current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 2e3c_A mol:protein length:291 Pyrrolysyl-tRNA synthetase, from PDB1018

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .
# E-value Template Links and tools%idFirst MGSSSSGLVPRGSHMASAPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSGSYYNGISTNLLast
1 0.000e+00UniRef50_J9JVQ6 Uncharacterized protein n=21 Tax=Eukaryota TaxID=2759 RepID=J9JVQ6_ACYPI  ali  16  191.GSWKSTPFKLYNFEALGQPQSAGCLHPLLKVRSDFRQIFLEMG--FTEMTNNFVESSFWNFDALFQPQQHPARDS-----HDTFFLENPQ---TSENFPQEYLNKVKTVHSKGGYDWSLDEAKKNVLRTHTTAVSARMLYGLAKDF-KPTKYFSIDRVFRNETLDATHLAEFQQVEGVIADYNLTLGDLIGVLHMFFERLGMTEIKFKPAYNPYTEPSMELKKWIEIGNSGMFRPEMLLPMGLKVNVIAWGLSLERPTMIKYGINNIRDLVGPRVNLQMVQDN. 479
2 0.000e+00UniRef50_A0A0V1HA16 Phenylalanine--tRNA ligase alpha subunit (Fragment) n=5 Tax=Eukaryota TaxID=2759 RepID=A0A0V1HA16_9BILA  ali  16  41...WQEKKFKPYNFKAFGVAPVRGYLHPLMKVRTEFRQIFLEMG--FTEMTQRYVESSFWNFDALFQPQQHPARDE-----QDTFFISEPMYTDLPYVKRVEKVHSVGDGSSGYGYKWKIEEAAKNVLRTHTTASSIRMLYEIAKKPFKPVRYFSIDRVFRNESLDATHLAEFHQVEGLIAGENLSLGHLIGILQEFYKKLGIERLRFKPAYNPYTEPSMELKKWVEIGNSGMFRPEVLLPLGLNVTVIAWGLSLERPTMIKYGIDNIRDLIGPRVDLTMIQ... 326
3 0.000e+00UniRef50_A0A158NE23 Uncharacterized protein n=24 Tax=Ecdysozoa TaxID=1206794 RepID=A0A158NE23_ATTCE  ali  18  193.GAWKDKKFKPYNFDALGASLQIGHLHPLLKVRHEFRKIFLEMG--FTEMSNNYIESSFWNFDALFQPQQHPAR-----DAHDTFFISEPLSTKFPMLERVRTVH-SKGAYGSQGYRWKLEEAQKNLLRTHTTSNSARMLYKLMKGDFKPIKYFSIDRVFRNETLDATHLAEFHQVEGVVADYNLTLGNLIGILYEFFSKLGITQLRFKPAYNPYTEPHNGLEKWIEIGNSGMFRPEMLLPMNLDVNIIAWGLSLERPTMIKYGLNNIRDLVGPKVDMEMVHNN. 483
4 0.000e+00UniRef50_A0A2P4UXE9 Uncharacterized protein n=5 Tax=Caenorhabditis TaxID=6237 RepID=A0A2P4UXE9_CAERE  ali  15  255.GSWKDKQFKKYNFESLGVVPSSGHLHPLMKVRSEFRQIFFSMG--FSEMTNRYVESSFWNFDALFQPQQHPAR-----DAHDTFFVSDPA-ISTDYLERVKTVHSKGGGSAGYNYDWKIEEAQKNVLRTHTTAVSARQLYQLAQEGFRPSKLFSIDRVFRNETLDATHLAEFHQVEGVIAEKNLSLAHLIGVFTEFFKKLGITNLRFKPTYNPYTEPSMELAKWVEIGNSGMFRPEMLLPMGLDVNVAGYGLSLERPTMIKYGINNIRDLFGSKIDLEVVYN.. 543
