA_CHLTE  ali  22  562.RVATERNHTATHLLHAALRKVLGEHVQQKGS-LVTPERLRFDFSHFSKVSAEELEQVEHEVNAEIRKAASVTKHDVPYEEALALGALAFFG----DKYADRVRVVEVPGISIELCGGTHVGNIGQIGMVKIVS-ESSVAAGIRRIEAVTGAAAEALL. 713
226 7.000e-79UniRef50_A0A2E5UKH1 Alanine--tRNA ligase n=2 Tax=Gemmatimonadetes bacterium TaxID=2026742 RepID=A0A2E5UKH1_9BACT  ali  23  563.RSDIQRNHTATHLLHASLRKALGNHVAQRGS-LVAPDRLRFDFTHDHPMTDEECAKVEEAVNQAIWSNQEVRIEDXAYTDALEAGAMALFG----EKYDEVVRVVEIKDVSMELCGGTHVPKTGEIGLFKIAS-ETGVAAGVRRIEACTGPGAKKHME 714
227 7.000e-79UniRef50_A0A2V8RP16 Alanine--tRNA ligase n=2 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8RP16_9BACT  ali  23  305.RDATRRNHTATHLVHAALKEVLGSHVKQAGSV-VAPNYLRFDFSHYQPMTARELQEVEDLVNRYILQNEPVTTNMMSIEEAMRSGAVAMFG----EKYGSEVRVLSVGTFSKELCGGTHVRATGDIGSFKITSDE-AIASGVRRIRAITGFDAFERF. 457
228 7.000e-79UniRef50_A0A109UMM5 Alanine--tRNA ligase n=12 Tax=root TaxID=1 RepID=A0A109UMM5_9GAMM  ali  22  275LRGATIRNHSATHLMHKALRLVLGDHVQQKGS-LVTPERLRFDFSHFEPMTPEQLAEVERLVNEQILANAATQIEQMTLDQAKERGAAALFEA----KYADSVRVLTIGDFSIELCGGTHVARSGDIGCFHIVS-EQGIASGVRRIEAITGEGALAWF. 428
229 7.000e-79UniRef50_C1A4D2 Alanine--tRNA ligase n=5 Tax=Gemmatimonadetes TaxID=219685 RepID=C1A4D2_GEMAT  ali  21  596.RRDTERHHTATHLLHAALRKVLGDHVHQAGS-LVTPDRLRFDFTHHGPVTAEQLAAIEADVNAGVWQSAPVNTREESYVDAVAHGAMALFG----EKYGDVVRVVEIPSLSVELCGGTHVRNTAEIGLVRVIN-ESGVAAGVRRIEAVSGPRAFQFL. 746
230 8.000e-79UniRef50_D0MIY9 Alanine--tRNA ligase n=24 Tax=Bacteria TaxID=2 RepID=D0MIY9_RHOM4  ali  19  628.RKRIEKHHTATHLLHAALREILGTHVQQKGS-LVAPDRLRFDFSHFERVTPELLRQIEARVNEVIQRNVPIEERDVPYEEAIARGAMALFG----EKYGDRVRVITFPNFSMELCGGTHVAATGELGVFRIIS-EGSVASGIRRVEALAGQDALDWI. 780
231 8.000e-79UniRef50_A0A1V6GZG4 Alanine--tRNA ligase n=28 Tax=Thermotogae TaxID=200918 RepID=A0A1V6GZG4_9BACT  ali  23  556.RRAVARNHTATHLLHAALRAVLGDHVQQAGS-LVEPDRLRFDFSHYEKIRANQVEAIEDWVNERVLMAIPVSIESRSIQEAKAMGAMALFD----EKYKETVRVVRVGTHSLELCGGTHVQNTGEIGLFKILG-ETAISAGMRRIEAITGLTSLAYV. 706
232 9.000e-79UniRef50_A0A2E3A641 Alanine--tRNA ligase n=3 Tax=unclassified Planctomycetes TaxID=473814 RepID=A0A2E3A641_9BACT  ali  21  540.RRATECNHSATHLLHAALREILGEHVHQKGS-LVDPSRLRFDVTHFSGIEPQELQQAQELVNRQVRANLPVEISEMDKDEAIEQGAMAFFG----EKYGDRVRVVRMGDFSVELCGGTHVSRTGDIGFFTLTS-EGSVSSGVRRVEALTAGQAEGWFD 691
233 1.000e-78UniRef50_A0A2H5YAF8 Alanine--tRNA ligase n=4 Tax=Bacteria TaxID=2 RepID=A0A2H5YAF8_9BACT  ali  22  581.RRDTARNHTATHLLHSALRRVLGTHVRQAGS-LVAPDRLRFDFTHVQALTREELQAVERLVNEKVREDLPVRKRETAYLQAIQEGALAFFG----DKYGERVRVVEVANFSLEVCGGTHLDRTGEIGLFLVVS-ESSIGAGVRRIEAVTGRWAEALV. 734
234 1.000e-78UniRef50_A0A1Z8KQU5 Alanine--tRNA ligase n=21 Tax=Bacteria TaxID=2 RepID=A0A1Z8KQU5_9BACT  ali  21  549.RLKIRSNHTATHLLHESLKQVLGNHVQQSGS-LVSDKKLRFDLTHYEKITKNQIKEIESKVNNIIRKNNELSTTIENFDDAKKKGAVALFG----EKYDDKVRVVDIPGFSKELCGGTHVSRTGDIGIFKIIS-ESSLSTGIRRIEALTGEAVLERI. 699
235 1.000e-78UniRef50_A0A0S7YBN4 Alanine--tRNA ligase n=3 Tax=Bacteria candidate phyla TaxID=1783234 RepID=A0A0S7YBN4_9BACT  ali  27  536.RKESARAHTATHLLHAALRKTLGEHARQEGSF-VAPGRFRFDFTHFKPLSNDEITVIEDIINQKILENIPVEKLFMSLDEAKKMGAMAIFG----EKYGDRVRVVKIGDFSIELCGGIHLENTGEIGLLKIMSQEAA-AAGIRRIEAVVGMR...... 681
236 1.000e-78UniRef50_A0A117L9S7 Alanine--tRNA ligase (Fragment) n=2 Tax=Thermotoga TaxID=2335 RepID=A0A117L9S7_9THEM  ali  25  165.RESTMRNHTATHLLHAALKKVLGDHVRQAGS-LVAPDRLRFDFTHFKGLSSAEIEQVEDLVNEWIMEAIPVEVRYTSYEEAVKSGVVALF----TEKYGDVVRVVEVPGVSKELCGGTHVKNTGQIGLFKIISEES-VSSGVRRIEAVTGFSALELL. 315
237 1.000e-78UniRef50_A0A1F2RID4 Alanine--tRNA ligase n=8 Tax=Acidobacteria TaxID=57723 RepID=A0A1F2RID4_9BACT  ali  23  584.RRATMRNHTGTHLLNAALRQVLGTHVKQAGSV-VDADRLRFDFSHFASVSGDELQEIERLANAEIVRNAAVGTEVLELDQALESGALAFFG----EKYPDRVRVVTVPGFSKELCGGTHVSRTGDIGLLKVT-HEGSISAGVRRVEAVTGERALAEFQ 735
238 1.000e-78UniRef50_T0T8E0 Alanine--tRNA ligase n=2 Tax=Streptococcus TaxID=1301 RepID=T0T8E0_9STRE  ali  21  252.RHSVIKNHTATHLLHAALHNVIGEHATQAGS-LNEEGFLRFDFTHFEAVTADELRQIEEEVNQQIWNAIPVVTVETDIDTAKSMGAMALFG----EKYGKNVRVVTIGDYSIELCGGTHVSNTAEIGIFKIVKEE-GIGSGTRRILAVTGKEAFEAY. 402
239 1.000e-78UniRef50_UPI00073E962E alanine--tRNA ligase n=1 Tax=Ruminococcus sp. AT10 TaxID=1720300 RepID=UPI00073E962E  ali  23 1306.RALSARNHSATHLLQKALRTVLGTHVEQAGSS-VNEDRLRFDFTHFSAVKPEELKKVEQIVNEQIENALPVIVKNMPIEEARKTGAQALFG----EKYGDIVRVVDMGGFSIEFCGGTHVKNTSEIMSFKIIS-ETGVAAGVRRIEALTSNGLMEYYD 1457
240 1.000e-78UniRef50_A0A1F8XDJ8 Alanine--tRNA ligase (Fragment) n=1 Tax=Deltaproteobacteria bacterium GWA2_55_10 TaxID=1797809 RepID=A0A1F8XDJ8_9DELT  ali  19  183.RNATRRNHTATHILHAILRKTVGEHVRQAGS-LVAPDYFRFDFSHFEQLGADTLKKIEQEANKAILSNKDVRTDVLTYNEAVERGALAFFG----EKYGDLVRMVQVENVSAELCGGTHVRRTGDIGLVKITG-ESSVAAGVRRLEAVTGEAAIEYL. 333
241 1.000e-78UniRef50_A0A1W6HQF2 Alanine--tRNA ligase n=2 Tax=Chlorobiaceae TaxID=191412 RepID=A0A1W6HQF2_9CHLB  ali  21  564.RRNTERNHTATHLLHAALRTVLGDHVQQKGS-LVTPDRLRFDFSHFEKLSDRQLAEVEAIVNREVREARKVQKPDVPYEEALDMGALAFFG----DKYADHVRIVEVPGVSMELCGGTHVSNIGKIGLFKITG-ESSVAAGIRRLEAVTGQAAEELL. 715
242 2.000e-78UniRef50_R7L667 Alanine--tRNA ligase n=5 Tax=Bacteria TaxID=2 RepID=R7L667_9CLOT  ali  27  442..EQTIKYHTATHLLHKALQIVLGEHAKQKGSN-ITTERLRFDFSHPEKMTKEQLKEVEDIVNEQIKRDLPVTCEEMTVEEAKNSGATGLFEN----KYGDKVKVYTIGDFSKEICGGPHVKHTGELGKFKILKEESS-SAGVRRIKAI.......... 582
243 2.000e-78UniRef50_A0A0B8PJN6 Alanine--tRNA ligase n=7 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A0B8PJN6_9VIBR  ali  22  344.RALVSLNHSATHLLHAALRQILGEHVTQKGS-LVKPDGLRFDFSHLEAMTADEIKQVERLVNAEVRRNHVIETNVMDIESAKQKGAMALFG----EKYDDEVRVLSMGDFSTELCGGIHATNTGDIGLFKIAS-EGGIAAGIRRIEAVTADAALDVFE 495
244 2.000e-78UniRef50_UPI00068B6173 alanine--tRNA ligase n=2 Tax=Solirubrobacterales TaxID=588673 RepID=UPI00068B6173  ali  22  552.RTATQANHTATHLLHAALRETLGTHVRQAGS-YVGPDKLRFDFTHGQRLSPEELKTVEDRVNEWVLGNDPVRPITTTLKEAQELGAMALFG----EKYGDVVRMVQIGDYSRELCGGTHVRSTAEIGVFKIVS-EGSSASNVRRIEAVTGPEAVTLL. 704
245 2.000e-78UniRef50_A0A2J1DXW5 Alanine--tRNA ligase n=1 Tax=Dehalococcoides mccartyi TaxID=61435 RepID=A0A2J1DXW5_9CHLR  ali  20  67.RRDIARNHTATHILQTALREVLGEQVQQRGSV-VTPDRLRFDFSHLKPMSKDEMRRVEEFVNDKIRRNLPVYAEEMPYRHALEEGVTALFG----EKYGDRVRVLRVGAVSAELCGGTHVTASGEIALFKIMS-ESSVGAGLRRIEAVTGREAEAFI. 219
246 2.000e-78UniRef50_A0A2N2G1Y5 Alanine--tRNA ligase (Fragment) n=1 Tax=Deltaproteobacteria bacterium HGW-Deltaproteobacteria-24 TaxID=2013752 RepID=A0A2N2G1Y5_9  ali  25  166.RYEIAKHHSATHLLQSALKMVLGETVSQAGS-LNDSSRLRFDFTYPKAMTTEEINEVEDLVNSMISRAIAGNVEELPIEEAKQKGAIAMFG----EKYGDLVRVVSFGDFSVEFCGGIHVKNTSDIGSFFITK-ESGVSAGVRRIEAVCGLSAINYAK 317
247 2.000e-78UniRef50_A0A2G6J1W5 Alanine--tRNA ligase n=4 Tax=Bacteria TaxID=2 RepID=A0A2G6J1W5_9PROT  ali  23  563.REATRKNHSATHLLHHALRKVLGEHVRQRGS-LVGPERLRFDFSHTGGMTDEELCRVEDMVNREVVANTPIATEVLAFDDAIAKGAIAFFE----EKYGDKVRVLSIGAESVELCGGTHARATGDIGLFKIIG-ESAISSGVRRVEAITGMQAVRWIQ 714
248 2.000e-78UniRef50_R6E606 Alanyl-tRNA synthetase n=4 Tax=root TaxID=1 RepID=R6E606_9BACE  ali  24  70.RLKITNNHTTTHLLDQALREVLGTHVEQKGSF-VCPDYLRFDFSHFSKMTDEEIEKVEKRVNELIRANFPLEKRDATMEEANAMGAIALFG----EKYGDKVRVVKFGK-SVELCGGTHAKATGQIGMFVIMS-EGAVAAGVRRIEAVTGEAAWLHL. 220
249 2.000e-78UniRef50_A0A258CQ68 Uncharacterized protein n=1 Tax=Bosea sp. 32-68-6 TaxID=1970325 RepID=A0A258CQ68_9BRAD  ali  22  41.RTAIRANHSATHLLHEALRLVLGDHVAQKGS-LVSPDRLRFDFSHPKPISDEELREVEEIANAIVLKNEPVSTRLMSVDEAIASGARALFG----EKYGDEVRVVAMGTYSVELCGGTHASRTGDIGLVSIVG-ESAVAAGVRRLEAMTGNGA..... 193
250 2.000e-78UniRef50_A0A239TMT9 Alanine--tRNA ligase n=7 Tax=Firmicutes TaxID=1239 RepID=A0A239TMT9_9FIRM  ali  20  552..LASARNHTATHLLQAALKRVVGDHINQAGSF-VNADHLRFDFSSFEPITDEQLAEVEAMVNAEILTGQDVNISFMKQDEAKEMGAMALFG----EKYGDIVRVVTVPGFSMELCGGSHVKNVGQIGMFKIVS-ETGVAAGVRRIEALTGKAAIDYM. 701
251 2.000e-78UniRef50_B0S104 Alanine--tRNA ligase n=58 Tax=Bacteria TaxID=2 RepID=SYA_FINM2  ali  23  551.RRDIMKNHSATHLLHQALKDVVGDHVNQAGS-YVDGERLRFDITHFEAVSKEQLEKVEQIVNDKIALGIPVKIDEMSLEESQSIGARGLFE----DKYQDVVRVVQMGDYSIELCGGTHVKTTSDIQMLKIIS-ESSVAAGVRRIEAITGRAVYKYLK 702
252 2.000e-78UniRef50_A0A1W9RMU7 Alanine--tRNA ligase n=1 Tax=Candidatus Latescibacteria bacterium 4484_7 TaxID=1970771 RepID=A0A1W9RMU7_9BACT  ali  22  571.RLATARNHTATHLLHAALRKVVGEHVAQAGS-LVESSRFRFDFNHFQPISREAVRTIERMVNGWILDAIDVETRLMGYKEAVKEGAVALFD----EKYGKEVRVVRIDDVSMELCGGTHIDNTGKIGSFIIIS-EQSVAAGVRRIEAVTGKAAVEY.. 720
253 2.000e-78UniRef50_A0A2G6FFD8 Alanine--tRNA ligase (Fragment) n=1 Tax=Desulfobacterales bacterium TaxID=2044940 RepID=A0A2G6FFD8_9DELT  ali  18  37.RAATARNHTATHILHAVLRNILGDHVKQAGS-LVAPDRLRFDFTHPSRVTEATRQQIETEVNIRIWQNTIVETHEMAAETALQSGATALFE----EKYGDQVRVVSLGDFSRELCGGTHASRTGDIGLFIIIVAESGVAAGVRRIEAMTGKTALEYLQ 204
254 3.000e-78UniRef50_A0A1G1N7L7 Alanine--tRNA ligase n=2 Tax=unclassified Candidatus Omnitrophica TaxID=1047005 RepID=A0A1G1N7L7_9BACT  ali  19  568.RLSIMRNHTATHLLQSALREILGSHVQQQGS-LVAEDRLRFDFTHPKALTKEQLTQIEAKIKDHISDNDKVMKEEMSLEEAKKKGALAFF----AEKYKDQVRVITIGNYSKEFCGGTHLNSTGEIKQF-IISGEGAVAQGIRRLEAKTGSGAQEFIK 719
255 3.000e-78UniRef50_A0A2E1WZV2 Alanine--tRNA ligase n=15 Tax=Candidatus Marinimicrobia bacterium TaxID=2026760 RepID=A0A2E1WZV2_9BACT  ali  23  548.RQKIKLNHTATHLLHRALKNVLGDHVQQAGS-LVAEDRLRFDLTHYQKISDLELIEIENIINDVIRENLVLHVENKDFEIAKKEGAQALFG----EKYDDIVRVIDIDQFSKELCGGTHVNRTGDIGIFKIIS-ESSLASGVRRIEALTGQSALSYF. 698
256 3.000e-78UniRef50_R6JDH2 Alanine--tRNA ligase n=3 Tax=Bacteroidetes TaxID=976 RepID=R6JDH2_9BACE  ali  23  245.RAACAANHSATHLLDAALREVLGEHIEQKGS-LVTPDSLRFDFSHFQKVTDEEIRKVEHIVNARIRANIPLEYRNIPIEEAKELGAIALFG----EKYGDRVRVIQFG-TSIEFCGGTHVAATGNIGMVKIIS-ESSVAAGVRRIEAYTGARVEEMLD 396
257 3.000e-78UniRef50_A0A1F5V689 Alanine--tRNA ligase n=1 Tax=Candidatus Fischerbacteria bacterium RBG_13_37_8 TaxID=1817863 RepID=A0A1F5V689_9BACT  ali  25  561.RETIMRNHTATHLLNASLRQLLGTHVKQSGS-LVSDEKFRFDFTHFDTLSPVTVKEIEKLVNEKIYENLPVEISWKSLEEAIDSGALAFFG----EKYEDHVRVMKIGNFSKELCGGTHCSSTGQIGCFILTKV-SSIAAGIRRIEAVTGALAFDHIQ 712
258 3.000e-78UniRef50_A0A2E4UWN6 Alanine--tRNA ligase (Fragment) n=1 Tax=Gammaproteobacteria bacterium TaxID=1913989 RepID=A0A2E4UWN6_9GAMM  ali  23  33LRRATCLNHSATHLLHAALREVLGSHVQQRGS-LVDADRLRFDFAHFDPVTAVEQREIERLVNREVLRNTPVETELMTVDAAKVRGAMALFG----EKYSHEVRVLTMGGFSVELCGGTHVDRTGDIGPFRITNQ-QGTASGVRRIEGVTGANALAWVE 186
259 3.000e-78UniRef50_A0A0K1NBA0 Alanine--tRNA ligase n=1 Tax=Ottowia sp. oral taxon 894 TaxID=1658672 RepID=A0A0K1NBA0_9BURK  ali  21  643.RQATMRNHSVTHLMHKALREVLGSHVQQKGS-LVDADKTRFDFTHGAPVTPEEIAEIERRVNAEILANTATQACVMDIDSARETGAMMLFG----EKYGDTVRVLDIG-ASRELCGGTHVARTGDIGLFKIV-MESGVAAGIRRVEAITGLNALNWAQ 793
260 3.000e-78UniRef50_A0A1W9RDC1 Alanine--tRNA ligase (Fragment) n=1 Tax=Candidatus Omnitrophica bacterium 4484_49 TaxID=1970784 RepID=A0A1W9RDC1_9BACT  ali  27  337.RLDTARNHTATHLLHYALRKVLGEHVEQAGS-YVWWEGFRFDFTHFKAVSEQELKWIEELVNLCVINNDPVKVRVIPFEQAKKEGVLALF----TEKYKEIVRVIEIGDYSKELCGGTHLKSTGQIGLFKI-NSESAVASGIRRIEAVTGRVAYNYI. 487
261 3.000e-78UniRef50_A0A1G1JVE3 Alanine--tRNA ligase n=5 Tax=unclassified Candidatus Omnitrophica TaxID=1047005 RepID=A0A1G1JVE3_9BACT  ali  23  555.RGKVMANHTATHLLQAALRNVLGEHVHQTGSM-VDKDRLRFDFTHIKKMDERELKRVEETVNENIKKRIPVKKEIKDLESAKREGATALFG----EKYEKKVRVVTIGDVSKELCGGTHLDNTGEIEIFKIIS-ESSIASGIRRIEALTGDEVRKWME 706
262 4.000e-78UniRef50_A0A1F3WVR7 Alanine--tRNA ligase n=2 Tax=Betaproteobacteria TaxID=28216 RepID=A0A1F3WVR7_9PROT  ali  23  587.RNRTMRNHSATHLMHKALREVLGSHVQQKGS-QVDPDKTRFDFVHAQPMTDVEIRKVESIVNAEILANAECQARVMGIEDAQRTGAMMLFG----EKYGDEVRVLDIGS-SRELCGGTHVRRTGDIGLFKII-AESGVAAGVRRVEAVTGEGALAYMQ 737
263 4.000e-78UniRef50_A0A257QJQ0 Alanine--tRNA ligase n=1 Tax=Verrucomicrobia bacterium 21-51-4 TaxID=1970609 RepID=A0A257QJQ0_9BACT  ali  24  372.RHEIERHHSVTHILHWALRKVLGTHVGQAGSF-VAPNYLRFDFTHFEALQPEQIAQIEKLVQERILENHAVRWFETPFDK-KPEGVIAFFG----EKYGAVVRVVDMDGFSMELCGGTHVRSTGEIGAFKITS-ESAISAGTRRIEAVAGFAAIEY.. 520
264 4.000e-78UniRef50_A0A1Q7WJY8 Alanine--tRNA ligase n=1 Tax=Actinobacteria bacterium 13_1_20CM_3_68_10 TaxID=1803474 RepID=A0A1Q7WJY8_9ACTN  ali  23  522VRFPTMANHTATHLLHKALRDLLGEHVKQAGSA-VRPDKLRFDFTHPQALTTEERERVEHAINEIVFQNRPVRTFVTPIEEARNLGAMMLFG----EKYGEEVRVVEIDGYSRELCGGTHVRSTAEIGPFVILS-EGSVGSGARRIEAVTSGEAF.... 670
265 4.000e-78UniRef50_A0A0E9FRB1 Alanyl-tRNA synthetase n=2 Tax=Bacteria TaxID=2 RepID=A0A0E9FRB1_CHLTH  ali  22  12.RVATMANHSCTHLLQAALQKVIGSHIHQAGS-YNCPDYLRFDFNHYEKVTNEQLAEVEALVNRYIADSYPVTKEVMPIEEAKKLGAMALF----NEKYGDTVRVVTMGDVSKEFCAGCHVNNTAEIGMCKIISEES-IGSDVRRITAKTKFAAYEEF. 162
266 4.000e-78UniRef50_A0A2L2WQV1 Alanine--tRNA ligase (Fragment) n=1 Tax=Prevotella sp. MGM2 TaxID=2033406 RepID=A0A2L2WQV1_9BACT  ali  25  25.RRGSEANHTATHLLDQALREVLGTHVEQKGS-LVTPEYLRFDFSHFQKVTPEELRQVERLVNARIREDIVLQHRDLPMEEAKKLGAIALFG----EKYGDKVRVVQFG-ASVEFCGGCHAKSTGRIGLIRIVS-ESSVAAGVRRIEAVTGKVAEESI. 175
267 4.000e-78UniRef50_Q0VNK2 Alanine--tRNA ligase n=744 Tax=cellular organisms TaxID=131567 RepID=SYA_ALCBS  ali  20  545.RLAVMRNHSATHLMHAALRNVLGEHVQQKGS-LVSADYLRFDFSHGEAVSEAQREEIEILVNRQILANTAVTTELMDIESAREAGAMALFG----EKYDDQVRVLSMGGFSKELCGGTHVNRTGDIGLFRIT-LEASAAAGVRRIEAVTGEHALAVM. 697
268 4.000e-78UniRef50_A0A2D5AVI2 Alanine--tRNA ligase n=2 Tax=Planctomycetes bacterium TaxID=2026780 RepID=A0A2D5AVI2_9BACT  ali  23  587.RSRTRKNHTATHLLHRALREVLGEHVNQQGS-YVGPDRLRFDFSHPKAMTAEEVSEVETLVNRKVIENAPVRTTEEELSEAKARGVMALFG----EKYADRVRVVDVGGFSTELCGGTHVRAAGDIGPFVLIS-ESAIQAGVRRVEALSGPDAVCWIQ 738
269 5.000e-78UniRef50_Q7VHV4 Alanine--tRNA ligase n=15 Tax=Helicobacter TaxID=209 RepID=SYA_HELHP  ali  22  585IRFEIAKHHSATHLLHLALRTILGSHIAQAGS-LVQPHRLRFDFSHPKALTNEEITHIENLVNEQILQSNAQLCENMDMQQAKAKGAMALFG----EKYGERVRVVSFGD-SIELCGGIHVNNTAEIGSFYIVK-ESGVSSGVRRIEAVCGNAAYHY.. 734
270 5.000e-78UniRef50_A0A0K1HEM7 Alanine--tRNA ligase n=13 Tax=root TaxID=1 RepID=A0A0K1HEM7_9PROT  ali  26  544.REMIKRNHSATHLLHAALRKVLGDHISQAGSS-VEASRLRFDFTHPKAMSFEEIKEVENLVNFEILKAIPAKTEILELNEAKKSGAIALFG----EKYASKVRVLSFGDFSKELCGGTHVKNSSEIGAFLIIK-ESGVSAGVRRIEAICSKEVINY.. 693
271 5.000e-78UniRef50_A0A173ZAR0 Alanine--tRNA ligase n=173 Tax=root TaxID=1 RepID=A0A173ZAR0_9FIRM  ali  19  555..LASARNHTATHLLQAALKQVVGDQVNQAGSS-VTPDRLRFDFTNFEPVTPQQLADVEELVNKVILKGQDVEISHMSLEEAKKAGAMALF----SEKYGDVVRVVRVPGFSMELCAGSHVKNVGQIGMFKIVG-ETGIASGVRRIEAITGKAALDY.. 703
272 5.000e-78UniRef50_F5TBB7 DHHA1 domain protein n=1 Tax=Parvimonas sp. oral taxon 110 str. F0139 TaxID=767100 RepID=F5TBB7_9FIRM  ali  23  1.....MKNHSATHLLHQALIEVLGNHINQAGS-LVDANKLRFDITHFEAISTEDLKRVEQIVNDKIALNLNTIVEEMSLEESSKMGAIGLFE----DKYKDVVRVVSFGGWSIELCGGTHVKNVSEIQMFKIIS-ESSVAAGVRRIEAITGRSVYEY.. 146