5 0.000e+00UniRef50_Q9Y285-2 Isoform 2 of Phenylalanine--tRNA ligase alpha subunit n=98 Tax=Eukaryota TaxID=2759 RepID=Q9Y285-2  ali  17  168VGSWRDRPFKPYNFLAHGVLPDSGHLHPLLKVRSQFRQIFLEMG--FTEMTDNFIESSFWNFDALFQPQQHPARDQ-----HDTFFLRDPAEALQLPMDYVQRVKRTHGGYGSQGYKWKLDEARKNLLRTHTTSASARALYRLAQKKPFPVKYFSIDRVFRNETLDATHLAEFHQIEGVVADHGLTLGHLMGVLREFFTKLGITQLRFKPAYNPYTEPSMELKKWVEVGNSGVFRPEMLLPMGLPENVIAWGLSLERPTMIKYGINNIRELVGHKVNLQMVY... 457
6 0.000e+00UniRef50_Q9Y285 Phenylalanine--tRNA ligase alpha subunit n=231 Tax=Eukaryota TaxID=2759 RepID=SYFA_HUMAN  ali  17  200.GSWRDRPFKPYNFLAHGVLPDSGHLHPLLKVRSQFRQIFLEMG--FTEMTDNFIESSFWNFDALFQPQQHPARDQ-----HDTFFLRDPAEALQLPMDYVQRVKRTHGGYGSQGYKWKLDEARKNLLRTHTTSASARALYRLAQKKPFPVKYFSIDRVFRNETLDATHLAEFHQIEGVVADHGLTLGHLMGVLREFFTKLGITQLRFKPAYNPYTEPSMELKKWVEVGNSGVFRPEMLLPMGLPENVIAWGLSLERPTMIKYGINNIRELVGHKVNLQMVY... 488
7 0.000e+00UniRef50_A0A212F868 Phenylalanyl-tRNA synthetase alpha subunit n=2 Tax=Eukaryota TaxID=2759 RepID=A0A212F868_DANPL  ali  16  194.GAWKDLQFKPYNFDALGQPPDSGHLHPLLKVRSEFREIFLEMG--FTEMTNRYVESSFWNFDALFQPQQHPAR-----DAHDTFFISSPAVSSQFPMDYLEKVKKVHGGYGSQGYTWKLEEAQKNLLRTHTTAVSARTLY-KRADRHTPIKCFSIDKVFRNETLDATHLAEFHQVEGVIADKDLGLADLITVLDDFFKRLGFDKLQFKPAYNPYTEPHNGLEKWIEIGNSGVFRPEMLLPMGLDVNVIAWGLSLERPTMIKYGLNNIRDLVGPKVDLQMVQSN. 482
8 0.000e+00UniRef50_A0A226MD39 Uncharacterized protein n=3 Tax=Archelosauria TaxID=1329799 RepID=A0A226MD39_CALSU  ali  18  224.GSWRTLPFKAYNFSALGLPPACGHLHPLLKVRSQLRQIFLEMG--FTEMTDNFVESSFWNFDALFQPQQHPARDQ-----HDTFFLRDPAEAELPA-NYMARVKKVHGGYGSQGYKWKVEEARKNLLRTHTTSASARALYHLARQGKFPVKYFSIDRVFRNESLDATHLAEFHQVEGVVADRGLTLGHLMGILQQFFTKLGISKLRFKPAYNPYTEPHEGLKKWVEVGNSGVFRPELLLPMGLNVSVIAWGLSLERPTMIKYGITNIRELVGHRVSLQMIY... 512
9 0.000e+00UniRef50_A0A261Y4Z5 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Bifiguratus adelaidae TaxID=1938954 RepID=A0A261Y4Z5_9FUNG  ali  16  155.GEWKTADFKPYNFNAIGLAPPGGHLHPLMKVREEFRRIFFEMG--FEEMTNKFVESSFWNFDALFQPQQHPAR-----DAHDTFFIKDPATSDLPLMAKVKKTHEDGGDTGSTGYRWKVEEAEKLLLRTHTTAVSSYMLYKLAQEPERPAKYFSIDRVFRNESVDATHLAEFHQLEGVIADRNLTLGDLIGFMDIFFKKMGIEKIRFKPAYNPYTEPHEGLKKWVEIGNSGMFRPEMLGPLGLDVRVIAWGLGLERPTMIKYGISNIRDLLGHKVNLSMVE... 444