273 5.000e-78UniRef50_D7DL84 Alanine--tRNA ligase n=3 Tax=Proteobacteria TaxID=1224 RepID=D7DL84_METV0  ali  24  584.RANIMRNHSATHLMHKALRQVLGTHVQQKGS-LVDADKTRFDFLHNAPMTDEEIAKVEAIVNAEILANAPTQAREMDIESAQKTGAMMLFG----EKYGDIVRVLDIGST-TELCGGTHVNRTGDIGLFK-VYAESGVAAGVRRIEAATGNGALKLI. 733
274 5.000e-78UniRef50_A0A1G0PEW9 Alanine--tRNA ligase (Fragment) n=5 Tax=unclassified Gemmatimonadetes TaxID=234665 RepID=A0A1G0PEW9_9BACT  ali  24  372.RHNIERNHTATHLAHAALRSVLGSHVRQAGSV-VAPDRLRFDFSHHLPIGDEELRRIEEAVNQAIWANLEVTTYELPYEKAIASGAMALFG----EKYGDRVRVVDVPGVSKELCGGTHVRTTGQIGLFHFRG-ESGVAAGVRRIEAFTGPGAYHAV. 522
275 5.000e-78UniRef50_D1VUM1 Alanine--tRNA ligase n=47 Tax=Firmicutes TaxID=1239 RepID=D1VUM1_9FIRM  ali  21  559.RNNIRRNHSVTHLLHKALKEILGDHVNQAGS-LVEADRLRFDFTHYQAMSQEEIKKVEDRVNQKIFEALSVTTTVTNPKHAQELGAVGLFE----EKYGDIVRVLSMGDYSIELCGGTHVRNTSEISMFKILS-ESGVSSGVRRIEGVTGPAVYKML. 709
276 6.000e-78UniRef50_A0A1Z8ZGH9 Uncharacterized protein (Fragment) n=1 Tax=Gammaproteobacteria bacterium TMED92 TaxID=1986770 RepID=A0A1Z8ZGH9_9GAMM  ali  20  48.RDQTRANHSATHLLHAALRQVLGDRVQQKGS-LVNAEKLRFDFSHEGGMNRKQIAEVEDRVCEQIRLNSVVDTRLMPYDDAVASGAMALFG----EKYEDEVRVLTMGDYSVELCGGTHVARTGDIGAFKIQ-LETGIAAGVRRIEAVTGQAAVAY.. 198
277 6.000e-78UniRef50_A0A2W4I0U1 Alanine--tRNA ligase n=2 Tax=unclassified Candidatus Margulisbacteria TaxID=2211321 RepID=A0A2W4I0U1_9BACT  ali  23  469.....ARHHTGTHLLQAALRDVLGAHVAQAGSM-VSPERLRFDFNHFEALTENELACVETLVNEKIIQNIRIEKFEESYAKALELGALAFFG----EKYSDIVKVVKIDDFSIELCGGTHLDYTGQIGLFKIVS-ESAVAAGVRRIEAVAGAPAVQYVQ 616
278 7.000e-78UniRef50_Q39HB7 Alanine--tRNA ligase n=34 Tax=Proteobacteria TaxID=1224 RepID=SYA_BURL3  ali  23  557.RARTQRNHSATHLMHKALREVLGAHVQQKGS-LVDAEKTRFDFAHNAPMTDDEIRRVEQIVNNEILANAPGIVRVMPYDEAVKGGAMALFG----EKYGDEVRVLDLG-FSRELCGGTHVSRSGDIGFFKIV-VEGGVAAGIRRVEAITGDNAVRYVQ 707
279 7.000e-78UniRef50_T1CT21 Alanine--tRNA ligase n=3 Tax=Helicobacter TaxID=209 RepID=T1CT21_9HELI  ali  21  610.RFEIMKHHSATHLLHYALRKILGTHIAQAGS-LVESNRLRFDFSHPKALSSAELEQIEELVNAQIIKASAQICETMEIEEAKAKGAMALFG----EKYGDVVRVITFGD-SIELCGGIHVENTAQIGSFYIVK-ESGVSSGVRRIEAVCGLAAYHY.. 758
280 7.000e-78UniRef50_A0A1Q6XKR1 Alanine--tRNA ligase n=3 Tax=Actinobacteria TaxID=201174 RepID=A0A1Q6XKR1_9ACTN  ali  23  545VRFPTMANHTATHLLHKALRDLLGEHVKQAGSA-VRPDKLRFDFTHPQALTTEERERVEHAINEIVFQNRPVRTFVTPIEEARNLGAMMLFG----EKYGEEVRVVEIDGYSRELCGGTHVRSTAEIGPFVILS-EGSVGSGARRIEAVTSGEAF.... 693
281 7.000e-78UniRef50_A0A1F9X9P0 Alanine--tRNA ligase n=6 Tax=unclassified Elusimicrobia TaxID=1797919 RepID=A0A1F9X9P0_9BACT  ali  18  555.RERIKRHHTATHILHRALRHVLGAHVTQAGSM-VTPDYFRFDFTHPAALSPQELSAAEEIVNDAIRKDMEVCIELMNQDEARKKGAMALFG----EKYGETVRAVSVKPFSMELCGGTHVGRTGNIGLFKIIS-ESSVASGTRRIEAVAGDAADNYV. 711
282 8.000e-78UniRef50_A0A2N2DBT4 Alanine--tRNA ligase n=1 Tax=Firmicutes bacterium HGW-Firmicutes-13 TaxID=2013774 RepID=A0A2N2DBT4_9FIRM  ali  25  242.RSCTCRNHTVTHLLHKALKEVLGEHVNQAGS-LVTPERLRFDFTHFAPLELKEIKEVEERVNHKVWENILVEVEETIFKEARGKGAMALFD----EKYKEKVRLVEIGNYSLELCGGTHVKSTGEIGIFKIVS-ETGIGTGLRRIEALSGPGAYEYF. 392
283 8.000e-78UniRef50_A0A2G9YLG1 Alanine--tRNA ligase n=2 Tax=unclassified Candidatus Omnitrophica TaxID=1047005 RepID=A0A2G9YLG1_9BACT  ali  23  607.RLNIARNHTATHILQAALREVLGNHVQQQGS-LVTDEKFRFDFTHFKRLSKEEISRVEEVANSYIAKNQGVNCKEMTLKDAKKAGALAFFE----EKYGENVRVVTIGDISKELCGGTHLNNISEIGQIKIIG-EGSAASGIRRIEGVTANFAEQFIK 758
284 9.000e-78UniRef50_R6TX80 Alanine--tRNA ligase n=1 Tax=Clostridium sp. CAG:448 TaxID=1262808 RepID=R6TX80_9CLOT  ali  23  17.RNAIRRNHSALHLLQGALREVLGNHVEQAGS-YVDEERGRFDFTHFAAMTPEELDRAEALVNARILRGIPVQTIETDIDEAKKMGAMMLFG----EKYGNVVRVVKMGEVSAEFCGGTHVANTAMVGLFHIIS-ETSVAAGVRRIECVTGMGVLAQL. 167
285 9.000e-78UniRef50_A0A1A9VJX5 Uncharacterized protein n=1 Tax=Glossina austeni TaxID=7395 RepID=A0A1A9VJX5_GLOAU  ali  20  608.RQTLRRNHSATHLLHFALRKILGDHVTQKGS-LVAPDRLRFDFSHNTQVAQDQLFWVEDMVNSLIRENLSASTKIQSMNQAIDEGAMALFG----EKYGDQVRVVNIGD-SKELCGGTHVEHTGEIGLFKIV-TESSVAFGVRRIEALTGQEAINYV. 757
286 9.000e-78UniRef50_A0A2M7AHK4 Alanine--tRNA ligase n=1 Tax=Armatimonadetes bacterium CG07_land_8_20_14_0_80_40_9 TaxID=1973916 RepID=A0A2M7AHK4_9BACT  ali  25  560.RLAISRHHTATHLLQASLRKVLGKQVRQSGS-LVDEARLRFDFSYPRALTKEELKEVEEILNQKILENIPVETYETKIDKAKAEGAIALFG----EKYEEIVRVVKVGEFSKELCGGCHVRFSGEIGLCKIVNEES-IGAGLRRIEALAGSHAYEYL. 710
287 9.000e-78UniRef50_A0A1V6HUP6 Alanine--tRNA ligase n=1 Tax=Deltaproteobacteria bacterium ADurb.Bin058 TaxID=1852865 RepID=A0A1V6HUP6_9DELT  ali  21  36VRLKTRRNHSATHLLHKALREVLGAHVRQRGS-LVAPDRLRFDFQHTGPVTDEEIAKIEAKVTKDILADEPVVTDVLAFDQAVERGALHFFG----DKYGDEVRMVSMGD-SIELCGGTHVSRTGQIFAFKIVS-ETGVAAGVRRIEAVTGDVALALLQ 187
288 9.000e-78UniRef50_A0A1V4VEZ7 Alanine--tRNA ligase n=1 Tax=Pelotomaculum sp. PtaB.Bin013 TaxID=1811692 RepID=A0A1V4VEZ7_9FIRM  ali  24  260.RAAVSRNHSATHLLQKALKTVLGGHVHQAGS-LVEPDRLRFDFTHYAALSPDELKQVEKIVNNAVLANLPVEIFETSVSEARAMGAAALFD----EKYGERVRAVKMGDFSLELCGGTHLRSTAEAGLFKLVG-ESSVGAGLRRIEAVTGEGALRFIE 411
289 9.000e-78UniRef50_A0A1E7I987 Alanine--tRNA ligase n=3 Tax=Desulfovibrio TaxID=872 RepID=A0A1E7I987_9DELT  ali  23  561IRVATERNHTATHLLHASLRKILGDHVKQSGS-LVGPNRLRFDFTHIAAMKPEEVRQVENEVNRAILASTPVDVQELTSKEAVEKGATALFG----EKYGDVVRVVDIAGESMELCGGTHIKTTGEAGTFVILS-ESGVAAGIRRIEAATGWNSLAFLQ 713
290 1.000e-77UniRef50_A0A2E7CLS6 Alanine--tRNA ligase (Fragment) n=1 Tax=Proteobacteria bacterium TaxID=1977087 RepID=A0A2E7CLS6_9PROT  ali  19  513.RLDTRRNHTATHILHAALRNRLGTHVTQKGS-LVNSDKLRFDFSHHKAMTLEELELIANDVQAEIFKNTTLGSCICSMNDAKEKGAMALFG----EKYGDEVRVVEIPGYSVELCGGTHAQATGEIGLFHILS-ESGIAAGVRRIEALTGRKAVEHLQ 664
291 1.000e-77UniRef50_A0A1F4UDJ3 Alanine--tRNA ligase n=1 Tax=candidate division WOR-3 bacterium RBG_13_43_14 TaxID=1802590 RepID=A0A1F4UDJ3_9BACT  ali  25  535IRKESARAHTSTHLLHAALRKTLGEHARQEGSF-VEPGRFRFDFTHFKPLSEDEITAIEDLVNEKIMAALPVKKFFTKLDQAKKLGAMAIFG----EKYGNEVRVVQIDDFSIELCGGIHIDNTGEIGLFKIISQEAA-AAGIRRIEAQVGLKLFHHL. 686
292 1.000e-77UniRef50_E6W1T2 Alanine--tRNA ligase n=17 Tax=root TaxID=1 RepID=E6W1T2_DESIS  ali  19  574.RRNITLNHSATHLLHAALKSTVGEHVRQAGS-LVEDGKLRFDFTHWKGLTPEELQGVEDQVNAQVMANHAVRKELMTLDDAVARGATALFD----EKYGDDVRVITMGDYSMELCGGTHVDATGQIGLFKILS-ESAIAAGVRRIEATTGPGALQVV. 724
293 1.000e-77UniRef50_A0A257TKI9 Uncharacterized protein (Fragment) n=1 Tax=Ignavibacteriae bacterium 37-53-5 TaxID=1970532 RepID=A0A257TKI9_9BACT  ali  24  95.RLEIMRNHSATHLFHAALRKTLGEHVHQAGS-LVDPGHMRFDFTHHKKVSPEELRDIEQIVNEKILERIELTHRNIPYDQARKMGALAFFG----DKYGDKVNVVQFGDFSMEFCGGTHVRNTSEIGFFKVI-TESSIASGVRRVEAVTGGGVEK... 244
294 1.000e-77UniRef50_B2JK72 Alanine--tRNA ligase n=102 Tax=Proteobacteria TaxID=1224 RepID=SYA_PARP8  ali  23  557.RARTARNHSATHLMHKALREVLGGHVQQKGS-LVDADKTRFDFAHNAPMTDEQIRRVEEIVNAEVLANAPGIVRVMAYDEAVKGGAMALFG----EKYGDEVRVLDLG-FSRELCGGTHVNRTGDIGLFKIV-MEGGVAAGIRRVEAITGDNAVRFVQ 707
295 1.000e-77UniRef50_A0A2H5W9H2 Alanine--tRNA ligase n=7 Tax=Bacteria TaxID=2 RepID=A0A2H5W9H2_9BACT  ali  24  561.RWSTMRHHTGTHLIHWALRERLGYHVKQAGS-LVAPDRLRFDFTHFSALSLSDIEELERMVNLKVWDDYEVEEKFMPLEEALRRGALAFFG----EKYPDVVRVIQIGDFSKELCGGTHVYHTGWIGPFVIVR-ESSIGAGLRRIEALAGEPAVRYLQ 712
296 1.000e-77UniRef50_A0A258W5H1 Alanine--tRNA ligase n=2 Tax=Bdellovibrionaceae TaxID=213483 RepID=A0A258W5H1_9PROT  ali  22  574.RKLTASNHSATHLMHAALRKTLGQSVTQAGS-LVDSLKLRFDFTFNRPLTPEEITKIEDIVNEQIYRSDSVSTHQMSYKKALEFGALALFG----EKYGDEVRVLKMGDFSTELCGGTHVHNTAEIRLFKIVS-ETGVSSGVRRIEALTNKNALDYL. 724
297 1.000e-77UniRef50_V2RRF9 Alanine--tRNA ligase n=2 Tax=Mucispirillum TaxID=248038 RepID=V2RRF9_9BACT  ali  22  561IRQYTEYNHTATHLLHKALQKIIGDHARQAGS-LVNDERLRFDFTHYQALTIEQIDEIEMEVNRAVTANYPVHKRIETLEDAMQEGATALFG----EKYGEEVRVVQIANYSKELCGGCHVDRTGVIGLFKILS-ESSVAQGVRRIEAVTSHKAFKYL. 712
298 1.000e-77UniRef50_Q9X1B6 Alanine--tRNA ligase n=36 Tax=Thermotogae TaxID=200918 RepID=SYA_THEMA  ali  25  554.REATMRNHTATHLLHAALKKVLGDHVRQAGS-LVAPDRLRFDFTHFKGLSSAEIEQVEDLVNEWIMEAIPVEVRYTSYEEAVKSGVVALF----TEKYGDVVRVVEVPGVSKELCGGTHVKNTGQIGLFKIISEES-VSSGVRRIEAVTGFSALELL. 704
299 1.000e-77UniRef50_A0A257VX99 Alanine--tRNA ligase n=7 Tax=Proteobacteria TaxID=1224 RepID=A0A257VX99_9PROT  ali  20  278.RNRIRANHSATHLLHAALRRNLGEHVTQKGS-LVTDDRLRFDITHPKQITPSELQAIEAEVNEVIWQNAPIGTRLMSQEDAIKAGAMALFG----EKYGAEVRVLTMGNYSIELCGGTHASRTGDIGLFKILS-EGAVAAGVRRIEAVTQAGAYAY.. 433
300 1.000e-77UniRef50_A0A1F2UHB4 Alanine--tRNA ligase (Fragment) n=1 Tax=Actinobacteria bacterium GWC2_53_9 TaxID=1797195 RepID=A0A1F2UHB4_9ACTN  ali  21  249.RLSIKRNHTATHLLQWALRLVLGEHVKQAGS-LVEPERLRFDLTHFSAISREQLRKVEELVNAKIFENHPVRAFVTSYDFARESGATALFD----EKYGDFVRLLEVGNFSRELCGGTHVGNTSEIGLFKITS-EGSVGANTRRIEAVTNGAAMRYL. 399
301 2.000e-77UniRef50_UPI000CFB84C8 alanine--tRNA ligase n=1 Tax=Candidatus Sulfotelmatomonas gaucii TaxID=2043161 RepID=UPI000CFB84C8  ali  22  588.RARIMRNHSGTHLVHAALRNILGTHVKQAGS-LNAPERLRFDFSHFAPVGQEELRDIEQQVNEEIRVNTQIETGVMSLEEALNSGALAFFG----DKYPENVRVVTIPDYSKELCGGTHVHRIGDIGVLKIVSEES-VAAGVRRIEAVTGIGALEHYQ 747
302 2.000e-77UniRef50_A0A1V5QGW8 Alanine--tRNA ligase n=3 Tax=Bacteria TaxID=2 RepID=A0A1V5QGW8_9CHLR  ali  25  53..EATARLHTAAHLMLAALREVLGDHVLQKGSN-ITAERLRFDFSHPEKMTPEQISEVEDLVNEQISKNIPIDMEEMSLDDAKSCGAMGVFEA----KYGDKVKVYTVGDFSREICGGPHAENTGDLGHFKILKEESS-SAGVRRIKAV.......... 193
303 2.000e-77UniRef50_A0A2H5XZZ1 Alanine--tRNA ligase n=3 Tax=Bacteria TaxID=2 RepID=A0A2H5XZZ1_9BACT  ali  25  542.RWAIMRNHSATHLLHEALRRVLGPHVQQAGS-LVAPDYLRFDFSHFGKIEPAQLRDIEALVNEKIREAIPVQTRIMPLEQARKIPNVKMFFA---DKYGDIVRVVIIDEFSVELCGGTHVQNTSQIGMFVLTAEES-VAAGVRRVEAVTGEGVERY.. 693
304 2.000e-77UniRef50_A0A136M928 Alanine--tRNA ligase n=1 Tax=Omnitrophica bacterium OLB16 TaxID=1617433 RepID=A0A136M928_9BACT  ali  23  550.RHLILPHHTATHLLQAALRQVLGDHVHQQGSF-VGPENLRFDFTHTEALSREQIDEVESLVNGWVLQDYPVQIEHTSLSEARSAGAMALFG----EKYGEVVRMVRIEPVSRELCGGTHVHRTGEIGSLYIASEES-IQAGVRRITAVAGERAYREIK 701
305 2.000e-77UniRef50_A0A2M8S7Y6 Alanine--tRNA ligase (Fragment) n=1 Tax=Anaerolineae bacterium CG_4_9_14_0_8_um_filter_58_9 TaxID=1973903 RepID=A0A2M8S7Y6_9CHLR  ali  17  56.RGDIMRNHTATHLLHAALRQVLGEHARQAGS-LVAPDHLRFDFNHPEALTEDQLERVERLVNEAIAADMLVTPKTKSRQQAIAEGAMALFG----EKYGETVRTITIGNYSYELCGGTHLDRTGSIGAFLILN-ESSAAAGVRRIEAVTGRGAYELI. 216
306 2.000e-77UniRef50_A0A2V8MS33 Uncharacterized protein n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8MS33_9BACT  ali  22  80.RRRIAANHTGTHILHAVLRETLGMHVKQAGS-LVAPDRLRFDYTHFAPLTDREIEEIEQKINQIVFKNSPVQTQVMDINQAITAGALAFFG----EKYQQQVRVVSIPDVSMELCGGTHTKMTGDVGLFKIVS-ESSIASGIRRIEALTG........ 223
307 3.000e-77UniRef50_A0A2D6IPT9 Alanine--tRNA ligase n=1 Tax=Proteobacteria bacterium TaxID=1977087 RepID=A0A2D6IPT9_9PROT  ali  25  252.REMVMRNHSATHLLHFALRQVLGNHVAQRGS-LVTEDRTRFDFSHDSKIDAEDISSIENVVNEIVKNNTATEIKNMEYSEAVDYGAVALFG----EKYGDRVRVLKIGP-SIELCGGTHVSRTGDIGFFKIIS-EGSISSGVRRIEAVSGRAAEEYV. 401
308 3.000e-77UniRef50_A0A2M8FVN9 Alanine--tRNA ligase n=1 Tax=Deltaproteobacteria bacterium CG_4_9_14_0_2_um_filter_42_21 TaxID=1973964 RepID=A0A2M8FVN9_9DELT  ali  23  556.RKKIAANHTATHLLHKALRETLGEHVKQAGS-HVNEDRLRFDFSHFQALSKDDWKKIQELANNAIKNNIKVETNELPYDEAIAKGALAFFG----EKYGDIVRLVEVGDFSKELCGGTHTSSTGEIKLVSIES-ESSVAAGVRRIEAATADLAYQH.. 705
309 3.000e-77UniRef50_A0A137SXU6 Alanine--tRNA ligase n=22 Tax=Terrabacteria group TaxID=1783272 RepID=A0A137SXU6_9FIRM  ali  22  558.RNNIRRNHSVTHLLHKALKEVLGDHVNQAGSE-VWDKGMRFDFTHFEAISKDDLEKIEKRVNEKIFESLPVETIITDLQEAQKLGAIGLFE----EKYGDEVRVLKMGDYSIELCGGTHVKNTSQISMFKILS-ESGISSGVRRIESITGPAVYEEL. 708
310 3.000e-77UniRef50_A0A1X4XZR1 Alanine--tRNA ligase n=1 Tax=Desulfurella amilsii TaxID=1562698 RepID=A0A1X4XZR1_9DELT  ali  28  556.RKDTARHHSAVHLLDSALIKKLGNNIKQAGS-LVEPDRLRFDFTHNSKLTDEEIRDIEIMVNVWIQEAYPVKTNIMKIKDAIESGAIAIF----TEKYDELVRVVEIEGVSKELCGGTHVKNTGEIGFFKIISEE-ALSKGVRRIEAKVGMAAYDYV. 706
311 3.000e-77UniRef50_X0W8H4 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X0W8H4_9ZZZZ  ali  22  47.RGRIACNHTATHLLQAALRKVLGAHVRQSGS-WVGPDKLRFDFTHFQVLNQRQLARVEELVNREIRQNKKLNVLNTTFEESQKMGALALFG----EKYQEKVRVVKIADTSLELCGGTHVSSTAEIGMFKIIS-ESSVASGIRRVEALTGERARAVLK 198
312 3.000e-77UniRef50_A0A1G3L6B0 Alanine--tRNA ligase n=1 Tax=Spirochaetes bacterium GWB1_36_13 TaxID=1802174 RepID=A0A1G3L6B0_9SPIR  ali  24  547.RNKIRKNHTATHLLHKALQMVLGKHVKQSGS-LVDDEKLRFDFAHFEKMSAEEIKKAELIVNEEIQKAKALSISVHDIEDAKAMGATALFG----EKYKDKVRVVQVPEFSMEFCGGTHVANTGEIGVFKIVS-ESSVASGIRRIEGMTGMLAFE... 695
313 3.000e-77UniRef50_UPI0004AC401B serine-tRNA(Ala) deacylase AlaX n=1 Tax=Leptospira interrogans TaxID=173 RepID=UPI0004AC401B  ali  25  124.RERLKFHHSGTHLLNGALRTLLGDHVLQKGSI-VSPEYLRFDFSHPSSLTSEEIRQIESWVNESIRKNFPVETKELSIEDAKKTGAVATFG----EKYGERVRVVQMGDASIEFCGGTHVSRTGEIGYFFI-KKESSPGAGNRRIEGVCGPAVIETFQ 275
314 3.000e-77UniRef50_A4SGJ6 Alanine--tRNA ligase n=18 Tax=Bacteria TaxID=2 RepID=SYA_CHLPM  ali  20  560LRQATERNHTATHLLHAVLRHTLGAHVQQKGS-LVNPERLRFDFSHFSKLTPEEIDAVESAVNDCIRQAATLKHADVPYDDAITKGALAFFG----DKYADLVRVVEIPGISVELCGGTHVDNVGQIGLFKIVG-ESSVAAGVRRIEALTGRAAEELM. 712
315 3.000e-77UniRef50_A0A143PSM8 Alanine--tRNA ligase n=1 Tax=Luteitalea pratensis TaxID=1855912 RepID=A0A143PSM8_9BACT  ali  19  557.RAAIRRNHTATHLLHAALRQTLGTHVKQAGS-LVAPDRLRFDFVHTGTIAASDLEAIERIVNAQIMRNTKVQTTLRRTDEAMALGAMALFG----EKYGDTVRVVDIPGFSLELCGGTHCRATGDIGVFTIVS-EGGVAAGVRRVEAVTGEGAVALLQ 708
316 3.000e-77UniRef50_A0A2G6JGE1 Alanine--tRNA ligase n=2 Tax=Planctomycetes bacterium TaxID=2026780 RepID=A0A2G6JGE1_9BACT  ali  19  592.RRAIERNHTATHLLHQALKDVLGEHVAQAGS-LVAPDRLRFDFTHGERLSPEQLREVERIVSREIMAATQLSPLQMSLSEAKGAGFTALFG----EKYGAEVRTLAIGEYSKELCGGTHVANTGQIGPFRIV-TETSVAAGVRRIEALTGVEALEHRQ 743
317 4.000e-77UniRef50_C8W9V0 Alanine--tRNA ligase n=60 Tax=Actinobacteria TaxID=201174 RepID=C8W9V0_ATOPD  ali  17  557.RELIRRNHTATHLLDAALKKVLGDHVNQAGS-LVAPDRMRFDFTHFEALTKDELDRIEGMVNAEIFAAKPIVTKIMSIEDAKAAGAVALFG----EKYGDVVRVVSAGPFSRELCGGTHARNTADLGLFKIIS-ESSVGSNSRRIEAVTSMGAIEYVD 712
318 4.000e-77UniRef50_A0A1F9EAL3 Alanine--tRNA ligase n=1 Tax=Deltaproteobacteria bacterium RIFCSPHIGHO2_02_FULL_38_15 TaxID=1797857 RepID=A0A1F9EAL3_9DELT  ali  18  563.RHDIVLNHTATHMLHTALQEQLGDHVRQAGS-LVAPDRLRFDFTHFQPLTPLEIENLENFMNDKIAASDPVTVTVMSFKDAMEIGAMALFG----DKYEDRVRVIQVGDYSIELCGGTHLHSTSQIRLFKIIS-ETGVSAGIRRIEALTGKGAFQYLK 714
319 4.000e-77UniRef50_U7D8J9 Alanine--tRNA ligase n=29 Tax=Bacteria TaxID=2 RepID=U7D8J9_9BACT  ali  22  559.REAIRRNHSATHLLQAALTEVLGDHVDQAGSR-VDAESLRFDFTHFSALSSDEIVQVERLVHRWIMEDTPVAAEEKSIDAAKKEGAKALFG----EKYGDTVRVVSMGEFSKELCGGTHIDRLGKIGPFKITG-ESSVSAGVRRVEAVSGAAAVELFQ 710
320 4.000e-77UniRef50_A0A1Z9BEM6 Alanine--tRNA ligase (Fragment) n=1 Tax=Betaproteobacteria bacterium TMED100 TaxID=1986666 RepID=A0A1Z9BEM6_9PROT  ali  21  269.RANIKRNHSATHLLHLALKKTLGDHVQQKGS-LVNSGRTRFDFSHPNILTNEQIRKVENIVNDEILENSKTSANLMEYADALKSGAVALFG----EKYSDEVRVLTIGS-SKELCGGTHVGRTGDIGFFKIVN-ETGVSSGVRRVEAVTGKNAFAYIQ 419
321 4.000e-77UniRef50_H3K4B1 Alanine--tRNA ligase n=4 Tax=Megamonas TaxID=158846 RepID=H3K4B1_9FIRM  ali  20  552..LASARNHTATHLLQAALKRVVGDHINQAGSA-VNAHHLRFDFSSFEPISAEQLQQVEEMVNAEILTGKDVEISHMNQEDAKKAGAMALFG----EKYGDIVRVVTVPGFSMELCGGSHVKNIGQIGMFKIIG-ESGVAAGVRRIEAITGKAAIDYM. 701
322 5.000e-77UniRef50_A0A133YYK2 Alanine--tRNA ligase n=2 Tax=Coriobacteriales bacterium DNF00809 TaxID=1588753 RepID=A0A133YYK2_9ACTN  ali  18  558.RKRIARNHTATHLLHAALREVLGEHVNQAGS-YVGPDRLRFDFTHFQALTKEEMLQVEARVNDVIGQAIPLTVCETSLEEARKSGAMALFG----EKYGEKVRVVSAGEFSKELCGGCHCNNTSDVNYMKLISQ-SSVGANVRRVEALTSFDAFNY.. 707
323 5.000e-77UniRef50_A0A2M6X2C2 Alanine--tRNA ligase n=1 Tax=Bdellovibrionales bacterium CG10_big_fil_rev_8_21_14_0_10_45_34 TaxID=1973927 RepID=A0A2M6X2C2_9PROT  ali  23  592.RQEIASHHSVTHLLHAALRKVLGSHVTQAGS-LVEANRLRFDFSNPKPLSDDEIQHVEALVNREIAQGYNVSPEEMSFDEALKRGALALFG----EKYSDQVRVVSLGSFSMELCGGTHVSNTALIRAFRIV-QETGVSSGIRRIEAVAGETAVRLL. 742
324 5.000e-77UniRef50_Q3ZAE4 Alanine--tRNA ligase n=21 Tax=Dehalococcoidia TaxID=301297 RepID=SYA_DEHM1  ali  20  554.RRDIARNHTATHILQTALRQVLGEQVQQRGSV-VTPERLRFDFSHLKPMTKDEIRRAEEFVNDKIRRNLPVYAEEMPYRHALEEGVTALFG----EKYGDRVRVLRVGAVSAELCGGTHVSASGEISLFKIVS-ESSVGAGLRRIEAVTGREAEAYI. 706
325 5.000e-77UniRef50_A0A2S5RA52 Alanine--tRNA ligase n=2 Tax=Holospora curviuscula TaxID=1082868 RepID=A0A2S5RA52_9PROT  ali  20  561.RKRIQSNHSATHLLHSALRGILGEHVTQKGS-LVTPERLRFDFSHPIAVSPDQLRYIELWVNERIWANLPVHARIMSQEAALNAGAMALFG----EKYAQEVRVISMGKVSMELCGGTHVEYTGEIGLFKIL-QESSIGAGLRRIEAITQHTALTYVQ 716
326 5.000e-77UniRef50_A0A2V9BLT5 Alanine--tRNA ligase (Fragment) n=2 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V9BLT5_9BACT  ali  22  256.RSRVMRNHTGTHLVHAALRNILGPHVKQAGS-LNAPDRLRFDFSHFAPVDAEELRDIEQQVNEEVRLNTELETNVTSLDEALASGALAFFG----DKYPENVRVVTIPDYSKELCGGTHVKRVGDIGVVKIVSEES-VAAGVRRIEAVTGIGALDHFQ 415
327 6.000e-77UniRef50_A0A142HUU2 Alanine--tRNA ligase n=9 Tax=Bacteroidetes TaxID=976 RepID=A0A142HUU2_9SPHI  ali  22  579.RDSTNNNHSATHLLHAAMKQVLGSHVNQKGS-LVNADYLRFDFSHFAKVTDDELAQIEAIVNQKIRENIYLEERNVPYDQAISSGVTALFG----EKYGDFVRVITFDSFSKELCGGTHVKATGHIGYFKIIS-ESAVAAGVRRIEAITGIAAENYI. 731
328 6.000e-77UniRef50_A0A2V2EZV3 Alanine--tRNA ligase (Fragment) n=1 Tax=Clostridiales bacterium TaxID=1898207 RepID=A0A2V2EZV3_9FIRM  ali  19  261.RLATARNHTTTHLLHKVLKETLGEHVNQAGSS-VDANRLRFDFSHFTAMTAEELATVERRVNEEILNAHDVEISEKSLDEAKTLGFTALFG----EKYGEIVRCVKAGDFSMELCGGTHLTNTAQAGSFKIVS-EGAVAAGIRRIEAVTGMAAYEYVK 412
329 6.000e-77UniRef50_A0A136KB35 Alanine--tRNA ligase n=1 Tax=Acidobacteria bacterium OLB17 TaxID=1617423 RepID=A0A136KB35_9BACT  ali  22  305.RDATRRNHTATHLVHAALKEVLGSHVKQAGSV-VAPNYLRFDFAHYQPMTAGEIAEVEDLVNRYILKNEQVTTDLMAIEDAMRSGAVAMFG----EKYGSEVRVLTVGGFSRELCGGTHVRATGDIGSFKITSDE-AIASGVRRIRAITGFDAFERF. 457
330 6.000e-77UniRef50_A0A1E7HLD8 Alanine--tRNA ligase (Fragment) n=1 Tax=Desulfuromonadales bacterium C00003094 TaxID=1869310 RepID=A0A1E7HLD8_9DELT  ali  18  298.RQATALNHTSTHILQKVLTEILGEHVQQAGS-LVTPERLRFDFIHFSALTPEELAQIEEQVNLRIRNNLQVATQQMSTDEAVAAGATALFG----EKYGDAVRVVRIGDFSMELCGGTHTSASGDIGLFKIV-QEAGIAAGVRRIEATTGAKALELI. 448
331 6.000e-77UniRef50_A0A268TIY8 Alanine--tRNA ligase n=5 Tax=Helicobacter TaxID=209 RepID=A0A268TIY8_9HELI  ali  24  550.RSEVIKHHSATHLLHAVLRKVLGEHIAQAGS-LVEASRLRFDFSHPKALSQEEIQTIEAEVNAMICKNIPATTEHLSIQEAKAKGAMALFG----EKYGEVVRVVSFAGESCELCGGIHVQNTGFIGSFYITK-ESGVSSGVRRIEAVCGNAAYVY.. 699
332 6.000e-77UniRef50_A0A2E6HVR8 Alanine--tRNA ligase n=9 Tax=Bacteria TaxID=2 RepID=A0A2E6HVR8_9CHLR  ali  24  547.RKRITANHSATHLLNSALKRILGSEIEQRGS-LVDEHHLRFDFTSPKAVTDEQIREIETLVNEEITKNTLTITETMSKDEALKKGALAFFG----EKYGEKVRVLSLGDFSIELCGGTHVKRTGDIGLFTITN-ESSISAGVRRLEAVTGEAAISIVQ 699
333 6.000e-77UniRef50_A0A1I3CUX1 Alanine--tRNA ligase n=3 Tax=Bacteroidetes TaxID=976 RepID=A0A1I3CUX1_9SPHI  ali  23  581.RRDIEGNHSATHLLHAALKQVLGNHVNQKGS-LVNTDYLRFDFSHFAKVNDDELLQIERIVNDKIRENIPLEERDVPFQQAIDAGVTALFG----EKYGDHVRVITFDDFSKELCGGTHVQATGQIGFFKIV-AESAVAAGVRRIEAITGSAAERFIE 734
334 7.000e-77UniRef50_J0NNM7 Alanine--tRNA ligase n=1 Tax=Helicobacter pylori Hp H-18 TaxID=992065 RepID=J0NNM7_HELPX  ali  21  238.RFEIAKHHSATHLLQSALREVLGSHVSQAGS-LVESKRLRFDFSHAKALNDEELEKVEDLVNAQIFKHLNSQVEHMPLNQAKDKGALALF----SEKYAENVRVVSFKEASIELCGGIHVENTGLIGGFRILK-ESGVSSGVRRIEAVCGKAFYQ... 386
335 7.000e-77UniRef50_A0A0G0JM43 Alanine--tRNA ligase n=13 Tax=cellular organisms TaxID=131567 RepID=A0A0G0JM43_9BACT  ali  25  482......KLHTATHLLNQALRQVLGDHVYQKGSN-ITAERLRFDFSHPQKVTPEELAKIEAIVNEQIKANLPINCDEMAVDEAKSKGAIGVFDA----KYGDKVKVYFMGDFSKEICGGPHANNTGDLKSFKILKEE-AVASGIRRIKAVIG........ 620
336 7.000e-77UniRef50_A0A1W9RE25 Alanine--tRNA ligase n=1 Tax=Candidatus Omnitrophica bacterium 4484_70.1 TaxID=1970782 RepID=A0A1W9RE25_9BACT  ali  25  545.RKALERAHTATHLLQAALRKILGTHVTQQGS-LVDTDRLRFDFTHFQALKENELEKIERLVNEFILQVDKVETKIVPFEEAKKEKALAFFE----EKYEDLVRVVSISDYSKELCGGTHVKDTGKIGLFLILS-ESSVSSGIRRIEAVCGKLAQNLV. 695
337 7.000e-77UniRef50_A0A1F8YP32 Alanine--tRNA ligase n=2 Tax=Bacteria TaxID=2 RepID=A0A1F8YP32_9DELT  ali  23  561.RRQTQANHTATHLLQAALRQVLGTHIRQAGS-YVGPDKLRFDFTHFEAVSEAALRQVEDLVNETVFAVRPVDWEYLPHEEAVSRGAMAFFG----EKYADVVRMVTVPGVSMELCGGTHVGNTGEIGLFRILS-EGALAAGVRRIEAATGPGAFHQL. 711
338 8.000e-77UniRef50_X0SDH9 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X0SDH9_9ZZZZ  ali  23  42.RMATARNHTATHLLHHALRRVLGQHAKQSGS-HVSAERLRFDFSNPTELGPDQLREVEDIVNAKILENDPVIGTQMSLSEAREAGAIALFG----ETYGDIVRVLSIGDYSRELCGGTHCESTGQVGLFRIT-HESSVAGGVRRIEAVTGLGVLERL. 192
339 8.000e-77UniRef50_A0A1F3TZ51 Alanine--tRNA ligase n=1 Tax=Bdellovibrionales bacterium RIFCSPHIGHO2_01_FULL_40_29 TaxID=1797389 RepID=A0A1F3TZ51_9PROT  ali  21  572.RRQVAANHSSTHLMHAALRKVLGTHVSQAGS-LVDNSKTRFDFTHTKPLSSEEIKKIDALVNDEISKAYPVEATLMSHQKAIESGAMALFG----EKYGDTVRVLKMADFSTELCGGTHVNNISEIRAFKIIS-ESGVSAGVRRIEAIAGDAAVQYL. 722
340 9.000e-77UniRef50_A0A1J5DYK5 Alanine--tRNA ligase n=4 Tax=Candidatus Desantisbacteria TaxID=1819803 RepID=A0A1J5DYK5_9BACT  ali  26  552.RLAIQRNHTATHLLQAALQQVLGKHVKQSGSF-VSSDYLRFDFSHLSPLTGEECQRIEELVNNKIRENLLVEVSEIERSRAEKIGAMALFG----EKYGQMVRVVKIGDYSLELCGGTHASATGELGLFKI-KAEIGIASGVRRIEAFSGMSAYRY.. 701
341 9.000e-77UniRef50_A0A2V7W2H5 Alanine--tRNA ligase n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V7W2H5_9BACT  ali  20  580.RLDTTANHTATHLLHKALKDILGPTVQQAGS-LVAPDRLRFDYTYHQPLTEQQTKAIEDAVNEKIRANLEVTKTVMPIEEAKKSGAVAMFG----EKYGEQVRIVAAGDYSREFCGGCHVNRTGDIGLFKIVSD-RSIAAGVRRMEALTGRGALAY.. 729
342 1.000e-76UniRef50_C6XZP3 Alanine--tRNA ligase n=29 Tax=root TaxID=1 RepID=C6XZP3_PEDHD  ali  22  581.RLLSQDNHTATHLLHAALKKVLGSHVNQKGS-LVNPDYLRFDFSHFARVTDEELSQIEHLVNQKIRENIPLEQRYVPYDQAISSGVTALFG----EKYGDLVRIITFDDYSKELCGGTHVQATGQIGYFKII-AESAVAAGVRRIEAITADKAEAFV. 733
343 1.000e-76UniRef50_UPI0009FB239D alanine--tRNA ligase n=1 Tax=Herbaspirillum hiltneri TaxID=341045 RepID=UPI0009FB239D  ali  21  318.RAQTMRNHSATHLMHKALREVLGDHVSQKGS-LVDADKTRFDFSHNAPMSADEIRRVEEIVNREILANAATEAKLMGYDDAVGAGAMALFG----EKYGDEVRVLSIGS-SRELCGGTHVSRTGDIGLFKIV-AESGVAAGIRRVEAVSGEGALALVQ 468
344 1.000e-76UniRef50_A0A259PR50 Alanine--tRNA ligase (Fragment) n=1 Tax=Thiomonas sp. 14-66-4 TaxID=1970450 RepID=A0A259PR50_9BURK  ali  26  493.RLATMRNHSATHLLHKALRLVLGEHVQQKGS-LVDAEKTRFDFAHDAPISADEIARIERWVNAQILLNAPTQARVLPIEEAKKTGAMMLFG----EKYGDQVRVLDIGD-SRELCGGTHVARTGDIGSLRVVSQ-GSVAAGVRRIEATTGMNALALAQ 643
345 1.000e-76UniRef50_A0A2E1E286 Alanine--tRNA ligase n=1 Tax=Dehalococcoidia bacterium TaxID=2026734 RepID=A0A2E1E286_9CHLR  ali  23  290LRDGSKRNHTGTHMLHAALREILGTHVHQQGS-LVSPTRLRFDFTHMKKLSDDEIDSIENLINSKIRSNIEVKKHETTYSEAIKQGAIAFFG----DKYSKDVRTVEISNFSFELCGGTHCEKTGEIGSFYIVS-ESSISSGVRRIEAVTGTNADQFAK 445
346 1.000e-76UniRef50_A0A2E5VGI2 Alanine--tRNA ligase n=1 Tax=Gammaproteobacteria bacterium TaxID=1913989 RepID=A0A2E5VGI2_9GAMM  ali  24  301IRKKIALNHSATHLLHASLRKVLGDHVEQKGS-LVDSQKLRFDFTHSKSISEEDILKVEDLINDEIIKNSPSKIEILTMDEAQKKGAIAFFG----DKYGEEVRVLDLGGFSVELCGGTHVKKSGDIGFMKIIS-ESGISAGVRRIEAVTGGGAKDLF. 453
347 1.000e-76UniRef50_A0A259CM33 Alanine--tRNA ligase n=9 Tax=Proteobacteria TaxID=1224 RepID=A0A259CM33_9HELI  ali  21  544.RNEIAKHHSATHLLHAALYEVLGEHISQAGS-LVEHNRLRFDFSHPKAMTSEEVALVEERVNQHIFHALSTLTKEMSIEEAKKSGAKAQFG----EKYGDRVRVVDFGGASVEFCGGTHVENTSIIGTFIITK-ESGVSAGVRRIEAVCGNAAYNVFK 695
348 1.000e-76UniRef50_A0A1Q7FN70 Alanine--tRNA ligase n=1 Tax=Armatimonadetes bacterium 13_1_40CM_64_14 TaxID=1805026 RepID=A0A1Q7FN70_9BACT  ali  21  567.RQDIMRNHTATHLLHRALQDVLGERARQAGS-LVAPDRLRFDFAHPTALSADQRAAVERQVNERVLADLPVRARWMGYQEALALGAMALFG----EKYGERVRVITIGEYSKELCGGTHLSHTSQAGLFKIT-TEGSVAAGTRRIEAVTGRGTAALLE 718
349 1.000e-76UniRef50_A0A1Y5R6J8 Alanine--tRNA ligase n=78 Tax=Proteobacteria TaxID=1224 RepID=A0A1Y5R6J8_9RHOB  ali  19  557.RSMIRANHSATHLLHEALRETLGDHVAQRGS-LNAPDRLRFDFSHAKALTDEEIAKVEADVNAYIRQNSPVETRIMTPDEARALGAQALFG----EKYGDEVRVVSMGTYSLELCGGTHVRRTGDIGAFVLTSD-SASSAGVRRIEALTGAAALEYL. 719
350 1.000e-76UniRef50_A0A250I822 Alanine--tRNA ligase n=4 Tax=Bacteria TaxID=2 RepID=A0A250I822_9DELT  ali  22  577.RSSIRANHSATHLLHRALKLVLGEHVKQAGSV-VAADYLRFDFSHFSPMTPEQQEQVEDLVNGWVRENTEAQTRIMSLDEAKKSGAVAMFG----EKYGETVRVVTVHPQTTELCGGTHVRRSGDIGLFKIVS-ESGVASGVRRINAVTGLGALQYV. 727
351 1.000e-76UniRef50_A0A0S7Y0J3 Alanine--tRNA ligase n=1 Tax=Coxiella sp. DG_40 TaxID=1703354 RepID=A0A0S7Y0J3_9COXI  ali  20  537.RQDISINHTTTHLLHAALRQILGSHVEQKGS-LVSDERLRFDFSHFEALTTQQIQTVETLVNQNIRANLPVKRELMTFDQAKKKDVIALFEG----KYANRVCVVSIGDLSAELCGGTHINATGEVGLFLIISEE-AIAAGIRRIEAITGRKAY.... 684
352 1.000e-76UniRef50_A0A2G4IH36 Uncharacterized protein n=2 Tax=unclassified Gemmatimonadetes TaxID=234665 RepID=A0A2G4IH36_9BACT  ali  19  67.RRDITRNHTATHLLHAALRTLLGDHVHQAGSV-VDPDRLRFDFTHHGPLTPSEVAKVERWVNEGIWQHSAVKTSEKAYADAVSGGAMALFG----EKYGAVVRVVEIAPRSVELCGGTHVANTGHILLFRVVS-ETGVSAGVRRITAVTGPKAFEML. 217
353 1.000e-76UniRef50_N1UYT5 Alanine--tRNA ligase n=2 Tax=Leptospira interrogans TaxID=173 RepID=N1UYT5_LEPIR  ali  25  305.RERLKFHHSGTHLLNGALRTLLGDHVLQKGSI-VSPEYLRFDFSHPSSLTSEEIRQIESWVNESIRKNFPVETKELSIEDAKKTGAVATFG----EKYGERVRVVQMGDASIEFCGGTHVSRTGEIGYFFI-KKESSPGAGNRRIEGVCGPAVIETFQ 456
354 1.000e-76UniRef50_P61708 Alanine--tRNA ligase n=167 Tax=root TaxID=1 RepID=SYA_TREDE  ali  25  457..EQTTAYHTATHLLHKALRMVLGDHVQQKGSN-ITAERLRFDFSHPEPMTEAEKKEVERLVNEAIKADLPVTMEVMPLEEAKKIGAMALFG----EKYEDVVKVYKIGDFSTEVCGGPHVERTGSLGRFCIKKEQSS-SSGVRRIRAV.......... 597
355 1.000e-76UniRef50_A0A258AHH4 Alanine--tRNA ligase (Fragment) n=1 Tax=Aerococcus viridans TaxID=1377 RepID=A0A258AHH4_9LACT  ali  21  363..HSIEKNHTATHLLHQALKDVLGDHANQAGS-LVTADHLRFDFSHFGQVTDEELAEMEAKVNEAIAEAFPVVTTVTTIDQAKAAGAQALFG----EKYGNEVRMVDVNHWSIELCGGTHVANTAEIGVFKITS-ESGIGAGVRRIEAVTSLAAIQEYQ 513
356 2.000e-76UniRef50_A0A1V9V9S8 Alanine--tRNA ligase (Fragment) n=3 Tax=Arcobacter cryaerophilus TaxID=28198 RepID=A0A1V9V9S8_9PROT  ali  25  60.RHEIEKHHSATHLLQSALRMVLGDSVSQAGSFN-DANKLRFDFTYPKAMTSEQINEVEDLVNSMIARALKGKVEELPLELAKKKGAIAMFG----EKYGEVVRVVSFGDVSVEFCGGTHVRNVSEIGSFYIVK-ESGVSAGIRRIEAVVGASAIKYAK 212
357 2.000e-76UniRef50_A0A2M7RMK4 Uncharacterized protein n=1 Tax=bacterium (Candidatus Howlettbacteria) CG_4_10_14_0_8_um_filter_40_9 TaxID=2014279 RepID=A0A2M7RM  ali  27  152.....TKYHTASHLLHQALKMVLGDHVKQAGSN-ITAERARFDFSHPEKLTPEEISEVENIVNSEIEKGLDVVYEEMPLDEAKKSGAIGIFDS----KYGEKVKVYSIGDFSKEICGGPHVKNTKELGHFKIKKEESS-SAGVRRIKAV.......... 289
358 2.000e-76UniRef50_A0A1W9SYR2 Alanine--tRNA ligase n=1 Tax=Desulfobacteraceae bacterium 4572_130 TaxID=1971625 RepID=A0A1W9SYR2_9DELT  ali  20  561.RENICLNHTATHILHTGLRNVLGDHVKQSGS-LVTNKRLRFDFIHFSAIEKKDIEKIEKNVNKIIRANYNVNTFEMSMDKAVESGATALFE----EKYGDKVRVVSIDKISKELCGGTHTTQTGNIGLFKIVS-ETGIAAGVRRIEALTGENALEYI. 711
359 2.000e-76UniRef50_V7GU68 Alanine--tRNA ligase n=11 Tax=Rhizobiales TaxID=356 RepID=V7GU68_9RHIZ  ali  22  514.RTRLRANHSATHLIHEALREVLGTHVAQKGS-LVAPERLRFDISHNKPISAEDLEEVERMANEIVVQNSPVTTRLMSVDDAIAEGAMALFG----EKYGDEVRVVSMGPYSVELCGGTHVRATGDIGLVRVVSD-SAVAAGVRRIEALTGEAARKHLD 675
360 2.000e-76UniRef50_A0A2J0M5Q6 Alanine--tRNA ligase n=3 Tax=root TaxID=1 RepID=A0A2J0M5Q6_9BACT  ali  23  302....TTKYHTATHLLHAALRKVLGEHVQQKGSN-ITAERLRFDFSHGEKMTEEEIRQVEDFVNNAIAADLSVSCEEMSVSEAKAQGAMGLFES----KYGDKVKLYSIGDISKEICGGPHVERTGDMGHFKITKEQAS-SAGVRRIKAV.......... 440
361 2.000e-76UniRef50_A0A1F4TQA1 Alanine--tRNA ligase n=5 Tax=Candidatus Saganbacteria TaxID=1703751 RepID=A0A1F4TQA1_9BACT  ali  23  535.RQAISIHHTATHLLHKALQEVLGGHVKQAGS-YVGPDKLRFDFSHISAVTPEELAQVEDLVNKKIKEHLKVEVLNKSYKDAVKMGAMALFG----EKYGDKVRVLKIADYSLELCGGTHVRSTADIYFFRIVN-ESSLGAGLRRIEAVAGQVAISSL. 685
362 2.000e-76UniRef50_F0QZ42 Alanine--tRNA ligase n=108 Tax=Bacteria TaxID=2 RepID=F0QZ42_BACSH  ali  23  556.RAACAANHSCTHLLDEALRQVLGTHVEQKGS-LVTPESLRFDFSHFQKVTPEQLREVEHLVNAKIRENVPLEYRNLPIEKAKELGAIALFG----EKYGDEVRVVQFGS-SIEFCGGTHVSATGKIGMVKILS-ESSVAAGVRRIEAITGAKVEEMMD 707
363 2.000e-76UniRef50_G2IHI4 Alanine--tRNA ligase n=6 Tax=Clostridiaceae TaxID=31979 RepID=G2IHI4_9CLOT  ali  20  558.RKSICRNHTATHLLQSALRSVLGNHVKQSGSYL-DDKKLRFDFTHFKALTHDEIKRVEDMVNEYIYKQINVKTELMDIISAKEKGATCLFD----EKYEDEVRVLSVDDFSMELCGGTHVTNTGFIGSFIITS-ESSVSSGVRRIEATTGSNVFDIVK 709
364 2.000e-76UniRef50_R5EQD2 Alanine--tRNA ligase n=1 Tax=Firmicutes bacterium CAG:110 TaxID=1263000 RepID=R5EQD2_9FIRM  ali  21  231.RKAIMRAHSATHLLQKALQTVLGDHVHQAGS-YVEPDRLRFDFTHYSALTPEELVKVNAIVQNSILEGYNIVTREMPVDEAKAMGATALF----SEKYGSTVRVVNMGNYSIELCGGTHLDNTAKVGPFEIES-ECSVASGVRRIEAITGKACLERME 382
365 2.000e-76UniRef50_UPI0009EE8CBA alanine--tRNA ligase n=2 Tax=Oleiphilus TaxID=141450 RepID=UPI0009EE8CBA  ali  20  244.RDATALNHSATHLLHAALRQILGEHVVQKGS-LCNGERLRFDFAHYEAVTPEQLLEIESMVNARIRENSLVTTTLTDIKTAKQMGAMALFG----EKYGENVRVLSMGDFSVELCGGTHAQRTGDIGSLVIVS-EGGISSGVRRIEALSGAEAEAW.. 395
366 2.000e-76UniRef50_A0A2W6Y6V4 Alanine--tRNA ligase (Fragment) n=1 Tax=Chryseobacterium sp. TaxID=1871047 RepID=A0A2W6Y6V4_9FLAO  ali  21  177.RKNSQANHSVTHLLHEALRNVLGTHVEQKGSF-VGPDYLRFDFSHFSKMTDEELKLVEDKVNAKIKESIALEFRSIPIQEALDRGAMALFG----EKYGDNVRMIQFG-TSMELCGGTHVKNTSEIGHFKIVS-ESSAAAGIRRIEAISGDKSAEYFK 328
367 3.000e-76UniRef50_A0A1F9XCE5 Alanine--tRNA ligase n=7 Tax=unclassified Elusimicrobia TaxID=1797919 RepID=A0A1F9XCE5_9BACT  ali  22  548.RKNIMRHHTTTHLLHKALRTVLGEHATQSGS-LVAPERFRFDFVHFKSLDARELARIEEIVNEKIMECLKVNVKLTTLKEAREMNATALFG----EKYKDDVRCVFVGDYSMELCGGTHCKNTGEIGLFKII-AETSVGSGLRRIEGVCGKMALKYI. 703
368 3.000e-76UniRef50_A0A2P1P6X3 Alanine--tRNA ligase n=1 Tax=Candidatus Phycorickettsia trachydisci TaxID=2115978 RepID=A0A2P1P6X3_9RICK  ali  20  553.RDNIRKNHTATHLLHSALKKVLGTHVMQKGS-LVAADRLRFDFNYDKPLSLGQIEQIETQVNGVIIRNLEVKISIMDKDKAEAMGAMMLFG----EKYDDKVRVISVGNDSIELCGGTHVARSGDIGLFKIVSQ-TSVASGVRRIEAVVGLDALDLVQ 705
369 3.000e-76UniRef50_H5SGJ5 Alanine--tRNA ligase n=1 Tax=uncultured Bacteroidetes bacterium TaxID=152509 RepID=H5SGJ5_9BACT  ali  20  552.REALSRHHTATHLLHAALRQVLGTHVRQSGS-LVAPDRLRFDFTHPQRLTPEEIQALETIVNQKIEEALPIEYRDIAYEEALQKGALAFFG----EKYGERVRMIEFGDFSRELCGGTHVSNTLELRFFKILS-EMASAAGVRRVEAVAGKAYIDWVE 705
370 3.000e-76UniRef50_A0A1W6BUP0 Alanine--tRNA ligase n=31 Tax=Campylobacteraceae TaxID=72294 RepID=A0A1W6BUP0_9PROT  ali  25  544.RQQIARHHSATHLLHFALRKILGTHISQAGS-LVEFNKLRFDFTHPKALSKEELESIENLVNEMILNSHEAKLEILPLDEAKKSGAIALF----NEKYQEKVRVLTLGE-SKELCGGTHVENTAQIGSFFIIK-ESGVSAGVRRIEAVVSKAALNFNQ 694
371 3.000e-76UniRef50_A0A0S7XAR8 Alanine--tRNA ligase n=1 Tax=Latescibacteria bacterium DG_63 TaxID=1703781 RepID=A0A0S7XAR8_9BACT  ali  21  543.RESTARNHTATHLLHHALRKVLGDHVRQAGS-LVAPDRLRFDFTHFQALSLAEIEEIEDVTNELVLEDIPVRPAVSSYRDAIEEGAIALFG----EKYGEKVRQVVVGDVSRELCGGTHVERTGQVGHFLVIS-ESAVGSGIRRIEAVTGYAARSLI. 693
372 3.000e-76UniRef50_A0A2D0A587 Alanine--tRNA ligase n=4 Tax=Pedobacter TaxID=84567 RepID=A0A2D0A587_9SPHI  ali  21  581.RVLTEDNHSATHLLHAALKQVLGQHVNQKGS-LVNADYLRFDFSHFAKVTDEELAQIEVIVNQKIRANIKLEQRNVPYQDAIESGVTALFG----EKYGDFVRMITFDDFSKELCGGTHVKATGQIGSFKIVS-ESAVAAGVRRIEAITADKAEQYF. 733
373 3.000e-76UniRef50_A0A1Z8NHJ1 Uncharacterized protein (Fragment) n=1 Tax=Synechococcus sp. TMED20 TaxID=1986597 RepID=A0A1Z8NHJ1_9SYNE  ali  22  51.RKATTRNHTGTHMLHAALKQIIGQHVNQAGSI-VHPDYLRFDFTHSERLSSDQVEEIERLVNRKIRENIDLNVFETGYRQAVDSGVTALFG----EKYGDTVRVVQLDDFSSELCGGCHTSATGEIGSFRIVS-EGAIASGVRRIVAVTGERAEE... 199
374 3.000e-76UniRef50_A0A2N2KIG0 Alanine--tRNA ligase (Fragment) n=2 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A2N2KIG0_9DELT  ali  21  253.RKAIQANHSGTHILQAALKAVLGDHIKQSGS-LVNTERLRFDFSHFSKITDEELSRIEEIANDIIRKNIKVVTEVCALEDAMKTGATAVFD----EKYGATVRIVKMGEMSMELCGGTHVDRTGDIGLLKVL-HESAIAAGVRRLEAVTGKQALVHVQ 404
375 4.000e-76UniRef50_A0A1J4VDG2 Alanine--tRNA ligase n=1 Tax=Candidatus Hydrogenedentes bacterium CG1_02_42_14 TaxID=1805216 RepID=A0A1J4VDG2_9BACT  ali  22  555.RLSTERNHTSTHLLHAALRKILGEHVQQAGS-YVGPDRLRFDFSHFKAMTEKEIAQVEAEMNAYVIENLPVSTKVYPIDEAKKLGAMAFFG----DKYGELVRVVSVQGISREFCGGCHVRRVGEIGMVKIIS-ETAVSSGMRRIEAVTGSKAVEEI. 715
376 4.000e-76UniRef50_A0A2A4VIR5 Alanine--tRNA ligase n=2 Tax=Proteobacteria TaxID=1224 RepID=A0A2A4VIR5_9PROT  ali  22  223.RTATMRNHSATHLMHKALREVLGAHVQQKGS-LVDTEKTRFDFVHNAPMTNEQIREVERIVNTEVFTNAETQARVMDIESAKDTGALMLFG----EKYGDEVRVLDIGS-SCELCGGTHVERTGDIGLFSIV-AEGGVAAGVRRVEAVTAANALRYMQ 373
377 4.000e-76UniRef50_A0A1E2S374 Alanine--tRNA ligase n=3 Tax=Rhizobiales TaxID=356 RepID=A0A1E2S374_9RHIZ  ali  22  136.RAGSRAHHSATHLLHEALRRVLGTHVAQKGS-LVEPGRLRFDFSHTKPMTHEQIEEVETLANRMILQNSAVETHLMSPDEAIEKGALALFG----EKYGDEVRVVSMGTYSIELCGGTHVGRTGEIGIMKIVG-ETAVGSGTRRIEALTGEAARTYL. 296
378 4.000e-76UniRef50_A0A2N6HI32 Alanine--tRNA ligase n=1 Tax=Nitrospira sp. CG24A TaxID=1985133 RepID=A0A2N6HI32_9BACT  ali  21  393.RHDAQRNHTATHLLHAALRDMLGPHVKQYGS-LVGPNRLRFDFAHFRPLSSRDVDEIETVVNNEVRKNERVATEVMSIQDAVAKGALAFFG----DKYGEQVRVVTVESFSKELCGGTHCRQTGDIGLFRIVS-ETGVAAGVRRIEAQTGSGALTHMK 544
379 4.000e-76UniRef50_D3FCU1 Alanine--tRNA ligase n=10 Tax=Thermoleophilia TaxID=1497346 RepID=D3FCU1_CONWI  ali  19  563.RHATEANHTATHLLHAALRRRLGGHVRQAGSA-VQPDKLRFDFTHGQALSPDELRDVEDEVNEWVLANFPVRALTTTLDEAKRLGAMALFG----EKYGDVVRMVEVGDFSRELCGGTHVRSTAEIGLFRVT-AETSSAANVRRIEAITGPAAVRLL. 715
380 4.000e-76UniRef50_A0A2G6P2A7 Alanine--tRNA ligase n=2 Tax=Bacteria TaxID=2 RepID=A0A2G6P2A7_9BACT  ali  26  554.RDKCRANHSATHLLQSTIKEVVGDHVAQSGS-YVDDKGLRFDYSHFDKLTLEEIGSIEYILNKKIRENLPVVTEEKSIDEAKKMGATALFG----EKYGDNVRVVSMGDFSMELCGGTHVKRSGDIGQFKIIS-ETSISSGIRRIEAVTGDEAV.... 701
381 4.000e-76UniRef50_A0A2S8SXA9 Alanine--tRNA ligase n=1 Tax=Abditibacterium utsteinense TaxID=1960156 RepID=A0A2S8SXA9_9BACT  ali  22  544.RRAIERAHSATHLLHAALRGHLGKHVEQRGS-LVEGDRLRFDFVHFSAISSEELQKIEATVNEEILASLPVEIAEKTLAEARAMGAMALFG----EKYGDVVRTVKMGDFSLELCGGTHLSTTSAAGLLRIVS-EGGVGANVRRIEALTGEAAFEH.. 693
382 4.000e-76UniRef50_M6GJE1 Alanine--tRNA ligase n=4 Tax=Leptospira interrogans TaxID=173 RepID=M6GJE1_LEPIR  ali  25  305.RERLKFHHSGTHLLNGALRTLLGDHVLQKGSI-VSPEYLRFDFSHPSSLTSEEIRQIESWVNESIRKNFPVETKELSIEDAKKTGAVATFG----EKYGERVRVVQMGDASIEFCGGTHVSRTGEIGYFFI-KKESSPGAGNRRIEGVCGPAVIETFQ 456
383 4.000e-76UniRef50_A0A2A2SAG1 Alanine--tRNA ligase n=7 Tax=Bacteria TaxID=2 RepID=A0A2A2SAG1_9SPHI  ali  22  235.RHSTEANHSATHLLHAAMKQVLGSHVNQKGS-LVNADYLRFDFSHFAKVTDEELAKIEAIVNEKIRENIALEERSVLYAEAIQSGVTALFG----EKYGEYVRVITFDDFSKELCGGTHVRATGQVGYFKIT-AENAVAAGVRRIEAITGIAAETYI. 387
384 4.000e-76UniRef50_R6X5U2 Alanine--tRNA ligase n=1 Tax=Parabacteroides merdae CAG:48 TaxID=1263094 RepID=R6X5U2_9BACT  ali  24  194.RIQCECNHSATHLLHEALREVLGTHVEQKGS-YVSPDSLRFDFSHFQKVTDEEIRKVEKLVSEKIRANYPLEHRNMPIAEAKALGAMALFG----EKYGDEVRVVKYGN-SIELCGGTHIPATGMIGSLRVVG-ESSIAAGVRRIEAVTAEAAENY.. 343
385 4.000e-76UniRef50_A0A290Q924 Alanine--tRNA ligase n=1 Tax=Verrucomicrobia bacterium TaxID=2026799 RepID=A0A290Q924_9BACT  ali  24  647.RRAISRHHSAAHLIHWALRKVLGTHVRQAGTS-KTPDRMRFDFSHFEAVTPAQLREVEQLVNEKVLDNAKVETYETEFDK-KPEGTLAFFG----DKYGKFVRVVDIGGYSRELCGGTHVSTTGEIGLIKVVS-EAAIAAGTRRIEAVAGQAALDYI. 796
386 4.000e-76UniRef50_A0A1F7S0R9 Alanine--tRNA ligase n=1 Tax=Candidatus Schekmanbacteria bacterium RBG_13_48_7 TaxID=1817878 RepID=A0A1F7S0R9_9BACT  ali  22  562.RQDIRLNHTSTHLLHAGLRSVLGDQVKQAGS-LVAPDKFRFDYTHFTQPNQRELEMVEDFVNESVRASYPVQTEVMNLDDAVKSGAMALFG----EKYHEKVRVVTINGISKELCGGTHISNTGQIGLFKIIK-EGSISSGIRRIEAVTGHHALEF.. 711
387 5.000e-76UniRef50_T1AI47 Alanyl-tRNA synthetase (Fragment) n=2 Tax=root TaxID=1 RepID=T1AI47_9ZZZZ  ali  18  11.RQAIVLNHSATHLLHAALRAVLGTHVQQKGS-LVAPERLRFDYSHTAPLNAAQRAEIETRVNAAIRANHATEVRHMAYQQALDFGAMALFG----EKYGDEVRVLRLGEASTELCGGTHVARTGDIGLFKII-AETGVAAGVRRVEALTGAAALAWVE 162
388 5.000e-76UniRef50_Q1GSD9 Alanine--tRNA ligase n=458 Tax=root TaxID=1 RepID=SYA_SPHAL  ali  19  558.RDRIRANHSATHLLHAALRNRLGGHVTQKGS-LVAADRFRFDFSHPKALTAAEIADIEADVNAQIRGNEPVTTRLMTPDDAIAAGALALFG----EKYGDEVRVLAMGNYSVELCGGTHVRALGDIALFKIVS-ESAVSSGVRRIEALTGEAARQWL. 713
389 5.000e-76UniRef50_A0A2M7XUX5 Alanine--tRNA ligase (Fragment) n=1 Tax=Candidatus Marinimicrobia bacterium CG_4_9_14_3_um_filter_48_9 TaxID=1975523 RepID=A0A2M7  ali  21  174.RQAIKLNHSATHLLHAALRLVLGDHVKQAGS-LVTDTHLRFDFNHFEKVSDSDLTRIEMLVNREIRKNDQTAISVKTFDEAKQAGALAFFG----EKYGDEVRTIKFGDFSFELCGGIHVQATGDIGSLRITS-ESAVAAGVRRIEAVTGHAAEE... 322
390 5.000e-76UniRef50_A0A2E8SGI7 Alanine--tRNA ligase (Fragment) n=1 Tax=Rhodobacteraceae bacterium TaxID=1904441 RepID=A0A2E8SGI7_9RHOB  ali  19  86LRLDIKRNHSGTHLVHEALRRIVGEHVAQRGS-LNNADRLRFDFSHDKPVTEEQIFLVEQLVNKQIRENTPVVTEIMQLDRAKQQGARALFG----EKYGDDVRVVKMSPFSIELCGGTHVNSTGDIGFLKIIG-ESASSSGVRRLEAVTGKKVVDFIE 243
391 5.000e-76UniRef50_A0A1W9GSK5 Alanine--tRNA ligase (Fragment) n=2 Tax=Nitrospira TaxID=203693 RepID=A0A1W9GSK5_9BACT  ali  22  376.RQDAARNHTATHLVHAALRDLLGPHVKQYGS-LVGPNRLRFDFAHFRPLSSRDIDEIESTVNEEIRKNEAVSTEVMSIQDAVAKGALAFFG----DKYGEQVRVVSVESFSKELCGGTHCRQTGEIGLFRIVS-ETGVAAGVRRLEAQTGSGAYNQIK 527
392 5.000e-76UniRef50_Q6MB06 Alanine--tRNA ligase n=28 Tax=root TaxID=1 RepID=SYA_PARUW  ali  27  557.RQKIANNHTATHLLHWALHQILGEHIKQAGSV-VDPQRLRFDFSHHKALSLEESRQIEDLVNQKIRENLPVKCYEIKYEEAQKKEDIKQFFG---EKYGSTVRVIDI-DYSKELCGGTHTSALGNIGLFRILK-ESGIAAGIRRIEAVTGAEA-ELLQ 707
393 6.000e-76UniRef50_A0A1F5S5L5 Alanine--tRNA ligase n=5 Tax=Bacteria candidate phyla TaxID=1783234 RepID=A0A1F5S5L5_9BACT  ali  23  471..EQTTKYHTATHLLHQALRQVLGDHVQQKGSN-ITAERLRFDFSHPDKMTPEQIAEVENIVNEQIRKALPVHSEEMTVEEAKEAGALGFFES----KYGEKVKVYSVGSFSREICGGPHIKNTSELGQFKIKKEESS-SAGVRRIKAV.......... 619
394 6.000e-76UniRef50_A0A2N3B135 Alanine--tRNA ligase n=1 Tax=Alphaproteobacteria bacterium HGW-Alphaproteobacteria-7 TaxID=2013670 RepID=A0A2N3B135_9PROT  ali  18  583.RDRIRANHSATHLVHAALRNRLGGHVTQKGSM-VAEERLRFDFSHPAPLTPDDIAAVEAEVNAEIRANEQVSTRLMTPDDAVEAGALALFG----EKYGDEVRVLSMGSYSVELCGGTHVRATGDIGVFRIVS-ESAVSSGVRRIEALTGEAARAWL. 740
395 7.000e-76UniRef50_A0A2E4MF66 Alanine--tRNA ligase (Fragment) n=2 Tax=Candidatus Marinimicrobia bacterium TaxID=2026760 RepID=A0A2E4MF66_9BACT  ali  21  293.RNSIKRNHTATHLLHASLKIVIGDHVQQAGS-LVHPEYLRFDLTCFEKITPGQIHEIEKLVNSEILINNNLKVSTKSYDEAMKDGVVALFG----EKYGDQVRVVSTGEFSSELCGGTHVNSTGDIGMFKIT-EESSLASGVRRIIAITGNAALEAFQ 444
396 7.000e-76UniRef50_A0A2W6CQZ2 Alanine--tRNA ligase n=1 Tax=Acidimicrobiales bacterium TaxID=2201156 RepID=A0A2W6CQZ2_9ACTN  ali  22  566.RDSIRRNHTGTHLLHGALRRVLGPQVKQQGS-LVAPDRLRFDFSHHERLTPDQLAQVEDLVNQVIMANHAVRVTETSRAEAERRGAIAFFG----EKYGEVVRVVEAGPDSVELCGGTHVDALGMIGPISIVS-EGSIGAGIRRIEALTGEGSFGHI. 716
397 7.000e-76UniRef50_A0A1Q2MAH7 Alanine--tRNA ligase n=12 Tax=Bacteria TaxID=2 RepID=A0A1Q2MAH7_9BACT  ali  20  570.REATRKNHTATHILQWALREVLGDSVSQQGS-LVNSEYLRFDFTWPKALSPEELHQVEKLVNMRIGMELPVQVAVMPIEEAKELGATALFG----EKYGDTVRVISIGGFSLEFCGGTHIDNIGRIGGFKVVREES-ISAGVRRITAVTGPAYNKYME 730
398 7.000e-76UniRef50_A0A1F6LJR9 Alanine--tRNA ligase n=1 Tax=Candidatus Lindowbacteria bacterium RIFCSPLOWO2_12_FULL_62_27 TaxID=1817870 RepID=A0A1F6LJR9_9BACT :  ali  21  551.RQAIMKNHTGTHLLHAALRQILGDHVHQAGS-LVAPDRLRFDYTHGAALG-EQWPDIETRVNRWILGNLEVRIQEMSMAEAQRTGAMMLFD----EKYGDRVRVVQVGGESVELCGGTHCRATGEIGLLKIVSD-AALSAGVRRIEAVTGEGAVAYVQ 702
399 7.000e-76UniRef50_A0A1Z8SRR7 Alanine--tRNA ligase (Fragment) n=2 Tax=Verrucomicrobia TaxID=74201 RepID=A0A1Z8SRR7_9BACT  ali  24  166.RKAIQRHHTATHVLHWSLRTVLGKHIRQAGS-LVEPDRLRFDFSHFEGIKPEQIEEIEYISNKKILRNDGLEAYEVPFSE-KPEEVIAFFD----EKYGDSVRVVNLGGWSQELCGGTHVSSAGEIGSIRITS-ESAISAGTRRIEAVAGLSAYQW.. 314
400 7.000e-76UniRef50_A0A2A5E7S0 Alanine--tRNA ligase n=1 Tax=Candidatus Hydrogenedentes bacterium TaxID=2030809 RepID=A0A2A5E7S0_9BACT  ali  22  559.RASIKNHHTATHLLQAALQNVLGDHVHQAGSM-VADDRLRFDFTHFEGIDTARLRDIERLVNQYIRTGTPVTIDLKNLEDARAAGAMALFG----EKYEDVVRVISIGDISMELCGGIHVLQTGVIGTFKIL-TESSIASGVRRIEAVCGESAVDTLQ 710
401 7.000e-76UniRef50_A0A2T0TNH3 Alanine--tRNA ligase n=2 Tax=Bacteroidetes TaxID=976 RepID=A0A2T0TNH3_9BACT  ali  24  615.RAQIAANHSATHLLHSALRDVLGTHVAQKGS-YVGPDALRFDFSHFSKVTDEQLAEVERIVNEKIREDIPLEQRNVPIAQAKEMGATALFG----EKYGDFVRVITFDPYSVELCGGTHVNRTGHIGLFKFTG-EGSVSTGVRRIEAKTALGAETLV. 767
402 7.000e-76UniRef50_A0A0M8K956 Alanine--tRNA ligase n=4 Tax=Bacteria TaxID=2 RepID=A0A0M8K956_9CHLR  ali  22  560.RWDIMRNHTATHLLHRALRNVLGEHAEQRGS-LVAPDYLRFDFVHLQPVTREELQRIEQEVLANIIADEVVDWHYLPLEEALNQGAIALFG----EKYGETVRMVSIEDYSRELCGGTHVERTGQIGPFVITS-ESSISAGVRRIVALTGRKAAAFI. 716
403 8.000e-76UniRef50_A0A1G1IL61 Alanine--tRNA ligase n=1 Tax=Omnitrophica bacterium GWA2_50_21 TaxID=1801815 RepID=A0A1G1IL61_9BACT  ali  23  243LRDSTRRHHTATHLLQAALRQVLGSHVRQLGS-LVSPDKLRFDFSHPSPLKDNEIREVEDFVNKAVLLNLEVKTDIKSFEESQKAGALAFFG----EKYEDEVRILNVGGLSVELCRGTHVSKTGDIGAFFITS-ESSIASGTRRIEAVAGMAALDYL. 395
404 8.000e-76UniRef50_A0A1Z8WVP4 Alanine--tRNA ligase n=1 Tax=Methylococcaceae bacterium TMED69 TaxID=1986766 RepID=A0A1Z8WVP4_9GAMM  ali  22  553.RTRTTIHHSATHLLHAALRHELGKGVGQKGS-HVAANRMRFDFSHPEAISDFELQKIEMLVNSKIRENMIVETKIMDKADAINSGAIAFFD----EKYGDKVRVLSIGKFSIELCGGTHVSRTGELGFFKILS-ESSIGSGIRRIEALCGIEAEHH.. 702
405 8.000e-76UniRef50_A0A2E1PFT8 Alanine--tRNA ligase (Fragment) n=1 Tax=Pelagibacteraceae bacterium TaxID=2026775 RepID=A0A2E1PFT8_9PROT  ali  21  56.RELIKKNHSATHLLHAALRDNLGKHVTQKGS-LVNDDKLRFDFSHNKSIEKEAILKIEEDINNIIKQAHEVKTEIKSQEEAVKEGAMALFG----EKYGDKVRVVSMGQYSKELCGGTHVNKTSDIKEFKIIKEES-VASGVRRIEAITFEKVDEFLK 212
406 9.000e-76UniRef50_A0A1F4USE1 Alanine--tRNA ligase n=2 Tax=candidate division WWE3 TaxID=422282 RepID=A0A1F4USE1_9BACT  ali  24  461...ATTKLHTATHLLHQALREVLGSHVHQMGSN-ITSERLRFDFSHDTKMTDEQIKKVEDIVNQKIKEALPVNKTVMSKSEAERTGALHFFG----DKYGDEVSIYFIGDCSKEFCGGPHVKNTSELGSFKIIKEE-AVARGIRRIKALC......... 606
407 1.000e-75UniRef50_A0A2E5YKS9 Alanine--tRNA ligase n=2 Tax=Deltaproteobacteria bacterium TaxID=2026735 RepID=A0A2E5YKS9_9DELT  ali  24  559LRRATVRNHTGTHLLHAALRETLGEQAMQKGS-LVGPERLRFDFTHDSPLSEAEIDEIEDRVNVMIESNQAGTTREMDYPSAIKSGAIAIFD----EKYGDDVRVVSFGDCSTELCGGTHARATGEIGLLKIVS-ETGIAAGIRRIEALTGLDALRQI. 710
408 1.000e-75UniRef50_A0A1Z8SV75 Alanine--tRNA ligase n=1 Tax=Planctomycetia bacterium TMED53 TaxID=1986839 RepID=A0A1Z8SV75_9BACT  ali  24  553.RQHIQRNHTATHLLHAALRQVVGDHVQQKGS-LVSPDRLRFDISHYEKVSPEQLREVEGIVQDWILLDQEVCIHEVPIEEAKSRGAMALFG----EKYGDRVRMVEIGDFSIELCGGIHCGHTGEIGPMMIT-AEGSVSSGVRRVEALTGEE...... 699
409 1.000e-75UniRef50_Q8F0T4 Alanine--tRNA ligase n=158 Tax=Leptospira TaxID=171 RepID=SYA_LEPIN  ali  25  611.RERLKFHHSGTHLLNGALRTLLGDHVLQKGSI-VSPEYLRFDFSHPSSLTSEEIRQIESWVNESIRKNFPVETKELSIEDAKKTGAVATFG----EKYGERVRVVQMGDASIEFCGGTHVSRTGEIGYFFI-KKESSPGAGNRRIEGVCGPAVIETFQ 762
410 1.000e-75UniRef50_A0A1G0E737 Alanine--tRNA ligase n=2 Tax=root TaxID=1 RepID=A0A1G0E737_9GAMM  ali  24  564.RQAIRLNHSATHLLHNCLRLVLGENAMQKGS-YVDNKRLRFDFTHSSAPSAGELYEIEKLVNAQIRANLKVQTAIKSIEEAKQEGAFALFG----EKYGDEVRVVTMGEFSKELCGGTHVNSTGEVGLFKIIS-EASIASGIRRIEAVTGEN...... 709
411 1.000e-75UniRef50_A0A1I6L151 Alanine--tRNA ligase n=1 Tax=Granulicella pectinivorans TaxID=474950 RepID=A0A1I6L151_9BACT  ali  25  704IRTATERNHTGTHLLHAALREVLGKHVKQAGS-LVNQNRLRFDFSHFTGVSDQELDEIETIVNQQVLANAHVETLVVPIDVAKELGAMALFG----EKYGDRVRVVKIGDFSTELCGGTHTRATGEIGLIKLVG-ESSVSSGVRRLEAISGTGALHEF. 857
412 1.000e-75UniRef50_A0A101HZF4 Alanine--tRNA ligase n=2 Tax=unclassified Bacteria TaxID=2323 RepID=A0A101HZF4_9BACT  ali  23  538.RYLIQRNHTATHILHSVLRKVVGEHVRQEGSF-VSFDRFRFDFLHFKPLTDREKELIESSVNEIITQNLSVDKKVVPYEDALKEGALAFF----NEKYGKKVRVVTIKNVSKELCGGTHVEKTGEIGLFRILKEES-VATGIRRIEAVTSLYALKSYK 689
413 1.000e-75UniRef50_R5PZW5 Alanine--tRNA ligase n=1 Tax=Ruminococcus sp. CAG:724 TaxID=1262966 RepID=R5PZW5_9FIRM  ali  23  26.RAAIRRNHSAVHLLDAALRRVLGDHIAQAGS-YVDECRGRFDFTHFAAVTPDELKKAERMINEVILSDIKADIFETDIETAKKSGAIALFG----EKYGSTVRVVKFGDFSSELCGGCHVGATGEIGLFRIVS-ESSVAAGTRRIEIMTGMNAYNAV. 176
414 1.000e-75UniRef50_J0V0Y7 Alanine--tRNA ligase n=2 Tax=Helicobacteraceae TaxID=72293 RepID=J0V0Y7_9HELI  ali  22  537.RKEIAKHHSATHLLHSALREVLGDRVQQAGS-LVLADKLRFDFSHDGAVSSQNLDKVEEIVNRVIFRGVSQKTEILSPDEAKERGAMALFG----EKYGDEVRVVSFENESMELCGGTHVQNSSEIGTCLILK-ESGVSAGVRRIEAVVGESAYKYLK 688
415 1.000e-75UniRef50_B1GZ43 Alanine--tRNA ligase n=8 Tax=Elusimicrobia TaxID=641853 RepID=SYA_UNCTG  ali  16  554.RKQIARHHTAAHLLHKALREAFGGHITQAGS-LVARDYFRFDFTHFSALKKDDLIKIEKRVNSIIRLNSEVCIETMAIAKARNAGAMALFG----EKYGDEVRTVLIGNYSMELCGGTHVSRTGDIGIFKIIS-ESSAAAGVRRIEAVAGIAAENYI. 710
416 1.000e-75UniRef50_A0A1G1Q2S8 Alanine--tRNA ligase n=3 Tax=unclassified Candidatus Omnitrophica TaxID=1047005 RepID=A0A1G1Q2S8_9BACT  ali  21  575.RLSIMRNHTATHLLQNALREALGKHVQQQGS-YVSQDRLRFDFTHHKALTKQEIINVETLVNNYVIDCETVTKEFLTADQAKNIGALAFF----AEKYGEVVRVVSIGNYSKEFCGGTHLDTTGQIGLFKIVS-ENAIAQGIRRIEAKTGQGALEH.. 724
417 1.000e-75UniRef50_A0A1F9FWG3 Alanine--tRNA ligase n=2 Tax=unclassified Deltaproteobacteria (miscellaneous) TaxID=122706 RepID=A0A1F9FWG3_9DELT  ali  24  554.RAAIRKNHTATHLLHKALRTVLGEHVKQAGS-LVDDHHLRFDFSHFQKLTDEEMKKIETMINEAIKKNIPVTTHVLSYDEAIKRGAIAFFG----EKYGSVVRLVEVDNFSRELCGGTHVVSTGEIGEAQIM-TESSVAAGVRRMELVTGEAVKTW.. 703
418 1.000e-75UniRef50_A0A2E7SMD0 Alanine--tRNA ligase n=1 Tax=Acidimicrobiaceae bacterium TaxID=2024894 RepID=A0A2E7SMD0_9ACTN  ali  22  229.RSKIRRNHTATHLIHWALREVLGDHVKQQGS-YVGPDRLRFDFSHFEAMTAEQISSVEDLVNSEVLNNYQCSHQEMTRETAEEKGAIAFFG----DKYGDTVRVLEAGPNSLEFCGGTHVSALGDIGLVKIVS-EGSIGSNIRRIEAVTGSSTIE... 377
419 1.000e-75UniRef50_A0A2A2A9H8 Alanine--tRNA ligase n=7 Tax=Betaproteobacteria TaxID=28216 RepID=A0A2A2A9H8_9BURK  ali  21  658LRAATTRNHSVTHLMHKALRETLGEHVQQKGS-LVDEDKTRFDFVQNAPVTQEQLHRIEQLVNAEIVQDAPTVIREMGIEDAKASGAMMLFG----EKYGDVVRVVDIGE-SRELCGGTHVQRAGEIGLFKLV-MEGGVAAGVRRVEAITGAKALAYVQ 809
420 1.000e-75UniRef50_A0A2H0WCJ8 Alanine--tRNA ligase n=1 Tax=Bdellovibrio sp. CG10_big_fil_rev_8_21_14_0_10_47_8 TaxID=1975526 RepID=A0A2H0WCJ8_9PROT  ali  16  587.RDNTAANHSATHLLHSALREVLGTHVSQAG-QMVDAGRIRFDFTHNKAITSDELKQIEGMVNNEISGAHEVQTKIMKHQEALDEGAMALFG----EKYGDTVRVLKMGSFSTELCGGTHVNNTAQIRLFKIVS-ESGVSAGVRRIEALSGDVAIQY.. 736
421 2.000e-75UniRef50_A0A1V5Y5E3 Alanine--tRNA ligase n=1 Tax=candidate division BRC1 bacterium ADurb.Bin183 TaxID=1852823 RepID=A0A1V5Y5E3_9BACT  ali  22  592.RFAIMRNHTATHLLQGALRSVVGSHIAQQGS-YVTPECFRFDFANPEPLTAEQIARVEEIVQREILKDTEVVIREMPLEEARQLGAIAPFG----EKYGVVVRVVSIGDFSLEFCGGTHCSRTGQIGTFLIES-ESSIASGIRRIEAKTGMAAFAANQ 743
422 2.000e-75UniRef50_G8QK15 Alanine--tRNA ligase n=45 Tax=root TaxID=1 RepID=G8QK15_DECSP  ali  26  580.RSRTVRNHSATHLMHKALREVLGGHVQQKGS-QVDPDKTRFDFAHNAPMSDEEIRKVEAIVNAEVLANAATEAQVMGIDDAQKSGAMMLFG----EKYGDEVRVLSIGS-SKELCGGTHVTRTGDIGLFKIV-AESGVAAGVRRVEAVTGDN...... 724
423 2.000e-75UniRef50_A0A2V8XQ19 Uncharacterized protein (Fragment) n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8XQ19_9BACT  ali  25  430IREATMRNHTATHLLHAGLREVLGKHVKQAGS-LVAPNHLRFDFSHFTAVEDEELQDIEDMINKEVLRNQRVEIENVPIDVAVNEYAMALFG----EKYGDRVRVIKIGDFSTELCGGTHTGATGEIGLIKILK-EGSVSSGVRRVEAVTGEGSLRHF. 583
424 2.000e-75UniRef50_A0A2A5A095 Alanine--tRNA ligase n=5 Tax=Candidatus Marinimicrobia bacterium TaxID=2026760 RepID=A0A2A5A095_9BACT  ali  23  541.REAIRKNHTATHLMHKALKTVLGDHVQQAGS-LVGQDYLRFDLTHDVKIPSEELEKIEEMVNSQILLNIPLDVTIKGFDEAKKEGAETIFE----EKYGDKVRMITIGDFSKELCGGTHVERTGDIGFFKIT-EESSLSSGVRRIFAVTGIGALRYV. 691
425 2.000e-75UniRef50_A0A2V8KH74 Alanine--tRNA ligase n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8KH74_9BACT  ali  21  353.RLRIAANHTGTHILHAVLRETLGTHVKQAGS-LVAPDRLRFDYTHFAPLTDREIEEIEQKINRIVFRNLPVQTEVMEINQAIAKGALAFFG----EKYQQQVRVVSIPEVSMELCGGTHTRMTGDVGLFKIV-AESSIASGIRRIEALTG........ 496
426 2.000e-75UniRef50_A0A257UPV4 Alanine--tRNA ligase n=2 Tax=unclassified Deltaproteobacteria (miscellaneous) TaxID=122706 RepID=A0A257UPV4_9DELT  ali  21  182.RRLTEGNHTATHLLQAALRKILGAHVKQAGS-YVGPDKLRFDFSHFEALSPETLSAVEEEVNRVVFSPRPVTWESLPYEQAVAAGAMAFFG----EKYADIVRMVTVPEVSRELCGGTHVRNTAGIGLFHILS-EGAVAAGVRRIEAVTGLPAWR... 330
427 2.000e-75UniRef50_I0IPJ0 Alanine--tRNA ligase n=9 Tax=Leptospirillum TaxID=179 RepID=I0IPJ0_LEPFC  ali  21  558.RRQTEIHHTATHLLHAALRQVLGEHVRQAGS-LVTPDRLRFDFSSPHPVSKDDLLEIGTLVNEWVRLDRPVNALEMEKAKAQEVGALAFFD----EKYGDIVRVVSVEGTSTEFCGGTHAKRTGQIGTFLIL-QESGVAAGIRRVEAVCGSAAYDRI. 708
428 2.000e-75UniRef50_K6H0R2 Alanine--tRNA ligase n=4 Tax=unclassified Gammaproteobacteria TaxID=118884 RepID=K6H0R2_9GAMM  ali  24  543.RAAAASNHSATHLMHAALKHVLGSHVEQKGS-LVDASKLRFDFSHPKAVTKDEIKQIELLVNQHTLNNAEVKTELMKLDDAIASGAEAMFG----EKYDDEVRVLSMDGFSVELCGGTHVTRTGDIGMFIILS-ESSVSSGVRRIEAVTGSMAVE... 692
429 2.000e-75UniRef50_K6SED0 Alanine--tRNA ligase n=5 Tax=Lactobacillales TaxID=186826 RepID=K6SED0_LACCA  ali  21  313.RKKVSLNHTATHLLDQALRDVLGEHTHQAGS-LVEPDYLRFDFTNFGQVTPKQLRQVETIVNQKIWDALPITWKEMPIEEAKKLGAIAMFG----DKYGSVVRIVKIGDYNTEFDGGTHPTNSNALGLFKITS-ESGIGAGIRRVEAVTSKEAYEYL. 463
430 2.000e-75UniRef50_A0A2U3JVB5 Alanine--tRNA ligase n=16 Tax=Acidobacteria TaxID=57723 RepID=A0A2U3JVB5_9BACT  ali  26  633IREATMRNHTATHLLHAGLREVLGKHVKQAGS-LVAPNHLRFDFSHFTAVEDEELQDIEDIINKEVLRNTKIEIENVPIDVAINEYAMALFG----EKYGDKVRVIRIGDFSTELCGGTHTAQTGEIGLIKILK-EGSVSSGVRRVEAITGEGSLAHF. 786
431 2.000e-75UniRef50_A0A1F5RVB1 Alanine--tRNA ligase n=1 Tax=Candidatus Eisenbacteria bacterium RBG_16_71_46 TaxID=1817856 RepID=A0A1F5RVB1_9BACT  ali  20  578.RFPTMRHHTATHLLHAALRQELGEHVRQAGS-LVAPDRLRFDYTHFEAPSREQLEAIERLVQEWTLRNREVGWEIVPLEKAKAMGAMALFG----EKYGAEVRMVSVAGVSRELCGGTHVRRTGDIGAFVVVSD-AAIASGVRRIEALCGHEAMRWLK 736
432 3.000e-75UniRef50_B5JGJ0 Alanine--tRNA ligase n=8 Tax=Verrucomicrobia TaxID=74201 RepID=B5JGJ0_9BACT  ali  26  571.RRSIERHHSATHVLHWALRKVLGTHVHQAGS-YVDDQRLRFDFAHFEAIKPEQLALIEKLCNEQLLANNKVNWYETPFNE-KPKEVIAFFG----DKYGDVVRVVDIGGFSIELCGGTHVRATGEIGLLKIAS-ESGIAAGTRRIEAIVGDSLYSHI. 720
433 3.000e-75UniRef50_A0A1G3PE04 Alanine--tRNA ligase n=1 Tax=Spirochaetes bacterium GWF1_41_5 TaxID=1802188 RepID=A0A1G3PE04_9SPIR  ali  25  553.RIFTRKNHSATHLLQKALRTVLGDHIRQSGSR-VNDKKLRFDFNHFSALSSEQIGRIEEEVYRAVLADWPVTCTEMTKNEAEKSGALAFFE----EKYGERVRVVKMGDYSMEFCGGSHVKSTGEIGYFRITS-ESSSASGIRRIEAVTGMEAW.... 700
434 3.000e-75UniRef50_A0A2N2MCJ6 Alanine--tRNA ligase (Fragment) n=1 Tax=Chloroflexi bacterium HGW-Chloroflexi-7 TaxID=2013730 RepID=A0A2N2MCJ6_9CHLR  ali  18  194.RMDIMRNHTATHLLHAQLHKVIGEHARQAGS-LVAPDRLRFDFTHHEAILAEKLDQIEAGVNQAILEDHALSIKTKSLAEAKAEGAMALFG----EKYGEVVRTVTIDPISYELCGGTHVENTGDIGTFLILS-EGSAAAGVRRIEAVTGRAAYEVI. 347
435 3.000e-75UniRef50_A0A1C0B8F9 Alanine--tRNA ligase n=29 Tax=Bacteria TaxID=2 RepID=A0A1C0B8F9_9PROT  ali  26  546.RNEVMKHHSATHLLQSALKMVLGDSVSQAGS-YNDDLKLRFDFTYPKAMSTEQIDEVEDLVNSMINRALEGVIEELPLEEAKKKGAIAMFG----EKYGDFVRVVSFGDISIEFCGGTHVNNTRDIGSFYIVK-ESGVSAGIRRIEAVVGASAFRYVK 698
436 3.000e-75UniRef50_A0A0S4PZM6 Alanine--tRNA ligase n=6 Tax=Helicobacter TaxID=209 RepID=A0A0S4PZM6_9HELI  ali  23  585.RLEIAKHHSATHLLHKALRDVLGSHIAQAGS-LVESTRLRFDFSHPKAVSGEELAQIESLVNAAIARASKQECEYMGINEAKAKGAMALFG----EKYGDVVRVVRFGD-SIELCGGIHTGSTAEIGSFYIIK-ESGVSSGVRRIEAVCGAAAYSY.. 733
437 3.000e-75UniRef50_H8XPS1 Alanine--tRNA ligase n=27 Tax=Bacteroidetes TaxID=976 RepID=H8XPS1_FLAIG  ali  19  562LRTSTSKNHSATHLMHLALRSILGTHVEQKGS-LVNPNYLRFDFSHFSKVTDEELRQVEARVNQQIEAQLQLEYRNIPIQEALDKGAMALFG----EKYGDTVRMIEFGD-SKELCGGIHVKNTADIWHFKIIS-EGAVAAGIRRIEAITGDAVKAFYK 714
438 3.000e-75UniRef50_A0A2E5J8L1 Alanine--tRNA ligase n=2 Tax=Gammaproteobacteria bacterium TaxID=1913989 RepID=A0A2E5J8L1_9GAMM  ali  20  541.RRKITSNHSSTHLLHQALREVLGNHVQQQGS-LVNDKYLRFDFTHSDPLTDKQIKSIEKIIMNEIKQDTKTQIKNMSYEKAIQNGALAFFD----EKYEDNVRVLHIGSRSIELCGGTHVESTSSIGMFKIIS-ESSVSTGVRRIEAITGEEVYQDYQ 692
439 3.000e-75UniRef50_UPI0005973686 alanine--tRNA ligase n=1 Tax=Rickettsia asembonensis TaxID=1068590 RepID=UPI0005973686  ali  21  610.RQNLRIHHSATHILHAVLHEVLGKHVTQKGS-LVAPTYLRFDISHSKAVTNEEITLIEYKVNEIIRDNHEVNTTLMTTEDAVKQGAMALFG----EKYDSEVRVVKMGETSLELCGGTHVRRTGDIGCFKITS-ENAIAAGVRRIEAVCGEFVIKLM. 760
440 3.000e-75UniRef50_A0A254W2W2 Uncharacterized protein (Fragment) n=1 Tax=cyanobacterium TDX16 TaxID=1503470 RepID=A0A254W2W2_9CYAN  ali  23  164.RDAIRRNHTGTHILHWALRRVLGDHVKQQGS-LVAPDRMRFDFSHYEALSSDEVAAIEDMANKEILANDPVRHYETSKEHAAELGAIAFFG----DKYGDVVRVLEAGPHSIELCGGTHVRATGDIGPLKIVS-ESSIGSNLRRIEAVTGTGPIERL. 314
441 3.000e-75UniRef50_A0A024YR48 Alanine--tRNA ligase n=6 Tax=Streptomyces TaxID=1883 RepID=A0A024YR48_9ACTN  ali  23  564.RRATMRNHSATHLLHAVLREVLGDQVRQAGS-LVAPDRLRFDFEHPRALTEEEADQVERLVNGRVLVNAGRDVQVKPYQDAVRDGAVAFFG----DKYGDDVRVVSFGDVSSELCGGTHVSGTAEIGLFRIVG-EGSVGAGVRRIEAVTGEAALAY.. 713
442 3.000e-75UniRef50_A0A2M8PQ62 Alanine--tRNA ligase n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2M8PQ62_9CHLR  ali  19  480.RIAIMRNHTATHLLHAALRNRLGTHVQQRGS-LVAPDRLRFDFSHDQAMTHDEIYDVERDVNYAILEGLPVIARLKHLDEARAEGAMALFG----EKYGDIVRTISIGEYSYELCGGTHLANTAMIGSFIIV-QETSIAQGIRRIEAVTGEQAY.... 631
443 3.000e-75UniRef50_A0A1B1USI2 Alanine--tRNA ligase n=28 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A1B1USI2_9BRAD  ali  21  557.RSSIRAHHSATHLLHEALRQVLGDHIAQRGS-LVAPDRLRFDFVHPKPITAEELARVEDIANEVVLENDEVTTRLMAVDDAREAGARALFG----EKYGDEVRVVSMGGWSVELCGGTHVRRTGDIGLISVTG-ESAVASGVRRIEALTGRHARKH.. 717
444 3.000e-75UniRef50_A0A1W1VQR5 Alanine--tRNA ligase n=1 Tax=Desulfonispora thiosulfatigenes DSM 11270 TaxID=656914 RepID=A0A1W1VQR5_DESTI  ali  22  561.RKAIARNHTATHLLHKALKEVLGDHVNQAGSLL-NANSLRFDFSHFSQVTGTELEKIEDLINHEILQASLINVYETDIETAKKDNVTALF----NEKYGEKVRCVSIGEISLELCGGTHLKNTSEIGLFKIIS-EGSVASGIRRIEGVTGQKALELIK 712
445 3.000e-75UniRef50_A0A1W9VVR8 Alanine--tRNA ligase n=1 Tax=Candidatus Cloacimonetes bacterium 4572_65 TaxID=1972455 RepID=A0A1W9VVR8_9BACT  ali  23  547.RVKTSANHSATHLLHSALRTVLGTHVQQKGS-LVDSKGLRFDFTHFNGMSTKEIELVENMVNEQILKSSPLLTEVKTIEEAREDGAMALFG----EKYGDSVRVVSISDFSKELCGGTHVSNVGEIGLLKIVS-ESSSAAGIRRIEALTGLKVLELL. 697
446 4.000e-75UniRef50_A0A2D9HHH8 Alanine--tRNA ligase n=1 Tax=Candidatus Marinimicrobia bacterium TaxID=2026760 RepID=A0A2D9HHH8_9BACT  ali  22  265.RIKXKANHTATHLLHEALKRVLGDHVQQSGS-LVNEFKLRFDLTHYEKXTXKQINEIENIVNXQVRSNIQLNTKIQSFDDAKDDGAVALFG----EKYDDKVRVVDVPGFSKELCGGTHVXRTGDIGXFKIIS-ESSLSAGIRRIEAATGQEVLNRI. 415
447 4.000e-75UniRef50_Q89I89 Alanine--tRNA ligase n=1804 Tax=root TaxID=1 RepID=SYA_BRADU  ali  21  558.RSSIRAHHSATHLIHEALRQVLGDHIAQRGSM-VAPDRLRFDFVHPKPITAEELARVEDIANDVVLENDEVTTRVMGVDEAREAGARALFG----EKYGDEVRVVSMGGWSVELCGGTHVRRTGDIGLITLTG-ESAVASGVRRIEALTGNYARKH.. 718
448 4.000e-75UniRef50_V8CJX4 Alanine--tRNA ligase n=5 Tax=Helicobacter TaxID=209 RepID=V8CJX4_9HELI  ali  23  664.RFEIARHHSATHLLHYALRQILGAHIAQAGS-LVEANRLRFDFSHPKALSVNELEQIQALVNEKIAESSPQMCETMGIEQAKAKGAMALFG----EKYGESVRVISFGD-SIELCGGIHTQNTAEIGSFYIVR-ESSVSSGVRRIEAVCGKAAYSY.. 812
449 4.000e-75UniRef50_A0A1F3VUQ2 Alanine--tRNA ligase n=2 Tax=unclassified Bdellovibrionales TaxID=404130 RepID=A0A1F3VUQ2_9PROT  ali  20  551.RNLTARNHTATHLLHAALGKVLGDHVHQAGS-LVTDERLRFDFTHPKGLTNEELDQVASIVNQSIANQIPVSTKKMNTKEATASGAKALFG----EKYGEHVRVISIKNVSVELCGGTHIKNTSEIGLFVIVS-EGALSTGIRRIEALTSTSAFKYL. 706
450 4.000e-75UniRef50_A0A1V6D590 Alanine--tRNA ligase n=1 Tax=Verrucomicrobia bacterium ADurb.Bin122 TaxID=1852929 RepID=A0A1V6D590_9BACT  ali  22  81.RRAIARHHTAEHLIHWALRKTLGSHVRQAG-THKTAERMRFDFAHFEALTPAQLREVEQLVNERILDNAKVACFETDFDQ-KPEGTLAFFG----EKYGKVVRVVDVGGYSRELCGGTHVSTTGEIGLIKIVS-ESAIAAGTRRLEIVAGQAALDFI. 230
451 4.000e-75UniRef50_A0A1Q2HN31 Alanine--tRNA ligase n=8 Tax=Planctomycetes TaxID=203682 RepID=A0A1Q2HN31_9BACT  ali  21  569.RNSSRKNHTATHLLQWALKKVMGESITQQGS-LVCPDYLRFDFTCSKALSNEQISEVEELVNRKIFADSPVTCSTMPIDEAKKLGATALFG----EKYGDTVRLISIGAFSKELCGGTHVSRTSQIGGFKIIKEES-ISAGVRRITALTGRALIEYF. 728
452 5.000e-75UniRef50_T2SPU1 Alanine--tRNA ligase (Fragment) n=4 Tax=Helicobacter TaxID=209 RepID=T2SPU1_HELPX  ali  21  271.RLEIAKHHSATHLLQSALREVLGSHVSQAGS-LVESKRLRFDFSHAKALNDEELEKVEDLVNAQIFKHLNSHVEHMPLNQAKDKGALALFG----EKYAENVRVVSFKEASIELCGGIHVENTGLIGGFRIVK-ESGVSSGVRRIEAVCGKA...... 416
453 5.000e-75UniRef50_A0A2N1V6S6 Alanine--tRNA ligase (Fragment) n=1 Tax=Ignavibacteriae bacterium HGW-Ignavibacteriae-4 TaxID=2013811 RepID=A0A2N1V6S6_9BACT  ali  23  241.RRNIMRNHSATHLLHEALKRVLGSHIQQQGS-LVSPDYLRFDYNHFEKMTPEQMTEIEDIVNTKILEAHKVETLVMSLEEAQNKDGLKMYFG---DKYGETVRAVIMDNYSQELCGGTHVSNTSEIGYVKITS-ESSIASGIRRLEAITGAAILHH.. 392
454 5.000e-75UniRef50_A0A2E2UAN6 Alanine--tRNA ligase n=8 Tax=Oligoflexia TaxID=1553900 RepID=A0A2E2UAN6_9PROT  ali  21  553.RELIKRNHSATHLLQAALIEVLGPHIKQAGSR-VSTDSLRFDFTQPEAVSKSDLQKVEDLVNQKIRNALAVSASLMTKDEATSKGAMALFG----EKYGDEVRVLEMGDFSLELCGGTHVKNTSEIEIFVILG-ESSLSSGVRRIEATTSSNALNYL. 703
455 6.000e-75UniRef50_A0A1V5UJ78 Alanine--tRNA ligase n=3 Tax=root TaxID=1 RepID=A0A1V5UJ78_9BACT  ali  20  559MRLKIRAAHTATHILHASLRSALGEHVKQAGSK-VEPGRLRFDFTHFEAVDPEVLEAVEARVNEAVRGCMPVSTKLSTLEEAQKEGAMALFD----EKYGDSVRVVSVGDFSKELCGGTHVSNSGQIGLVKILS-ETALAAGVRRVEALVADEAVNYLK 711
456 6.000e-75UniRef50_A0A1Y0H6Q1 Alanine--tRNA ligase n=1 Tax=Armatimonadetes bacterium Uphvl-Ar2 TaxID=2004468 RepID=A0A1Y0H6Q1_9BACT  ali  22  569.RADITRHHTATHLLHAALRERLGAHVTQAGS-LVAPDQLRFDFTHGQALTPEDLRAVEDRVNEHVLSAQPVVIYEVPLDEARAMGAMALFG----EKYADRVRVVQIGGFSRELCGGIHVPNTGAIGQFRI-RHEGSAASGIRRITAVCGRAALQMAQ 728
457 6.000e-75UniRef50_A0A1Z9E148 Alanine--tRNA ligase n=1 Tax=Cellvibrionales bacterium TMED122 TaxID=1986772 RepID=A0A1Z9E148_9GAMM  ali  17  233VRNKTRLNHSATHLLHEALRRELGDHILQKGS-LVDSQRLRFDFSHGEPVSSETLETITGVVNQQIRANEAVATELMSMDDAIEAGAMALFG----EKYGEEVRVLTMGAFSVELCGGTHVSRTGDIGLFLVTS-ESGVASGVRRIEAVTGEAAL.... 383
458 7.000e-75UniRef50_Q1IJG7 Alanine--tRNA ligase n=2 Tax=Acidobacteria TaxID=57723 RepID=SYA_KORVE  ali  24  771VRRATMRNHTGTHLLHAALREVLGKHVKQAGS-LVDPAKLRFDFSHFTGVADEELQDIEDIVNKEVLKNDRVEIENVPIDVAVNEYAMALFG----EKYGDRVRVIKIGDFSTELCGGTHTLATGEIGLIKVL-HEGSVSSGVRRLEAVTGENSVRHF. 924
459 7.000e-75UniRef50_A0A1Z9UWV9 Alanine--tRNA ligase n=7 Tax=Bacteria TaxID=2 RepID=A0A1Z9UWV9_9RICK  ali  26  541.RNSIMANHTATHILHQSLKDVLGSHVNQAGS-LVHPEYLRFDITHPNKISSKELDEIELIVNQKIGENITVKTSIKSLEEAKKEGATALFG----EKYGDKVRVVKIGKFSKELCGGTHVSSTGKISKFKI-KHDKAISSGIRRIHAITSNHVDLY.. 690
460 7.000e-75UniRef50_X5JI91 Alanine--tRNA ligase n=8 Tax=Cyanobacteria TaxID=1117 RepID=X5JI91_9NOST  ali  21  189.RRRAQANHTATHLLQAALKKIVDDGISQAGS-LVSFDRLRFDFNAPQALTPEQITQIEAQVNTWIGEAHTATIETMPLEDAKKKGALAMFG----EKYADVVRVIDFPGVSMELCGGTHVSNTAEIGVFKIIS-EGSVSSGVRRIEAVSGPATLDYL. 339
461 7.000e-75UniRef50_A0A2E1CZU5 Alanine--tRNA ligase n=2 Tax=Proteobacteria bacterium TaxID=1977087 RepID=A0A2E1CZU5_9PROT  ali  22  549.REMVMCNHSATHLLHFALRQVLGNHVVQKGS-LVTEDRTRFDFSHESKIDAADITSIENVVNEIIKNNTMTEIKNMEYSEAVDYGAVALFG----EKYGDRVRVLEIGP-SIELCGGTHVSRTGDIGFFKIIS-EGSVSSGVRRIEAVSGKSAEEYV. 698
462 8.000e-75UniRef50_A0A2E2BDP3 Alanine--tRNA ligase (Fragment) n=7 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A2E2BDP3_9GAMM  ali  22  1........HSATHLLHAALRQLLGKHVEQKGS-LVDENKLRFDFSHGQGLDGASVRDVEVLVNEKIRGNFEISSNVMAYDAAIESGAVALFG----EKYGDEVRVLSMSEFSTELCGGTHASRTGDIGVFKIVS-ESGVASGVRRIEAVTGDIAIEHL. 144
463 8.000e-75UniRef50_A0A127V8T5 Alanine--tRNA ligase n=8 Tax=Bacteroidetes TaxID=976 RepID=A0A127V8T5_9SPHI  ali  20  581.RVQTNNNHSATHLLHAALKSVLGDHVNQKGS-LVNADYLRFDFSHFTKITEDELAAIEHIVNKRVRDNIALEQRLVPYEEALSSGVTALFG----EKYGDFVRIITFDDYSKELCGGTHVQATGQIGYFKIIS-ESAVAAGVRRIEAITADRAEEYV. 733
464 8.000e-75UniRef50_B8E226 Alanine--tRNA ligase n=2 Tax=Dictyoglomus TaxID=13 RepID=B8E226_DICTD  ali  21  550.RYHTMRHHTATHLLHAALREYLGTHVMQSGS-LVSPEFLRFDFTHHSPLTYEDLKIIERKVNENILANHKVEKFWTNLEEAKRMGAIALF----TEKYQKNVRIIKINNVSMELCGGTHVDCTGEIGSFYIVKEE-GIGSGIRRIFAVCGLKAWEF.. 699
465 8.000e-75UniRef50_A0A1G1QEB6 Alanine--tRNA ligase (Fragment) n=1 Tax=Omnitrophica WOR_2 bacterium RIFOXYB2_FULL_45_11 TaxID=1801876 RepID=A0A1G1QEB6_9BACT  ali  20  373.RKAVARAHTATHLLQASLRQVLGSHIQQAGS-LVEPDRLRFDFIHSDKISAENLKRVEDLVQEKILAGLEISLRQMSLKMAKKSGAIALF----NEKYEDKVRLVDIQDFSKELCGGTHLDNSSQVGLFKIIS-EGSIAKGVRRIEASTGKAAWEAY. 523
466 9.000e-75UniRef50_A0A2D5JDN3 Alanine--tRNA ligase (Fragment) n=1 Tax=Arcobacter sp. TaxID=1872629 RepID=A0A2D5JDN3_9PROT  ali  25  283.RKEIEKHHSATHLLQSALKMVLGDTVAQAGS-LNDTSKLRFDFTYPKAMTEAQIKEVEDLVNSMIARGISGDVEELPIEEAKNKGAIAMFG----EKYGSSVRVVSFGDVSVEFCGGTHVKNTHDIGSIYITK-ESGVSAGVRRIEAVCGLAAIEY.. 432
467 9.000e-75UniRef50_X0YXB3 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X0YXB3_9ZZZZ  ali  26  91.RKNISKNHTATHLLHWVLRNVFGNEIKQCGSF-VGEDRFRFDYSIYTAPSKEDLRKVERMINEKIQNNDPVRCFETTREFAKEIGATALFG----EKYGKFVRVVEINDYSRELCGGIHVNRTGDIGIFKII-TEASIGANLRRIEAATGMYAYNYLE 242
468 9.000e-75UniRef50_A0A1G3QBC0 Alanine--tRNA ligase n=6 Tax=unclassified Spirochaetes TaxID=1130380 RepID=A0A1G3QBC0_9SPIR  ali  25  555.RNLIRANHTVTHLLHAALRKVLGTHVKQSGS-LVAPDRLRFDFTHYNAVSREEISEIESIVNRKIWENVPVSTEIMSYQDAVSAGAMAVFD----EKYEDTVRVVSVHGLSRELCGGTHVSSTGQIGLFKILR-EASPGAGLRRIEGVT......... 697
469 9.000e-75UniRef50_A0A1Z8QHE7 Alanine--tRNA ligase n=2 Tax=unclassified Betaproteobacteria (miscellaneous) TaxID=33809 RepID=A0A1Z8QHE7_9PROT  ali  25  559.RTHIKRNHSATHLLHLALKKILGSHVQQKGS-LVTFERTRFDFSHPSILTSEQIRKIEDLVNNEIIENTKTHVNLMEYSEALKSGAVALFG----EKYNDEVRVLSIGS-SKELCGGTHVERTGDIGFFKII-HETGVSSGVRRIEAITGENAIMYI. 708
470 1.000e-74UniRef50_Q8A0M6 Alanine--tRNA ligase n=1998 Tax=root TaxID=1 RepID=SYA_BACTN  ali  25  556.RAACAANHSATHLLDSALREVLGEHIEQKGS-LVTPDSLRFDFSHFQKVTDEEIRQVEHLVNAKIRANIPLEYRNIPIEEAKELGAIALFG----EKYGERVRVIQFGS-SIEFCGGIHVAATGNIGMVKIIS-ESSVAAGVRRIEAYTGARVEEMLD 707
471 1.000e-74UniRef50_P74941 Alanine--tRNA ligase n=64 Tax=Deinococci TaxID=188787 RepID=SYA_THET8  ali  21  567.RRDTERNHTATHLLHAALRAVLGPHVRQAGS-LVAPDRLRFDFTHPEPLKPEELERVELLVNRWIMADFPVTWRYMPLEEARKEGAMALFG----EKYGLE---------SKELCGGCHVRRTGEIGAFLIRSEE-AVSAGVRRIEAVTGEEAIRF.. 722
472 1.000e-74UniRef50_A0A2V9NEE3 Uncharacterized protein (Fragment) n=2 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V9NEE3_9BACT  ali  26  267IRESTMRNHTATHLLQAGLREVLGKHVKQAGS-LVAPNHLRFDFSHFTAVEDEELQDIEDLINKEVLRNQRVEIENVPIDLAVNEYAMALFG----EKYGDRVRVIKIGDFSTELCGGTHTGATGEIGLIKILK-EGSVSSGVRRVEAITGEGSLRHF. 420
473 1.000e-74UniRef50_A0A0S8FX75 Alanine--tRNA ligase n=1 Tax=Planctomycetes bacterium SM23_32 TaxID=1704029 RepID=A0A0S8FX75_9BACT  ali  23  561LRMATARNHTATHLLHWALRRVLGEHAKQSGS-HVSPERLRFDFANPTELGADRLRQIEDLVNRKILDDEPAVATRMSLSEAREAGAIALFG----ETYGDIVRVLSIGDFSRELCAGTHCERTGQIGLFRIT-HESSVAGGVRRIEAVTGTSVLERL. 712
474 1.000e-74UniRef50_A0A2N3G7Q2 Alanine--tRNA ligase n=1 Tax=Actinobacteria bacterium HGW-Actinobacteria-3 TaxID=2013648 RepID=A0A2N3G7Q2_9ACTN  ali  27  577.RLAIARNHSATHLVHWALRDVLGAHARQAGS-LVAPDRLRFDFTHFDAVSPDEIARIEMLVNERVLDDAPVRVTVMAREAAIAGGAMALFG----EKYGEEARVVEIGDFSKELCGGTHVERAGNIGPVRIT-AESSVGAGLRRIEATSGFETLRHY. 727
475 1.000e-74UniRef50_A0A2H5ZGK2 Alanine--tRNA ligase n=4 Tax=Bacteria TaxID=2 RepID=A0A2H5ZGK2_9BACT  ali  24  566.RDAARLNHSATHILHAVLREQLGREVRQAGS-LVAPDRLRFDFTYQGPVGEERLAAIEREVNARIRWNDPVWAEEMPYEEALKAGALAFFG----EKYGDIVRVIRIGEYSTELCGGTHVRRSGDIGLFKIRAEE-GVAAGVRRIEALTAEGAWQWLQ 717
476 1.000e-74UniRef50_A0A2M8ELE0 Alanine--tRNA ligase n=1 Tax=candidate division WWE3 bacterium CG_4_9_14_0_2_um_filter_35_11 TaxID=1975077 RepID=A0A2M8ELE0_9BACT  ali  27  462....TTKLHTATHLLHQALREVLGDHVHQMGSN-ITPKRLRFDFSHDKKMTDEEIKKVEQIVNQKIKESLTVNKVVMSKSEAEKTGALHFF----ADKYTDEVSVYFIGDWSKEFCGGPHVKNTSEIGGFKIIKEES-VAKGVRRIRA........... 604
477 1.000e-74UniRef50_A0A1V5FIZ8 Alanine--tRNA ligase n=1 Tax=candidate division BRC1 bacterium ADurb.BinA292 TaxID=1852824 RepID=A0A1V5FIZ8_9BACT  ali  20  607.RIATMLNHSATHLMQGALKRLIGGHVTQQGSF-VGPDGLRFDFTHPEPVPEATLREIERIVNGQILANLPVTTQVMALEEAKATGAIAPFG----EKYGAQVRVIAMGDFSREFCGGTHVRNTGQIGLFLITG-ESSVASGIRRIEARTGLGALE... 755
478 1.000e-74UniRef50_A0A257LTJ1 Alanine--tRNA ligase (Fragment) n=1 Tax=candidate division bacterium WOR-3 4484_18 TaxID=2020626 RepID=A0A257LTJ1_9BACT  ali  24  238LRKAIAQHHTATHLLQAALKRVLGDHVRQEGS-LVAPTYLRFDFTHYKGLTDREIEKVETLVNEWIQSNLPVEVYHTTFKQAVDDGVIYIVG----EEYKDPVRVVKIGDISRELC-GTHLNATGEIGMFKILN-ESSIHAGIRRIEAVAGMNAWR... 386
479 1.000e-74UniRef50_A0A2E1KV20 Alanine--tRNA ligase n=7 Tax=Verrucomicrobia TaxID=74201 RepID=A0A2E1KV20_9BACT  ali  24  575.RVAIQRHHSATHLLNWALRNALGSHIQQAGSM-VSENRLRFDFSHFEPIDEACLEQIEQNINACILGNHPVNSYELPFSE-KPDDVVAVFG----EKYGDRVRVVDIGGFSKELCGGTHVAATGEIGLFKIVS-ESGIAAGTRRIEAVCGASAYALTE 725
480 1.000e-74UniRef50_A0A2W4NLA8 Alanine--tRNA ligase (Fragment) n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2W4NLA8_9CHLR  ali  19  1.............LLHAALRQTLGNHVQQRGS-LVAPDRLRFDFAHDARLTPEQLRQVETEVNDIILRNYPVVAVEKPLAQAREEGAMALFG----EKYGEQVRTITIGDYSYELCGGTHVSETAEIGPFVIVS-EGSVSAGIRRIEALTGYGAVQYIQ 144
481 1.000e-74UniRef50_UPI000C088DC6 alanine--tRNA ligase n=1 Tax=Miniphocibacter massiliensis TaxID=2041841 RepID=UPI000C088DC6  ali  18  558.RRDTMKNHTATHLLHKALREVLGNHVHQAGS-YVSSERLRFDITHFEAISKDDLLKVQNIVNDVISLGMPVNSSEMTLEESTKLGAIGLFE----DKYKDVVRVINIGGYSTELCGGTHVVSTSDIQMLKIIS-ESSVAAGIRRIEAITGRSVYEDLK 710
482 1.000e-74UniRef50_A0A2D4QT50 Uncharacterized protein n=1 Tax=Rhodobacteraceae bacterium TaxID=1904441 RepID=A0A2D4QT50_9RHOB  ali  19  135.RSSVRANHSATHLLHEALRKKLGQHVAQRGS-LNAADRLRFDFSHSKALTKDELSSVERSVNFYIRQNTEVSTRVMSPDDARTLGATALFG----EKYGEEVRVVSMGGYSXELCGGTHVKRTGDIGAFVILSD-GASSSGVRRIEALTGEAALDHY. 297
483 1.000e-74UniRef50_A0A0A8E8R2 Alanine--tRNA ligase n=1 Tax=Coxiella endosymbiont of Amblyomma americanum TaxID=325775 RepID=A0A0A8E8R2_9COXI  ali  25  536.RHDITRNHSATHLLHEALRRVLGQHIIQKGS-LVEEKRLRFDFSYLRPVPAQTLYSVERLVNEKIRDNLKTVSSTMNANEAMKLGA--LFISDTSKKYEDVVRILNIGDFSVEACGGTHVKRTGEIGLFKIVS-ESSCASGVRRIEAVTGQEALSYIE 689
484 2.000e-74UniRef50_A0A177QKJ3 Alanine--tRNA ligase n=6 Tax=root TaxID=1 RepID=A0A177QKJ3_9PLAN  ali  25  579IRADTMRNHTSTHLLNWALRKVLGGEIDQKGS-LVDPDKTRFDFSYVEPLTKEQIAEVERLVNEKIYADMPVTPVFMPLAEAKKIAGVRAVFG---EKYPDPVRVLLIGEHSVEFCGGTHLRHTGEAGFFKIVSQE-AVGKGVRRITAVTGRGAVAEVQ 741
485 2.000e-74UniRef50_A0A2N2ZT66 Uncharacterized protein (Fragment) n=1 Tax=Bacteroidetes bacterium HGW-Bacteroidetes-12 TaxID=2013680 RepID=A0A2N2ZT66_9BACT  ali  22  243.RKLTAANHSATHLLHQALRTILGTHVEQKGS-LVNNAHLRFDFSHFQKVSEEELQQIEDFVNEKIQSSISLEHREIPIKEAEKVGAMMLFG----EKYGNKVRMIQFGD-SKELCGGIHVNNTQDIELFKITS-EGSVAAGIRRIEAVTSKGAANYLK 394
486 2.000e-74UniRef50_A0A1G1WZ51 Alanine--tRNA ligase n=4 Tax=Patescibacteria group TaxID=1783273 RepID=A0A1G1WZ51_9BACT  ali  23  430..ERTTRMHTATHLLHQALRTVLGDGVAQKGSN-ITNDRLRFDFSYSNKLTQEQLQQVQDLVNEKINKGLEVTREEMSLEEAKKSGAIGLFEQ----KYGDKVSVYTIGDFSKEFCGGPHVTNTKEIGLFKIQKEE-AVASGIRRIKATV......... 571
487 2.000e-74UniRef50_W4US16 Alanine--tRNA ligase n=10 Tax=Bacteroidetes TaxID=976 RepID=W4US16_9BACE  ali  25  312.RASCAANHSATHLLDEALREVLGEHVEQKGS-LVTPDSLRFDFSHFQKVTDEEIRKVEHLVNAKIRANIPLEHRDIPIEEAKELGAIALFG----EKYGDRVRVIQFGS-SIEFCGGIHVAATGSIGMVKIIS-ESSVAAGVRRIEAYSGVRVEELLD 463
488 2.000e-74UniRef50_A0A1G6E139 Alanine--tRNA ligase n=2 Tax=Desulfovibrionales TaxID=213115 RepID=A0A1G6E139_9DELT  ali  16  562LRLDTARHHTCTHLLQAALRTVLGDHVRQAGSF-VSPDILRFDFTHTMAMTSDELRAVEDAVNQAILADVALDVVVTTPEEAQQRGALAFFG----EKYGLEVRIVSVPGFSTELCGGTHLRSTGQAGSFVILS-ESGIAAGVRRIEALAGTRALQH.. 712
489 2.000e-74UniRef50_A0A2M7AYJ7 Alanine--tRNA ligase n=5 Tax=Bacteria TaxID=2 RepID=A0A2M7AYJ7_9BACT  ali  21  552.RKNIMRNHTATHLLHKSLRQIIGTHIVQRGS-LVSDDRFRFDFSQPTQLKKEELALIEKRINEKILENLKVTTKITTVDEAKKLGALALFG----EKYGEKVRCVIIGNESVELCGGTHCKSTGEIGQFIILS-EGSIGSGLRRIEAITGIEAYNFMK 710
490 2.000e-74UniRef50_UPI00094C1C57 alanine--tRNA ligase n=1 Tax=Pelagibacter ubique TaxID=198252 RepID=UPI00094C1C57  ali  21  236.RDNTRAYHSATHLLHESLRRVLGTHVTQKGS-LVEPSRLRFDFSHMKPILNEEIDKIEEFVNTMVSKKSDVKTRLMTPDEAVENGALALFG----EKYGDEVRVLSMGDFSTELCGGTHVKNTGDIGKFKIVSQ-SSIAAGVRRIEALRDKQLEEYLK 392
491 2.000e-74UniRef50_A0A2H0LRI2 Uncharacterized protein n=1 Tax=Candidatus Omnitrophica bacterium CG11_big_fil_rev_8_21_14_0_20_43_6 TaxID=1974747 RepID=A0A2H0LR  ali  21  132.RQNIARNHTATHILQAVLREVLGKHVQQQGS-LVAAEKFRFDFTHPKGLTKDEILKVEEIANRYVNNDYAVGCRQMAFNEAKKTGALAFFE----EKYGECVRVVTVGDISKELCGGTHLTSIGEINLIKITG-ESSVASGIRRIEGVTAGFARQFIE 283
492 2.000e-74UniRef50_A0A2M7AH68 Alanine--tRNA ligase n=2 Tax=unclassified Armatimonadetes TaxID=1042316 RepID=A0A2M7AH68_9BACT  ali  22  552.RDAVQRAHTGTHLLHAALHKVLGDHATQSGS-LVEPDRLRFDFAHFSALTDDELVAVEQEVNQHILQNVPVTPVETSLEDARNMGAMALFG----EKYGDQVRVIRIGEVSLELCGGTHVRRTGDIGVCKIV-TESSIGSNLRRIEAITGEAVVAHL. 705
493 2.000e-74UniRef50_A0A0P1NZG0 Alanine--tRNA ligase n=2 Tax=Candidatus Kryptonia TaxID=1855361 RepID=A0A0P1NZG0_9BACT  ali  23  314.RKSVMKNHSATHLLHSALRKVLGTHVQQAGS-LVAPDRLRFDFTHPKKLSKEEIEMVEHLVNDVIFEDIELVKEYKPLKQALEEGALAFFG----DKYGDIVRTVRIGDFSYELCGGTHLDRTIETGYFKII-YEGSIASGVRRVEAIT......... 456
494 2.000e-74UniRef50_A8G242 Alanine--tRNA ligase n=7 Tax=Cyanobacteria TaxID=1117 RepID=SYA_PROM2  ali  23  557.RVRASANHTATHLLQSALKEVVNKNVSQKGS-LVAFNKLRFDFNASKPVSEDQIRKVESLVNSWIIQNHPLVIKNMPKREALEKGALAMFG----EKYGDEVRVVDVPGVSMELCGGTHVKNTSELGCFKIISEE-GISAGVRRIEALSGQSAFDYF. 707
495 2.000e-74UniRef50_A0A090W8C9 Alanine--tRNA ligase n=1 Tax=Jejuia pallidilutea TaxID=504487 RepID=A0A090W8C9_9FLAO  ali  19  263.RNLSASNHTATHLLHQALRTILGDHVEQKGS-LVKPNALRFDFSHFAKVSPEQLQEIEDFVNARIEGKLPLENRNVPMEQALEEGAMALFG----EKYGDTVRTVRFGK-SIELCGGIHVNNTSDIWYFKIIS-ESAVAAGIRRIEAITNKAVRDFY. 413
496 2.000e-74UniRef50_A0A2D8WB24 Alanine--tRNA ligase (Fragment) n=1 Tax=Gemmatimonadetes bacterium TaxID=2026742 RepID=A0A2D8WB24_9BACT  ali  20  1..RDTVRNHTATHLLHSALREVLGDHVVQRGS-LVAPDRLRFDFAHTGPLDTDELEQVELIINEGIWANHPVEINHRSYAAAVEDGAMALFG----EKYPDEVRVVSIAGVSMELCGGTHASQTSEIGLFRFVSQ-SGVSAGVRRVEGLTGREAFTYLK 151
497 2.000e-74UniRef50_A0A0S7Y729 Uncharacterized protein (Fragment) n=1 Tax=Microgenomates bacterium DG_75 TaxID=1703769 RepID=A0A0S7Y729_9BACT  ali  25  178...AVTKYHTTTHLLHQALRDVLGDHVQQVGSN-ITPERLRFDFTHPEKLTEEQMRKIEEIINQKIKANLPVRMKTMSLAEAKKKGALAFFG----EKYGSKVKVYSIGDYSQEVCGGPHVQSTGEIGRVKIIK-EKAVGAGRRRIYA........... 316
498 2.000e-74UniRef50_A0A2D6BHY4 Alanine--tRNA ligase n=4 Tax=Bacteria TaxID=2 RepID=A0A2D6BHY4_9DELT  ali  23  560.RGATVRNHSGTHLLHAALRQVLGPQAMQKGS-LVSPERLRFDFTHDHPLSEDEIERIEDLANRWIEDNAAATTRVMGYKDALEAGAVAIFE----EKYGDEVRVVSFGEVSTELCGGTHAKASGDIGLLKVVS-ESGIAAGVRRIEALTGMAALHHL. 710
499 2.000e-74UniRef50_A0A2A2T4D2 Alanine--tRNA ligase n=3 Tax=Burkholderiales TaxID=80840 RepID=A0A2A2T4D2_9BURK  ali  21  649LRAATTRNHSVTHLMHKALRETLGEHVQQKGS-LVDEDKTRFDFVQNAPVTQEQLHRIEQLVNAEIVADAPTVIREMGIEDAKASGAMMLFG----EKYGDVVRVVDIGE-SRELCGGTHVQRAGEIGLFKLV-MEGGVAAGVRRVEAITGAKALAYVQ 800
500 2.000e-74UniRef50_T2T141 Uncharacterized protein (Fragment) n=3 Tax=Helicobacter pylori TaxID=210 RepID=T2T141_HELPX  ali  22  1....IAKHHSATHLLQSALREVLGSHVSQAGS-LVESKRLRFDFSHPKALNDEELEKVEDLVNAQIFKHLKSQVEHMPLNQAKDKGALALF----SEKYAENVRVVSFKEASIELCGGIHVENTGLIGGFRIVK-ESGVSSGVRRIEAVCGKA...... 143
501 3.000e-74UniRef50_A0A2D6TBH4 Alanine--tRNA ligase (Fragment) n=2 Tax=Bacteria TaxID=2 RepID=A0A2D6TBH4_9GAMM  ali  20  554VRQATALNHSATHLLHAALREVLGDHVQQKGS-LVDSQRLRFDFSHYEAIKPEQLRALEDRVNEQIRLNSVVGVEVTDIESAKNKGAMALFG----EKYGDQVRVLTMGGFSVELCGGTHVSRTGDIGLFKIT-AESGIASGVR............... 692
502 3.000e-74UniRef50_A0A1G5J640 Alanine--tRNA ligase n=9 Tax=Bacteroidetes TaxID=976 RepID=A0A1G5J640_9FLAO  ali  19  559LRDHTASNHSATHLLHQALRAILGTHVEQKGS-LVNPNYLRFDFSHFAKVTDAELKQVEDFVNERIQEHLPVERRSIPFAQAIEEGAMALFG----EKYGDNVRAIKFGD-SMELCGGIHVPNTADIWHFKIVS-EGAVAAGIRRIEAITNDAVKDYF. 710
503 3.000e-74UniRef50_A0A2E1AE86 Alanine--tRNA ligase n=3 Tax=Anaerolineaceae TaxID=292628 RepID=A0A2E1AE86_9CHLR  ali  19  575.REDIIRNHTGTHLLHAALRNHLGKHVEQRGS-LVAPDRLRFDFSHNDKLTPEEMSVIEQEVNDIILANYPVRTERKSLDEARSEGAMALFG----EKYADVVRTVIIDNYSYELCGGAHVGETAEIGAF-ILTSEGSVSAGVRRIEAVTGKAAAELV. 729
504 3.000e-74UniRef50_X1QBW8 Uncharacterized protein (Fragment) n=2 Tax=marine sediment metagenome TaxID=412755 RepID=X1QBW8_9ZZZZ  ali  25  90.RKAIARAHTATHLLQAALREILGETVKQSGS-LVGEDRLRFDFSYSSPSSDEQLKRITSLINEKIRENLSITVKEMSLKEAQEKGAIALFET----KYKEKVRVVTIGKFSQEVCGGTHLSSTGEIGILRIIS-ESSIASGIRRIEALVG........ 233
505 3.000e-74UniRef50_G1VP65 Alanine--tRNA ligase n=15 Tax=Terrabacteria group TaxID=1783272 RepID=G1VP65_9FIRM  ali  24  614.RDIITSNHSCTHLLQSALKQIVGSHIQQAGSF-VSEEYLRFDFTHFEKVNEEQLKEIERLVNRYISGHYAVSKVEMPIEEAKKSGATALFD----EKYGDVVRVVSMGDVSKEFCGGCHVNNTQEIGVCKIISEES-IGSGIRRITAKTGYDAYAEF. 764
506 3.000e-74UniRef50_A0A1M3MS67 Alanine--tRNA ligase n=6 Tax=Proteobacteria TaxID=1224 RepID=A0A1M3MS67_9DELT  ali  25  590.RTATRRNHSATHLLHWALRAVVGESAQQKGS-LVGPDRLRFDYSSGKPLTAEEIQKIEDLVNEKILSDAPVTTEVLPQAEAKKRGAMAIFE----EKYGDVVRVLTMTKDSVELCGGTHARALGEIGMFKVLSD-NGVAAGVRRIEAATGMNALAYV. 740
507 3.000e-74UniRef50_A0A2M7U1T5 Alanine--tRNA ligase (Fragment) n=1 Tax=Candidatus Marinimicrobia bacterium CG_4_10_14_0_2_um_filter_48_9 TaxID=1975522 RepID=A0A  ali  21  404.RQAIKLNHSATHLLHAALRLVLGDHVKQAGS-LVTDTHLRFDFNHFEKVSDSDLTRIEMLVNREIRKNDQTAISVKTFDEAKQAGALAFFG----EKYGDEVRTIKFGDFSFELCGGIHVQATGDIGSLRITS-ESAVAAGVRRIEAVTGHAAEE... 552
508 3.000e-74UniRef50_A0A1V6EQ58 Alanine--tRNA ligase n=3 Tax=unclassified Candidatus Hydrogenedentes TaxID=1046981 RepID=A0A1V6EQ58_9BACT  ali  19  557.RRRIESHHTATHLLQAALRNALGEHVHQAGS-YVGPDRLRFDFSHFEGIGLDRLQDVEQEVNASIRADVPVDITYKPLDEARAEGTMALFG----EKYEDIVRVVKAEGISKELCGGCHVPRTGVIGFFKILS-ESAVAAGVRRIEAVCGQPSVEVVQ 708
509 3.000e-74UniRef50_E8WYK5 Alanine--tRNA ligase n=2 Tax=Acidobacteriaceae TaxID=204434 RepID=E8WYK5_GRATM  ali  23  622VRAATMRNHTGTHLLHAALREVLGKHVKQAGS-LVNRDRLRFDFSHFTGVAEEELREIETIVNAQVLKNTPVETLVVPIDVAVNDGAMALFG----EKYGDKVRVVRIGEFSTELCGGTHTLATGEIGVIKLVG-ESSVASGVRRLEAISGTGALDEF. 775
510 3.000e-74UniRef50_A0A0S7XEF6 Uncharacterized protein (Fragment) n=1 Tax=Planctomycetes bacterium DG_23 TaxID=1703414 RepID=A0A0S7XEF6_9BACT  ali  24  1...............HFALRQVLGPHAQQAG-ALKTPERLRFDFTHPEALTTTEVRQVEALVNEKIMENVPISTSEMNLDEAKSSGAIALFG----EKYGEKARVVSVGDFSKELCGGTHLHSTGEVGLFKIISEES-VAAGVRRITALTGPEALHSI. 137
511 3.000e-74UniRef50_A0A1V4RG34 Alanine--tRNA ligase n=3 Tax=Bacteria TaxID=2 RepID=A0A1V4RG34_9BACT  ali  21  553.RHALMRAHTATHLLQAALRNILGEHITQQGS-LVDEDRLHFDFSHFSALSPREIKLVEEKVNYFILRSDNVAKKEISFDEAQKEGALAFF----KDKYKDRVRVVFISGYSKELCGGTHIDNTAEIGSFLILN-EFSVSSGIRRIEAVTGNEAIR... 701
512 3.000e-74UniRef50_A0A2D6WMA7 Alanine--tRNA ligase n=11 Tax=Verrucomicrobia TaxID=74201 RepID=A0A2D6WMA7_9BACT  ali  25  575.RAAIQRHHSATHLLNWALRNTLGSHIQQAGS-LVSENRLRFDFSHFEPIDANSLQQIEQSINACILGNHPVKSYELPFSE-KPDDVIAVFG----EKYGDRVRVVDIGGFSKELCGGTHVAATGEIGMLKILS-ESGIAAGTRRIEAVCGTSAF.... 721
513 4.000e-74UniRef50_UPI00048BD540 alanine--tRNA ligase n=1 Tax=Prevotella sp. MA2016 TaxID=1408310 RepID=UPI00048BD540  ali  21  590.RNASAANHTATHLLDYALKQILGDHVEQKGSF-VSPDTLRFDFSHFEKVTDEQLREVERMVNDMIRQDIQLEHRDVPFDEAKKLGAIALFG----EKYGDKVRVVRFGP-SCEFCGGIHASSTGRIGFFKIIS-ESSVAAGIRRIEAKTGQECEELL. 740
514 4.000e-74UniRef50_A0A0G1B3U1 Alanine-tRNA ligase n=38 Tax=Microgenomates group TaxID=1794810 RepID=A0A0G1B3U1_9BACT  ali  22  443....TTKYHTATHLLHTVLRQILGTHVQQKGSN-ITAERLRFDFSHSQKLTEDEIKKVQDLVNEKIDANIPVLRKEMPKSQALAEGALAFF----PEKYPEVTSVYSMGDFSKELCGGPHVNSTGEIGHIMITKEESA-GSGIRRIYATA......... 582
515 4.000e-74UniRef50_A0A1I2HCI4 Alanine--tRNA ligase n=2 Tax=Proteobacteria TaxID=1224 RepID=A0A1I2HCI4_9DELT  ali  23  579.......NHSATHLLHHALRAVLGTHVAQKGS-LVAPDRLRFDFSHPRPITPEQRQQIERIVNEMTLANADTDTREMSPGDAKSAGAIGLFEA----KYGEQVRVVRIGSDSVELCGGTHVHRAGDIGLFAIVS-EVGIAQGVRRIEAVTGMNALQHLQ 724
516 4.000e-74UniRef50_B3E044 Alanine--tRNA ligase n=5 Tax=Verrucomicrobia TaxID=74201 RepID=SYA_METI4  ali  26  570.RRCIAAHHTATHLLHWALRKVLGPETLQRGS-YVGPDRLRFDFSHTGPLSAEELAEIERLVNEKIELNDPVTAEEESYEKVKNNPDIQLFG----EKYGQRVRIVSVGRYSKELCGGTHVRSTGEIGYFKILG-EYGVSAGIRRIEAACGKALEQFL. 721
517 4.000e-74UniRef50_A0A090WRZ1 Alanine--tRNA ligase n=7 Tax=Bacteroidetes TaxID=976 RepID=A0A090WRZ1_9FLAO  ali  18  356.RNRTESNHTATHLLHQALREILGTHVEQKGSA-VNSKYLRFDFSHFSKLTTEELQDVENFVNARIEGKLPVEKRNVPKEEAIADGAMSLFG----EKYGDTVRAIRFGQ-SIELCGGTHVKNTGDIWHFKIVS-EGAVAAGIRRIEAITNDAVKDFY. 506
518 4.000e-74UniRef50_A0A1W9QJY9 Alanine--tRNA ligase n=2 Tax=Candidatus Parcubacteria bacterium 4484_255 TaxID=1970769 RepID=A0A1W9QJY9_9BACT  ali  27  469...KIIRLHTATHLLHQALREVLGDSVHQAGSD-INPERLRFDFTYSQKLTEEEKSKIEKIVNKKIQEALPVTMEEMPYKQAIKKGALAFF----REKYPEIVKVYSIGDFSREICAGPHVKNTKELGQFKIIKEKSS-SAGIRRIKAI.......... 608
519 5.000e-74UniRef50_D3DKE4 Alanine--tRNA ligase n=9 Tax=Bacteria TaxID=2 RepID=D3DKE4_HYDTT  ali  19  556.......NHTATHLLHAVLRHVLGDHVRQAGS-LVSDQYLRFDFTHYEALDWDRLSRIEELVNEHIRQNYEVSVEETDYTKAIKEGAIAIFE----EKYSDRVRVITVGEVSKELCGGTHVRRTGDIGYFKIVS-ESSVGAGVRRIVAKTGRWAVE... 698
520 5.000e-74UniRef50_G5SFS1 Alanine--tRNA ligase n=71 Tax=root TaxID=1 RepID=G5SFS1_SALET  ali  21  568.RARIRLNHSATHLMHAALRQVLGTHVAQKGS-LVSDKVLRFDFSHNEAMKPSEIREVEDLVNAQIRRNLPIETNIMDLDAAKYDGAMALFG----EKYDERVRVLSMGDFSTELCGGTHASRTGDIGLFRIIS-ESGTAAGIRRIEAVTGEGAM.... 728
521 5.000e-74UniRef50_A0A2A5DXB5 Alanine--tRNA ligase n=1 Tax=Planctomycetes bacterium TaxID=2026780 RepID=A0A2A5DXB5_9BACT  ali  20  562....ISQHHTATHLLHRSLRDVLGDMVDQKGS-LVTENRLRFDFSYPKAMTKDELRKVEKIVNNEIRHNTSVESKLMNIDEAKAQGATALF----SEKYDTDVRVVSSGDFTKELCGGIHVKRLGDIGQFKIIKEES-IAAGIRRIEAVAGAEAYAVI. 709
522 5.000e-74UniRef50_A0A1F5F4K5 Alanine--tRNA ligase n=1 Tax=Candidatus Coatesbacteria bacterium RBG_13_66_14 TaxID=1817816 RepID=A0A1F5F4K5_9BACT  ali  24  552.RRRIQAHHTATHVLHWALRKVLGEHAVQAGS-WVGPDYFRFDLNHPRAVSENELEEITRLVNGKILENDPVRWRIVTLDEAKRLGAMMLFG----EKYSGEVRLVETGDFSKELCGGTHARATGEIGSLYVV-QEGALAAGIRRIEAVCGMAAVEHM. 702
523 5.000e-74UniRef50_D9QUP9 Alanine--tRNA ligase n=17 Tax=Bacteria TaxID=2 RepID=D9QUP9_ACEAZ  ali  22  557.RIYIRRNHTATHLLHQALRDILGEHVDQSGS-LVTPERLRFDFTHFEAVSEEELKEIEERVNQVIRKNLEVEVLKTTLEEAKKMGAAALF----SEQYDDEVRVIKIGDYSLELCGGTHVDAAGEINLFKITS-EGGIAAGVRRIEAVTGKEALNYI. 707
524 5.000e-74UniRef50_A0A257Y5F8 Alanine--tRNA ligase n=6 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A257Y5F8_9RHOB  ali  19  111.RAKIRANHSATHLLHAALRNRLGKHVTQKGS-LVEADYFRFDFSHTAPMTREEIETVEAEVNAVVRQNAEAQIKVMAPDKAIEAGAMALFG----EKYGDEVRVLRLGNYSVELCGGTHVARTGDIAVFVITS-EGGVAQGVRRIEGVTGEAALAYLK 270
525 5.000e-74UniRef50_A0A1Z8L567 Alanine--tRNA ligase n=5 Tax=Proteobacteria TaxID=1224 RepID=A0A1Z8L567_9PROT  ali  21  560.REKIRNNHTATHLLHQSLRRVVGNHVSQKGS-LVNDQKLRFDYTSNEPLSEDKIKKIEFIVNSSIRSNIVSEIKYMPLKEAMQSGAVALFG----EKYPENVRVLSIKSVSVELCGGTHVSSTGEIGFFKIIN-ETSISSGIRRIEAVTGNKAERHV. 717
526 5.000e-74UniRef50_A0A2D5SJ24 Alanine--tRNA ligase n=4 Tax=Deltaproteobacteria bacterium TaxID=2026735 RepID=A0A2D5SJ24_9DELT  ali  22  568LRLSTTNNHTAAHLMHEALRQVLGEHVNQAGS-LVNPEILRFDFTHFEKVSETQLEEIENIVNAVIRKNIPTDIYETPFQEAIDSGITALFG----EKYGDVVRVVKVSDFSEELCGGCHVRATGQIGQFRMFSEE-AIASGVRRVVAVTGRQAE.... 716
527 5.000e-74UniRef50_A6GJR9 Alanine--tRNA ligase n=1 Tax=Plesiocystis pacifica SIR-1 TaxID=391625 RepID=A6GJR9_9DELT  ali  23  585.RDAIRRNHSATHMLHHALRKVLGKHVAQKGS-LVAPDRLRFDFSHARSVTREETRRIEAEVNAMVLANAPTGTAEMSLADAKQAGAIGLFG----EKYGAEVRVVTIGEVSVELCGGTHVARAGDVGLFKIV-AEGGVAQGVRRIEAMTGMGAVEWVQ 744
528 6.000e-74UniRef50_A0A0G4I7D3 Alanine--tRNA ligase n=1 Tax=Chromera velia CCMP2878 TaxID=1169474 RepID=A0A0G4I7D3_9ALVE  ali  23  605.REAVMRAHSATHLLHSALRQVLGEGVEQKGS-LVEADFLRFDFSHPSGISSEEIREVERLVNLWVRGNSAVGTAEMLLGDAQEAGALGLFG----EKYGETVRVVSMGSVSKELCGGTHVGRTGDIGLLRVQS-ESGIAAGIRRIEAVVGSRAVEAAQ 756
529 6.000e-74UniRef50_B1ZZ40 Alanine--tRNA ligase n=5 Tax=Verrucomicrobia TaxID=74201 RepID=SYA_OPITP  ali  23  619.RRAISRHHSAEHLVHWALRKTLGTHVRQAGTS-KTKERMRFDFTHFEALTPEQIAEVERLVNSKILSNDKVEAYETEFDK-KPEGTLAFFG----EKYGKIVRVVDIGGYSRELCGGTHVSTTSEIGLFKIV-AEMAIAAGTRRLEAVAGQAAYDFVE 769
530 6.000e-74UniRef50_X1SRM0 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X1SRM0_9ZZZZ  ali  28  89.RRRIARNHTATHLIHAALRVVLGKHVMQAGSR-VSDKELRFDFSHFEGLNAEEIAKIEDLANEIVLADVLVKTQEMPLVRAKEMGALAHFDEEYKGK--DLVRVVSVGDSSQELCGGTHISRSGEIGLIKITSEES-ISSGVRRIHAVTGDNTLGWL. 241
531 6.000e-74UniRef50_A0A257R4C7 Alanine--tRNA ligase (Fragment) n=1 Tax=Legionella sp. 21-45-4 TaxID=1970394 RepID=A0A257R4C7_9GAMM  ali  18  237.REAIRLNHTATHLLHAALKEILGSEVQQKGS-LVDAARARFDFSYSKALTSEEVQHVEARVNAMIQQNVLVQTDLMSLEAAQRTGAVALFG----EKYAEDVRVLSMGDFSKELCGGTHANRTGDLGLFKI-SAEYGVASGVRRIEMLTGSYALAWV. 387
532 6.000e-74UniRef50_A0A2D7M2G4 Alanine--tRNA ligase n=2 Tax=Bacteria TaxID=2 RepID=A0A2D7M2G4_9BACT  ali  22  562.RQHIQRNHTATHLLHAALRQIVGDHVQQKGS-LVSPERLRFDISHYEKVSPEQLKEVEGRVQDWILLDQEVAIHEIPIDEARDRGAMALFG----EKYGDRVRMVEIGDFSIELCGGIHCRHTGEIGPMLIT-AEGSVSSGVRRVEALTG........ 706
533 6.000e-74UniRef50_Q30PA9 Alanine--tRNA ligase n=641 Tax=root TaxID=1 RepID=SYA_SULDN  ali  21  544.RGEITKHHSATHLLHAVLFDVLGDHISQAGS-LVEASRLRFDFSHPKAISNEELAEIERRVNYEIMRGIRANTEVMSIDEAKKSGAKAQFG----EKYGDEVRVVSFGDASIEFCGGVHVENSANIGSFIITK-ESGVSAGVRRIEAVCGNAAFNYF. 694
534 6.000e-74UniRef50_A0A2W6AIJ2 Alanine--tRNA ligase n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2W6AIJ2_9CHLR  ali  23  681.RLHILPHHSGTHLLHKALQEVLGPEATQAGS-LVAPDRLRFDFRWPRPVTEEELRDVQDRVNAAIWANLPVRRDTMPYEDAIGLGAMALFG----EKYGDLVRVVSIGDWSKELCGGTHVAMSGDIGLLVITS-ETGIGNGIRRIEALAGAAAYMHL. 831
535 6.000e-74UniRef50_I7HDZ3 Alanine--tRNA ligase n=13 Tax=Helicobacter TaxID=209 RepID=I7HDZ3_9HELI  ali  21  682.RFEIIKHHSATHLLHYALRQILGSHIAQAGS-LVEANRLRFDFSHPKALSVNDLEQIEALVNSKITESSPQVCETMGIDQAKAKGAMALFG----EKYGESVRVITLGD-SIELCGGIHIHNTAEIGSFYIVR-ESSVSSGVRRIEAVCGKAAYHY.. 830
536 7.000e-74UniRef50_A0A2H0LS75 Alanine--tRNA ligase n=10 Tax=unclassified Candidatus Omnitrophica TaxID=1047005 RepID=A0A2H0LS75_9BACT  ali  20  548.REATKRNHTATHLLQAALRQVLGNHVRQVGS-LVHPSKLRFDFKHHSALSEKELAMIESAVNQVILRNELVETAQQTYEAAVSGGAIAFFG----DKYGEKVRVINVSGFSKELCGGTHCERTGDIGVFVIAS-ETAIGSGTRRIEAVTGLGALEYL. 698
537 7.000e-74UniRef50_A0A1V5UJE8 Alanine--tRNA ligase n=3 Tax=unclassified Tenericutes TaxID=713063 RepID=A0A1V5UJE8_9BACT  ali  22  551.RRQTMLNHSATHLLHRALNDVLGSEVSQAGS-YVGPDYLRFDFNYNSRVKEEELAKIELIVNKYISDAVPLTVKYMTLPEAQKLGAKALF----MEKYGDLVRVVIFAGISIELCGGTHISNTSKIGPFVIVS-ESSIASGVRRIVALTGLAAYEHLK 702
538 8.000e-74UniRef50_A0A2D7J674 Alanine--tRNA ligase n=3 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A2D7J674_9GAMM  ali  18  318LRNRTRLNHSATHLLHEALRRELGDHILQKGS-LVDSQRLRFDFSHGEAVSAQALATITSTVNEQIRANAAVTTELMDMEAAIEAGAMALFG----EKYGDEVRVLTMGAFSVELCGGTHVLRTGDIGLFWITG-ESGIASGVRRIEALTGEAALAYV. 471
539 8.000e-74UniRef50_A0A2E5C1V7 Alanine--tRNA ligase n=7 Tax=Bacteria TaxID=2 RepID=A0A2E5C1V7_9DELT  ali  24  561.RLSTTNNHTAAHLMHEGLRQVLGEHVTQAGS-LVNPEMLRFDFTHSEKVSDAQIEEIEDMVNLIIRRNINTDIYETPFDEAISSGIIALFG----EKYGDVVRVVKIADFSEELCGGCHVKATGQIGQFRIVSEE-GIAAGIRRVVAVTGKEA..... 707
540 8.000e-74UniRef50_A0A2H5XRB5 Alanine--tRNA ligase n=1 Tax=bacterium HR19 TaxID=2035414 RepID=A0A2H5XRB5_9BACT  ali  21  552.REQSARHHTTTHLLHSALRRILGTHVRQMGS-LVEPKRLRFDFSHHSPLSLQQLEDIEHMINEWIMMNMPVEHENMKLEEALKKGALAFFG----DKYGKIVRVVKIGEVSLELCGGTHLRKTGEAGILKIIK-ETSSASGIRRVEAVAGWELLNYI. 702
541 9.000e-74UniRef50_P56452 Alanine--tRNA ligase n=725 Tax=Helicobacter TaxID=209 RepID=SYA_HELPY  ali  21  547.RFEIAKHHSATHLLQSALREVLGSHVSQAGS-LVESKRLRFDFSHAKALNDEELEKVEDLVNAQIFKHLNSQVEHMPLNQAKDKGALALF----SEKYAENVRVVSFKEASIELCGGIHVENTGLIGGFRIVK-ESGVSSGVRRIEAVCGKA...... 692
542 9.000e-74UniRef50_A0A136NW84 Alanine--tRNA ligase n=6 Tax=unclassified Chloroflexi (miscellaneous) TaxID=189774 RepID=A0A136NW84_9CHLR  ali  19  575.RADIIKNHTATHLLHAALRNQLGTHVEQRGS-LVAPDRLRFDFAHGDRVTDQQLRTIEREVNDAVQANYVVVAKVKPLAEARAEGAMALFG----EKYGETVRTVSIGAYSYELCGGVHVRETGEIGAFVFTS-EGSVSSGIRRVEALTGRAAVEYIQ 730
543 9.000e-74UniRef50_A0A1V6GNJ4 Alanine--tRNA ligase n=3 Tax=cellular organisms TaxID=131567 RepID=A0A1V6GNJ4_9BACT  ali  24  119...ATTRLHTATHLLHKALQMVLGPHAQQKGSN-ITPERLRFDFSHSEKMTPEQLKQVEEIVNDAIRRNLVVTMETMTIEEAKAKGATALFAA----KYGEQVKVYAAGDFSMEVCGGPHAATTGELGGFKIQKEESS-SAGVRRIKAV.......... 258
544 9.000e-74UniRef50_A0A1Q6YAX8 Alanine--tRNA ligase n=16 Tax=Acidobacteria TaxID=57723 RepID=A0A1Q6YAX8_9BACT  ali  20  630.RARIIRNHTGTHLVNAALRNILGTHVKQSGS-LNAPDRLRFDFSHFAHVDTEELRDIEQQVNDEIRLNTEIETNVTSLEEALASGALAFFG----DKYPENVRVVTIPDYSKELCGGTHVQRVGDIGVLKIVSEES-VAAGVRRIEAVTGIGALEHFQ 789
545 9.000e-74UniRef50_B0SGD3 Alanine--tRNA ligase n=34 Tax=Leptospira TaxID=171 RepID=SYA_LEPBA  ali  25  558.RQNLANHHSGTHLLNGALRRILGSHVTQKGSI-VSADYLRFDFSHPKALSKEEIIQIETDVNEAVSANIPVKTEVLEIGQAKESGALSMFD----EKYGSVVRVISMGDKSKEFCGGTHVSNTKEIGFFAIVK-EGSPGAGNRRIEAICGESVVNYF. 708
546 9.000e-74UniRef50_A0A1V5Q1Y2 Alanine--tRNA ligase n=2 Tax=Chloroflexi TaxID=200795 RepID=A0A1V5Q1Y2_9CHLR  ali  23  587.RKDIMRNHTATHLLHAALREVIGEEARQAGS-LVAADHLRFDFNSSRALTNEELSRVETIVNEKILECIPVTTTIEKLDDAINEGVTAIF----NEKYGEIVRVVRVGDFSAELCGGTHVSNTGEIGLFMIMS-EGSVSTGIRRIEAITGRTA..... 737
547 9.000e-74UniRef50_A0A2V9ARM7 Alanine--tRNA ligase n=2 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V9ARM7_9BACT  ali  19  663.RARIIRNHTGTHLVHAALRNILGTHVKQSGS-LNAADRLRFDFSHFAHVDAEELRDIEQQVNDEIRLNTQVETNVTSLEDALNSGALAFFG----DKYPENVRVVTIPDYSKELCGGTHVARVGDIGVLKIVNEES-VAAGVRRIEAVTGIGALEHYQ 822
548 9.000e-74UniRef50_A0A2D8VK53 Alanine--tRNA ligase n=10 Tax=Bacteria TaxID=2 RepID=A0A2D8VK53_9GAMM  ali  22  540.RKNIVNNHSATHLLHSALRKVLGDSVFQKGS-LVTDEKLRFDFSHNKKLSETEISDVENLVNEQIQKSSETVVESMSFDQAIENGALAFFG----DKYGDEVRVLKIGDFSTELCGGTHVTNTSEIEGF-IISNETSVSSGVRRIEAMTGSNLIE... 689
549 1.000e-73UniRef50_A0A2A4MA30 Alanine--tRNA ligase n=1 Tax=Legionellales bacterium TaxID=2026754 RepID=A0A2A4MA30_9GAMM  ali  25  522.RDNTARNHSATHLLHAALRQVCGAHVIQKGS-LVNAAKLRFDFTHDAVVTEAELLQIETLVNKKILANSEIVTEIMPIAAAEKMGAMSLFG----EKYAATVRVLSMEGFSIELCGGTHAKRTGDIGCVKILS-ETGVAAGIRRIEAITGDVALQYL. 673
550 1.000e-73UniRef50_A0A0F9H4A5 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=A0A0F9H4A5_9ZZZZ  ali  25  505.RKAVARAHTATHLLQAALREVLGETVKQSGS-LVGENRLRFDFSYFSPSNDEQLKKISSLINEKIRENLSVAVKEMGLKEAQKKGAIALFES----KYKEKVRLVTIGKFSQEVCGGTHLSSTGEIGILRIIS-ESSIASGIRRIEALVGEKALELVE 656
551 1.000e-73UniRef50_UPI0005575A16 alanine--tRNA ligase n=1 Tax=Clostridiales bacterium VE202-08 TaxID=1232449 RepID=UPI0005575A16  ali  24  324.RLIITSNHSACHLLQSALKAVVGSHIAQAGSF-VSDEYLRFDFTHFEKVSEEQLQQIEDLVNQYIAQKNPVMIQNMNIDEARKTGATALFD----EKYGDVVRVVSMGDVSKEFCGGCHVHNTQEIGVFKIESEES-IGSGVRRIVAKSGYAAYRDF. 474
552 1.000e-73UniRef50_A9WCR2 Alanine--tRNA ligase n=15 Tax=Bacteria TaxID=2 RepID=SYA_CHLAA  ali  20  562.RADIQRNHTATHMLQRALRDVLGEHAAQAGS-LVAPDRLRFDFTHTKAVDPEELREVEQRLNKWVRADTTVRWEITGYQDAMARGAIALFG----EKYGDTVRLVTIGEFSLELCGGTHVNHTGEIGFVRIVS-EGSIGSGIRRIEALTGRGAEGWVE 725
553 1.000e-73UniRef50_A0A258L5E7 Alanine--tRNA ligase n=1 Tax=Sphingobacteriia bacterium 35-40-5 TaxID=1970579 RepID=A0A258L5E7_9BACT  ali  20  225.RTATENNHSVTHLLHAALKQVLGDHVNQKGS-LVNSEYLRFDFAHFSKLTDLELSEVVSIVNRKIRENIPLEERNVPYQQAIDSGVTALFG----EKYGDFVRVITFDDFSKELCGGTHVKSSGQIGYFKVIS-ESAVAAGVRRIEAITAETAENYI. 377
554 1.000e-73UniRef50_A0A2W4KZS7 Uncharacterized protein n=1 Tax=[Clostridium] cellulosi TaxID=29343 RepID=A0A2W4KZS7_9FIRM  ali  20  89.RHNTMRNHSAAHLLQASLRKVLGTHVQQAG-QLVDSHRVRFDFTHFAAMTKEEISLVEQGVNDAILAGLDVVTEVMPIEEARKTGAMALFG----EKYGNTVRVVRMGEASLEFCGGTHVKNTAQIGLFHIVS-ESSVAAGVRRIEGVTG........ 236
555 1.000e-73UniRef50_A0A1V5IA98 Alanine--tRNA ligase n=16 Tax=Synergistetes TaxID=508458 RepID=A0A1V5IA98_9BACT  ali  22  560..RSIRRNHTATHLLHESLSRVLGGHVRQSGS-LVGERGLRFDFTHFEPMTREQIDEVEREVNHRILANESLEITETDMEHARAEGAKALFE----EKYGDVVRVVKVPGFSAELCGGLHVNSTGEIGVFKILKEES-IGSGTRRIIAVTGMEALRAFQ 710
556 1.000e-73UniRef50_A0A174K0Z7 Alanine--tRNA ligase n=47 Tax=Firmicutes TaxID=1239 RepID=A0A174K0Z7_9FIRM  ali  23  567.RKAVMRAHSATHLLDTVLRKVLGDHVHQAGS-LVEPDKLRFDFTHFAALTAEELSQVSALVNEAVLEGYEVSTEVLPIEEAKQRGAIALFG----EKYGDTVRVVDMGGFSVEFCGGTHLDNTAKVGVFHIDS-EFSVASGVRRIEATTGLKSLE... 716
557 1.000e-73UniRef50_A0A2H9SQR6 Alanine--tRNA ligase n=3 Tax=Chlamydiae TaxID=204428 RepID=A0A2H9SQR6_9BACT  ali  26  559.RQKIANNHTATHLLHWALHLVLGEHIKQAGSV-VDPQRLRFDFSHHKAVTKEEMHQIENLVNQRIRENLPVATYEIPYEEAQKREDIKQFFG---EKYGNIVRVVDAE-FSRELCGGTHTSALGNIGYFRIAR-EGSIAAGIRRIEAVTGQEAE.... 706
558 1.000e-73UniRef50_A0A2W6AYI2 Alanine--tRNA ligase (Fragment) n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2W6AYI2_9CHLR  ali  22  405.RKDVMRNHTATHLLHQALRDVLGPHLYQRGS-LVEADYLRFDFNHYAPVSGEDLREVERQVNDHIRKDIPVAVKYCSYEEAINDGAIALF----NEKYGATVREVMIDRYSRELCGGTHCHATGEVGFIRIIG-EQSIGSGMRRIEAVSGRGAEEYVE 556
559 1.000e-73UniRef50_A0A1F9KJ03 Alanine--tRNA ligase (Fragment) n=2 Tax=unclassified Deltaproteobacteria (miscellaneous) TaxID=122706 RepID=A0A1F9KJ03_9DELT  ali  21  492.RRRTMLNHSATHILHAVLREDLGSHVRQAGS-LVAPDRLRFDFNHTGAIPEERLEAIEKKVNARIRQDAEVRIDESGFDEAIRQGALAFFG----EKYGERVRVVRIGDFSVELCGGTHVHRSGEIGIFKLQS-EGGIAAGVRRVEAVTGEGALELI. 642
560 2.000e-73UniRef50_A0A1G1MUG4 Uncharacterized protein n=1 Tax=Omnitrophica WOR_2 bacterium RBG_13_44_8 TaxID=1801850 RepID=A0A1G1MUG4_9BACT  ali  25  15.RLDVQRNHSATHLLHAALREVLGASIKQAGS-LVTPYRLRFDFSFNRQLKDNEIIAVEDLVNEKIMESLSVKVYDTTLEFATELGAIALFD----EKYGEYVRVVEIDNYSRELCGGTHVFNSDELGMFKIVS-EVGIGSSTRRIEALTGRGVLNYL. 165
561 2.000e-73UniRef50_A0A2N1W2Q4 Alanine--tRNA ligase n=1 Tax=Candidatus Goldbacteria bacterium HGW-Goldbacteria-1 TaxID=2013807 RepID=A0A2N1W2Q4_9BACT  ali  18  556.RNATMKNHTCTHLLQAALRLVLGLHVEQAGS-YVGPDRLRFDFTHFAPLTEDEIKKVQFIMNGWIQESYDVTVELLDFHQAKAKGAMALFD----DKYKDKVRMVTVGDVSLELCAGTHISNSGEIGMVKIISY-GSTAAGVRRIEAVTGRGAEALF. 706
562 2.000e-73UniRef50_A0A0G1NQP9 Alanyl-tRNA synthetase, alanyl-tRNA synthetase n=5 Tax=root TaxID=1 RepID=A0A0G1NQP9_9BACT  ali  28  200..LKVTRLHTATHLLHQALREILGSHVKQMGSD-ITPERLRFDFIHPQKMTDEEKKRVEDLVNEKIKEDLPVLMEEMNFEEAIKQGALAFF----KEKYPERVKVYSAGSFSKEVCGGPHVSRTGEIGKFRIAKEESS-SAGVRRIKAMV......... 341
563 2.000e-73UniRef50_A0A2N2EYH1 Alanine--tRNA ligase n=1 Tax=Elusimicrobia bacterium HGW-Elusimicrobia-1 TaxID=2013763 RepID=A0A2N2EYH1_9BACT  ali  22  547.RKDIARHHTATHLLHKALRETLGRGAVQSGS-LVAPDYLRFDFAHSAAPAKEQLDEIERKVNEAVRADFVVRTTVDDLDAARKKGAMALFG----EKYGNKVRMVEVGEHSLELCGGTHVGSTGEIGFFKIIS-ESSVGSGLRRITAVCGKYAEDYV. 698
564 2.000e-73UniRef50_A0A0E0A7H6 Alanine--tRNA ligase n=2 Tax=Poaceae TaxID=4479 RepID=A0A0E0A7H6_9ORYZ  ali  21  595LRQGAKAHHTATHLLQSALKSVIGSETSQAGS-LVAFDRLRFDFNFHRPLSEEELMKIESLVNQWVSSATHLETKVMDLQDAKNAGAIAMFG----EKYGEQVRVVEVPGVSMELCGGTHVSNTAEIRGFKIIS-EQGIASGVRRIEAVAGDAFVEYV. 746
565 2.000e-73UniRef50_A0A2D6YEA2 Alanine--tRNA ligase n=3 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A2D6YEA2_9GAMM  ali  18  540.RHQTAPHHSATHLLHATLKNVLGEHVCQKGS-LVTSEKLRFDYSHDQALTAIQQETIEQTVNDMIRQSIPVQTKMMSLDEAKAEGAICLFG----EKYPDRVRVLSIGDFSKELCGGTHVSNTNQLIVFKLLSD-SALSSGVRRIEAIAGIPALNYL. 690
566 2.000e-73UniRef50_A0A0D8HLB8 Alanine--tRNA ligase n=2 Tax=Acidimicrobiaceae TaxID=84994 RepID=A0A0D8HLB8_9ACTN  ali  19  557.RNAIRKNHTATHLVHSALRSVLGDHVKQQGS-LVAPDRLRFDFFHWGPLLPDEIIKVEELVNEAISASEKVETKVTSKSEAMEMGAIAFFG----DKYGDSVRVVRAGSTSMEFCGGTHVDELGAIGLFVIT-QETSIGANTRRIEALTGLGALSYLK 708
567 2.000e-73UniRef50_A0A2H6A4R0 Alanine--tRNA ligase n=29 Tax=Bacteria TaxID=2 RepID=A0A2H6A4R0_9BACT  ali  23  577.RRNIERNHTATHLVHAALRRVLGSHVRQAGSV-VAPERLRFDFSHHSPVSEGELEAIEEEVNRAIWENVEIETYEMPYREAIAAGAIALFG----EKYGERVRVVDIPGISKELCGGTHVRSTGQIGLFHF-SGESGVAAGVRRIEALTGPAAYRAV. 727
568 2.000e-73UniRef50_A0A2H0PN24 Alanine--tRNA ligase n=1 Tax=Deltaproteobacteria bacterium CG11_big_fil_rev_8_21_14_0_20_45_16 TaxID=1973974 RepID=A0A2H0PN24_9DE  ali  24  557LRRRTRIHHTMTHVMHWALQKVLGGHIKQAGS-LVGPDYLRFDFSHFQGVSKDELRRIESLCNQKIWENPLLDLVEEDLEKAIASGAKAFFE----DKYSDRVRVLRIGDFSIELCGGTHAKSLAEAGVFKII-QESSVASGVRRIVAVTGEAAYDYI. 708
569 3.000e-73UniRef50_A0A2E5J5H1 Alanine--tRNA ligase (Fragment) n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2E5J5H1_9CHLR  ali  22  516.RSDTARNHTATHLLHSALRSVLGNHVRQHGS-LVAPDRLRFDFTHVSSISDKELREVQSLVNRKIRENIHIHVDETTYRQAVSDGAIAFFGDR----YGDSVRVVRVDDFSIEVCGGTHVVRTGDIGYCYVVS-ESSIGAGLRRIEAVTGRYAENIIQ 672
570 3.000e-73UniRef50_A0A2D5ZMX2 Alanine--tRNA ligase n=1 Tax=Gemmatimonadetes bacterium TaxID=2026742 RepID=A0A2D5ZMX2_9BACT  ali  20  550.RDDIKRNHTATHLLQSYLRTNLGEHVNQAGS-LVAPDRLRFDFTHYEAVSKEELTRIERDVNEAIMSGHAVSPRTMKYDEAIEGGATALFG----EKYGDEVRVVRIGDVSAELCAGTHCRFTGEIGPFLLLS-EGGIAAGVRRVQALTGRAALDHFQ 702
571 3.000e-73UniRef50_Q2S2B6 Alanine--tRNA ligase n=6 Tax=Rhodothermaceae TaxID=563843 RepID=SYA_SALRD  ali  18  639.RNHIRAHHTATHLMHAVLRETLGDHVQQKGS-LVAPDRLRFDFSHFDAVDEDTLRHIERRVNTAIQQNIPQEARDVPIDEALDRGATALFD----EQYGDRVRVITFPDFSMELCGGTHVDATGEIGLFRFLS-EGSVASGVRRVEAVAGKAALEHVE 792
572 3.000e-73UniRef50_A0A1F3T3W2 Alanine--tRNA ligase n=2 Tax=Oligoflexia TaxID=1553900 RepID=A0A1F3T3W2_9PROT  ali  19  551.RNLTARNHTATHLLHAALGQVLGDHINQAGS-LVTAERLRFDFTHPKGLSPEELDQVTSIINKIIENQVSVITKKMSTKEATASGAKALFG----EKYGEHVRVISIKNVSIELCGGTHIKNTSEIGLFVIVS-EGALSTGIRRIEALTSTFAFKYLQ 707
573 3.000e-73UniRef50_UPI000D62705D alanine--tRNA ligase, chloroplastic/mitochondrial isoform X4 n=1 Tax=Cynara cardunculus var. scolymus TaxID=59895 RepID=UPI000  ali  24  428.......HHTATHLLQAALKKVIGEETSQAGS-LVAFERLRFDFNFHRQLVDHELTKIEGLVNEWIGEATPLETEVMPIADAKNAGAIAMFG----EKYGEEVRVVNVPGVSMELCGGTHVSNTSEIRGFKIIS-EQGIASGIRRIEAVAGDAFIEYV. 572
574 3.000e-73UniRef50_A0A251MZA6 Alanine--tRNA ligase n=2 Tax=fabids TaxID=91835 RepID=A0A251MZA6_PRUPE  ali  23  444LRQRAKVHHTATHLLQSALKKVIGQETSQAGS-LVAFERLRFDFNFHRPLIDDELAEIERLVNKWVGDATPLQTKVMPLADAKGAGAIAMFG----EKYSEEVRVVEVPGVSMELCGGTHVSNTSEIRGFKIIS-EQGIASGIRRIEAVAGDAFIEYV. 595
575 3.000e-73UniRef50_A0A1Z9VEM1 Alanine--tRNA ligase n=1 Tax=bacterium TMED274 TaxID=1986781 RepID=A0A1Z9VEM1_9BACT  ali  23  541.RKDIKINHSATHLLHQALKDVLGNHINQAGS-LVHPDYLRLDITHPSKIDTKDIVAIELLVNNKIAENISVETDIKSLEDAKKEGATALFG----EKYGDTVRVVTMDSFSKELCGGTHVESTIEIDKF-IVKNEKAIASGVRRIHALTGKHVEDYLD 692
576 3.000e-73UniRef50_A4S051 Alanine--tRNA ligase, chloroplastic/mitochondrial n=318 Tax=cellular organisms TaxID=131567 RepID=SYAP_OSTLU  ali  21  582.RRRAKSNHTATHLLQSALKKVLGEDVSQAGS-LCGFDRLRFDFNSPKAPTEAQLLEVENLVNGWISQSAALTAEEMPIAAAKDKGATMMFG----EKYGDVVRVVDVPGISMELCGGTHVSNTAEIGGFKILS-EAGIASGIRRIEAVAGAGVVELLQ 733
577 3.000e-73UniRef50_A0A221SUW8 Alanine--tRNA ligase n=2 Tax=Deinococcus ficus TaxID=317577 RepID=A0A221SUW8_9DEIO  ali  21  571.RAAIQRHHTATHLLHAALRAVLGSGVQQKGS-LVAADRLRFDFSHGAALSAAEIAQVELLVSRWVSANFPVSWQEMPIADAKAMGATALFG----EKYGDTVRVVRVGDVSMELCGGAHVRRTGDIGAFVLLSDEN-VAAGVRRIEALAGDAATTWV. 730
578 3.000e-73UniRef50_A0A1E3H2K2 Alanine--tRNA ligase n=7 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A1E3H2K2_9RHIZ  ali  21  321.RGAISSNHSATHLLHEALRQVLGTHVAQKGS-QVSPDRLRFDFSHTKPVSEAEIAAIETMANAIVLQDSPVVTRLMGVDDAIASGAMALFG----EKYGDEVRVVSMGDYSVELCGGIHVGRTGEIGLVHVL-QESAVASGVRRLEALTGHAARQYL. 481
579 3.000e-73UniRef50_A0A2N1U6M0 Alanine--tRNA ligase n=2 Tax=Planctomycetes TaxID=203682 RepID=A0A2N1U6M0_9BACT  ali  22  577.RRQSRKNHTATHILQWALQQTLGRNVAQQGS-LVCPQYLRFDFTSPKALSPDEIKQVENLVNEKIRQNLPVTSACLPIAEAKKLGAMALF----NEKYGDTVRVIAVGAFSREFCGGTHIDNTGKIAGLKIIKEES-ISAGVRRITALTGDALLDYL. 736
580 4.000e-73UniRef50_A0A2A5A812 Alanine--tRNA ligase n=2 Tax=Planctomycetes bacterium TaxID=2026780 RepID=A0A2A5A812_9BACT  ali  22  557.RFDVVRNHTATHLLHAALRVVVGDHVQQKGS-LVAPDRLRFDISHYEKINSEQLTEVEGIVQDWILRDAEVQIHDIPLKEAKKRGAMALFG----EKYGDRVRMVEIPEFSLELCGGIHCQRTGEIGPMMIVG-EGSVASGVRRIEALTGXE...... 703
581 4.000e-73UniRef50_A0A0G1Q3A0 Alanine-tRNA ligase n=9 Tax=Bacteria candidate phyla TaxID=1783234 RepID=A0A0G1Q3A0_9BACT  ali  28  422..LKVTRLHTATHLLHQALREILGSHVKQMGSD-ITPERLRFDFIHPQKMTDEEKKRVEDLVNEKIKEDLPVLMEEMNFEEAIKQGALAFF----KEKYPERVKVYSAGSFSKEVCGGPHVSRTGEIGKFRIAKEESS-SAGVRRIKAMV......... 563
582 4.000e-73UniRef50_A0A235BYS3 Alanine--tRNA ligase n=3 Tax=unclassified Bacteria TaxID=2323 RepID=A0A235BYS3_9BACT  ali  24  526.RRLVQANHTATHLLQSALRHVLGEHVRQEGS-WVGKDRFRFDFTHFSRLSEREIRGIEQMVNDWILENIQVSIRYTTLKEARELGAIALFG----EKYEEPVRMVQIGDISLELCGGTHVKNTGEIGIFKIVS-EIGVHTGIRRIEAVTSMGVMRLL. 676
583 4.000e-73UniRef50_C1F8F1 Alanine--tRNA ligase n=6 Tax=Acidobacteriaceae TaxID=204434 RepID=C1F8F1_ACIC5  ali  23  656.RAATRRNHTGTHLLHAALREVLGTHVKQAGS-LVEPGRLRFDFSHFTQIADEELKDIEDLINRQVLVNTRVETEDVPIDVAVNEYAMALFG----EKYGERVRVVKIGDFSTELCGGTHTGATGEIGVVKLMS-EGSVSSGVRRVEAVTGLGALDEF. 808
584 4.000e-73UniRef50_B2A5J7 Alanine--tRNA ligase n=36 Tax=Bacteria TaxID=2 RepID=SYA_NATTJ  ali  22  557.RKDIMKNHSATHMLHYALKKVVGAHVEQAGS-LVAPDRLRFDFTHFAPLSEDEIKQIELEVNKLIRENSRVRVINTDLEEAKELGAVALFE----DKYEQEVRVIEIGPA-VELCGGTHATATGELGLFKIDNQ-TSVGAGVRRLEALTGQHALEYLD 707
585 4.000e-73UniRef50_A0A0G1PE07 Alanine--tRNA ligase n=27 Tax=root TaxID=1 RepID=A0A0G1PE07_9BACT  ali  24  443......KYHTATHLLHQALRDVLGDHVHQKGSN-ITSARLRFDFSHSARITPEELIRIEEKVNQKISVDLPVTRTEMPKDQALAQGALAFF----PEKYPETTSVYQIGDYSLELCGGPHVSSTGQIGRIKIVKEESA-GSGIRRIYA........... 578
586 4.000e-73UniRef50_A0A0F9MEY9 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=A0A0F9MEY9_9ZZZZ  ali  20  1........HTATHILHWALRKVFGAHVKQAGS-LVEDDRLRFDFTHFEAMDTKQIKKVEDLVNEKILQALPVKAFTTTIDYAKEIQAIAFF----NEKYGEFVRVVEAGDFSKELCGGTHVTNTAFINLFKI-NSEGSVGANLRRIEAFTGGRLFKRF. 144
587 4.000e-73UniRef50_A0A0E9DW62 Alanine--tRNA ligase n=66 Tax=Bacteria TaxID=2 RepID=A0A0E9DW62_CHLTH  ali  18  559.RECIRRNHTATHLLDAALIKVLGDHVSQAGS-LVAPDRLRFDFTHFEALTPAQIAQVEQLVNDEIFAAEPMVTRIMSREEAKNSGAIQLFEDM----YGDDVRVVSTGPYSRELCGGTHARNTADIGCFKIIS-ETSVGSNVRRLEALTSLGYIDYMK 714
588 5.000e-73UniRef50_UPI0009DC011B hypothetical protein n=1 Tax=Planktothrix agardhii TaxID=1160 RepID=UPI0009DC011B  ali  21  146.RRRAQANHTATHLLQSALKLIVDPSISQAGS-LVDFERLRFDFNSPRGLTAEELQQIEDQVNSWITEAHPAVIAEMAIEAAKAKGAIAMFG----EKYSDIVRVVDYSGVSMELCGGIHVSNTAEIGLFKIIS-ETGIASGIRRIEAVAGQAVLDYLK 297
589 5.000e-73UniRef50_A0A0E0DZT2 Probable alanine--tRNA ligase, chloroplastic n=8 Tax=Oryza TaxID=4527 RepID=A0A0E0DZT2_9ORYZ  ali  21  623LRQGAKAHHTATHLLQSALKSVIGSETSQAGS-LVAFDRLRFDFNFHRPLSEEELMKIESLVNKWVSSATHLETKVMDLQDAKNAGAIAMFG----EKYGEQVRVVEVPGVSMELCGGTHVSNTAEIRGFKIIS-EQGIASGVRRIEAVAGDAFVEYV. 774
590 5.000e-73UniRef50_A0A2A2TAK9 Alanine--tRNA ligase (Fragment) n=2 Tax=Cyanobacteria TaxID=1117 RepID=A0A2A2TAK9_9CYAN  ali  21  48.RRRAQANHTATHLLQAALKKIVDEGISQAGS-LVNFDRLRFDFNCPRALTSEEVQQVEELVNTWISEAHPAKIEVLSLSDAKAKGATAMFG----EKYGSEVRVIDFVGVSMELCGGTHVSNTAEIGVFKIIS-EAGISSGVRRIEAVSGSAILDYL. 198
591 5.000e-73UniRef50_A0A1G1W910 Alanine--tRNA ligase n=5 Tax=cellular organisms TaxID=131567 RepID=A0A1G1W910_9BACT  ali  25  511....TTKGHTATHLLHQALRTVLGEHVEQRGSN-ITPERIRFDFSHGEKLTDEEIKKVEELVNQKIKEDLPVKKEIMSPGEAKKAGAIGLFE----EKYSDKVSVYSVGNFSKEICGGPHVEYTGQLGKFKIIKEE-ALGSGQRRIRAV.......... 649
592 5.000e-73UniRef50_A0A1V5KWE6 Alanine--tRNA ligase n=8 Tax=Bacteria TaxID=2 RepID=A0A1V5KWE6_9BACT  ali  20  553.RRSTERNHTVTHLTHKALRTVLGDHVHQSGS-WVGPQQMRFDFSHFEKVAAAQLRQIEDIVNEQIRTNRLVSWQEMPLEQARALGAMALFG----EKYGERVRMVEVAGFSRELCGGTHVRATGEIGVFAIT-AESAVAAGIRRIECATGAGFIDLF. 703
593 6.000e-73UniRef50_A0A2H6HE96 Alanine--tRNA ligase n=3 Tax=Bacteria TaxID=2 RepID=A0A2H6HE96_9BACT  ali  19  552.REYLRKNHTGTHLLHAALRDVIGDHVQQAGS-LVAPDRLRFDFNHYTAVAPEELRDVELLVNEQVIDNAQVDTLVTSKTEAERMGAIAFFG----DKYGDEVRVVKTGEFSTEFCGGTHVSSTGQVGPLLLIS-EGSVGSNVRRVEALTGVRAYEHL. 702
594 6.000e-73UniRef50_A0A2D5NG61 Alanine--tRNA ligase n=1 Tax=Planctomycetes bacterium TaxID=2026780 RepID=A0A2D5NG61_9BACT  ali  20  570.RRATERNHTATHLLHAALRQVLGDHVSQAGSE-VSPERLRFDYTQPEKPGADAMRAVEEIVNEQVLLTTPVEASVRSLEDAKRQGFTALFG----EKYGDEVRTLQVGDFSKELCGGTHVNNTGNIGLFRIVS-EGAVAAGTRRIEAVTGRVAMQ... 718
595 7.000e-73UniRef50_A0A2M7FYX5 Alanine--tRNA ligase n=1 Tax=bacterium (Candidatus Blackallbacteria) CG17_big_fil_post_rev_8_21_14_2_50_48_46 TaxID=2014261 RepID  ali  25  541.RRETMKHHSVTHLMHQALKDVLGDQVKQAGSE-VTHLQTRFDFNFNRAMSAEEIQKVEEIVNAQIMLNHAVQTQVLPIEEARKSGAVAMFG----EKYGDVVRVIGMGDYSMEFCGGTHVPATGTIGSFKVISEE-AISAGVRRITAVAGLAAYRY.. 690
596 7.000e-73UniRef50_A0A0G0LJX7 Alanine-tRNA ligase n=2 Tax=Patescibacteria group TaxID=1783273 RepID=A0A0G0LJX7_9BACT  ali  26  194......KYHTATHLLHQALREILGDHVVQKGSN-ITPKRLRFDFSHSDKMTDEEKQKVENLVNQKIKEKLSVSVEEMRMEEAKKRGALGVFE----EKYGDRVKVYSIGDFSKEICGGPHVKNTSELGKFKIQKEE-AIAAGVRRARAV.......... 330
597 7.000e-73UniRef50_A0A1G1M9T1 Alanine--tRNA ligase n=1 Tax=Nitrospirae bacterium RIFCSPLOWO2_12_FULL_63_8 TaxID=1801718 RepID=A0A1G1M9T1_9BACT  ali  22  324.RQDAARNHTATHLVHAALRELLGPHVKQYGS-LVAPNRLRFDFAHFRPLSSRDTDDIESMVNEQIRKNQAVKTDVMGVQEAVAAGALAFFG----DKYGDQVRVVSVDSFSRELCGGTHCRQTGEIGVFRLVS-ETGVAAGVRRIECVTGSGA..... 470
598 8.000e-73UniRef50_A6H0Y3 Alanine--tRNA ligase n=14 Tax=Flavobacterium psychrophilum TaxID=96345 RepID=SYA_FLAPJ  ali  17  571LRASTSKNHSATHLMHLALRSILGTHVEQKGS-LVNPDYLRFDFSHFSKVSDDQLRQVEASVNAQIEAQLQLEHRNIPIKEALDKGAMALFG----EKYGDNVRMIEFGE-SKELCGGIHVKNTAQIWHFKILS-EGAVAAGIRRIEAITGDAVKAFY. 722
599 8.000e-73UniRef50_A0A2E6D460 Alanine--tRNA ligase n=8 Tax=Bacteria TaxID=2 RepID=A0A2E6D460_9BACT  ali  20  579.RQSTRAHHTATHLLHAALRQVLGDHVTQQGS-YVGPDRLRFDFSNPKGVSAEDLAKVERLVNAAVAKGTTVATTIEKPEEAKARGVMALFG----EKYGETVRVVAVGEDSIELCGGTHVESSGQIGTFVIQ-QERAIQAGVRRIEAVVGAGA..... 725
600 8.000e-73UniRef50_A0A1W9S1W8 Alanine--tRNA ligase n=1 Tax=Candidatus Coatesbacteria bacterium 4484_99 TaxID=1970774 RepID=A0A1W9S1W8_9BACT  ali  26  790.RRETERHHTATHLLHYALRQVFGEEVKQSGS-YVNSERLRFDYTIGRQPTREELLEVEQLVNEKILSDDEVSYSFKLLKEAHKEGVIALFE----DKYGEVVRVLSIGDYSKELCGGTHVRRTGEIGSFYILSD-SAVSAGVRRIEAVCGLSAVRY.. 939
601 8.000e-73UniRef50_Q0BSD5 Alanine--tRNA ligase n=480 Tax=root TaxID=1 RepID=SYA_GRABC  ali  18  558.RSAIRAHHSATHLLHEALRRRLGTHVAQKGS-LNAPDRLRFDVSQPTPITRDDLAVVEAEVNALIRQNSPVNTRLMTPEQAVAEGAMALFG----EKYGDEVRVVSMGAYSIELCGGTHVGRTGDIGLFRITG-ESAVSAGVRRIEAVTGEAALAQI. 716
602 9.000e-73UniRef50_I4B7G1 Alanine--tRNA ligase n=1 Tax=Turneriella parva (strain ATCC BAA-1111 / DSM 21527 / NCTC 11395 / H) TaxID=869212 RepID=I4B7G1_TURPD :_  ali  24  553.REALQRHHSATHLLNAELRKALGNHVKQSGS-LVHPDYLRFDFAHPKALSAEELVRVETAVNDAIAANAEVATAVLPKSEAEKRGAVMTFG----EKYGDVVRVVEMGGFSSEFCGGTHVARTGDIAGFLIQK-ESSPGAGNRRIEAVAGEAAVK... 701
603 9.000e-73UniRef50_A0A2E5Z8N4 Alanine--tRNA ligase n=2 Tax=Chloroflexi TaxID=200795 RepID=A0A2E5Z8N4_9CHLR  ali  19  593.RQDTARNHTATHMLHAALRGVLGAHVRQAGS-LVTPDRLRFDFTHFRPLTTEQISEIQYLVNGRIRADLLCEKSEIAYKEALEKGALAFFGDR----YPENVRTLQIGNFSYEVCGGTHVNRTGQIGLFHITS-ESGLGTGIRRLEAVTGSGADRWLE 748
604 1.000e-72UniRef50_A0A1H6FTG2 Alanine--tRNA ligase n=4 Tax=Thermoleophilia TaxID=1497346 RepID=A0A1H6FTG2_THEAL  ali  23  573.RRRTMRNHTATHLLHAALRRQLGSHVRQAGS-YVGPDKLRFDFTHGKRLGRDEAEEIQGLVNAWVEQRLPVRAFETTREEANRLGAIALFG----EKYGDWVRVVEIDDVSRELCGGTHVASSAEIGLFEI-EAETSSASNVRRIEAVTGPAAAALF. 723
605 1.000e-72UniRef50_D1AX74 Alanine--tRNA ligase n=46 Tax=Fusobacteriia TaxID=203490 RepID=D1AX74_STRM9  ali  23  549.RNDIKKNHTATHLLHKVLKDVLGSAVEQAGS-LVSDDGLRFDFSYYEQVSQEQVNIIENKVNELILENLPVYINYENINDAVKKGAMALF----SDKYGDVVRVIDISGVSLELCGGTHVSSTGEIGLFKI-KSEQGKASGIRRIEATTGYKSLEYV. 699
606 1.000e-72UniRef50_A0A1F5MKQ3 Alanine--tRNA ligase n=2 Tax=cellular organisms TaxID=131567 RepID=A0A1F5MKQ3_9BACT  ali  26  441....TTKLHTATHLLQQALRLVLGEHVSQKGSN-ITEERLRFDLSHPEKLTNEQIKEVENLVNQKIIENIPVTVETMNKEEALNSGARAFF----AEKYGDQVTVYTIGEFSQEICGGPHVKQTGEVGSFKITKEE-AVSAGVRRIYATV......... 580
607 1.000e-72UniRef50_A0A2E5IX70 Alanine--tRNA ligase n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2E5IX70_9CHLR  ali  15  550.RFNIMRNHTATHLLHAALRRRLGDHVRQAGS-LVDPDRLRFDFTHPDSLTDAELEEVQAWVNAEVL