10 0.000e+00UniRef50_T1JMN7 Uncharacterized protein n=3 Tax=Mandibulata TaxID=197563 RepID=T1JMN7_STRMM  ali  17  264..SWKEKKFKEYNFNALGVEPTCGHLHPLMKVRAEFRQIFLEMG--FTEMTNNFIESAFWNFDALFQPQQHPAR-----DAHDTFFVSKPAQFPSDYVQRVKTMHEDGG-HGSEGYKWKMEEAAKNLLRTHTTAVSARMLYKLAQQPEFPVKYFSIDRVFRNETLDATHLAEFHQIEGVIADRGLTLGDLIGTLHEFFKKLGISKLRFKPAYNPYTEPHEGLGKWVEVGNSGVFRPEMLLPMGLDVRVIAWGLSLERPTMILYGIDNIRDLVGHKVDLQMVRDN. 553
11 0.000e+00UniRef50_G3WQG8 Phenylalanyl-tRNA synthetase alpha subunit n=13 Tax=Eukaryota TaxID=2759 RepID=G3WQG8_SARHA  ali  17  151.GSWRDVKFKAYNFSSKGILPEGGHLHPLMKVRTQFRQIFLEMG--FTEMTDNFIESSFWNFDALFQPQQHPARDQ-----HDTFFLKDPAEALDFPMDYVERVKRIHGGYGSQGYKWKMEEAQKNLLRTHTTAASARALYRLAQKKPFPAKYFSIDRVFRNETLDATHLAEFHQIEGVVADYGLTLGHLMGILKEFFTKLGITNLRFKPAYNPYTEPSMELKKWVEVGNSGVFRPEMLLPMGLPESVIAWGLSLERPTMIKYGINNIRELVGHKVNLQMVYDN. 441
12 0.000e+00UniRef50_A0A088AIQ1 Uncharacterized protein n=52 Tax=Pancrustacea TaxID=197562 RepID=A0A088AIQ1_APIME  ali  16  193.GAWKNKKFKPYNFAALGTTLEVGHLHPLLKVRSEFRKIFLEMG--FTEMTNNYVESSFWNFDALFQPQQHPAR-----DAHDTFFIAEPSHSTNFPIDYMEKVKKVHGDYGSLGYRWKLEEAQKNVLRTHTTAVSARMLYKLMQQNKKPVKYFSIDRVFRNETLDATHLAEFHQIEGVIADYNLTLGDLIGILYEFFKKLGIIQLQFKPAYNPYTEPHEGLKKWIEIGNSGMFRPEMLLPMGLDVNVIAWGLSLERPTMIKYGLNNIRDLVGPKIDLEMVYNN. 483
13 0.000e+00UniRef50_A0A0B1SLL8 Phenylalanine--tRNA ligase, alpha subunit (Fragment) n=4 Tax=Ecdysozoa TaxID=1206794 RepID=A0A0B1SLL8_OESDE  ali  17  78.GSWKNKTFKQYNFDALGVQPPCGHLHPLMKVRSEFRQIFFAMG--FTEMTNRYVESSFWNFDALFQPQQHPAR-----DAHDTFFVSEPLSTKFPMLERVKTVHSKGGGSAGYNYDWKIEEAQKNVLRTHTTAVSARQLYKLAQEGFKPTKMFSIDRVFRNETLDATHLAEFHQVEGVIAERNLSLAHLIGIFTEFFKKLGIENLRFKPTYNPYTEPHDGLKKWVEIGNSGMFRPEMLLPMGLDVNVAGYGLSLERPTMIRYGIDNIRDMFGPKVNLEMIYN.. 366
14 0.000e+00UniRef50_A0A2J7Q0D3 Phenylalanine--tRNA ligase alpha subunit n=4 Tax=Neoptera TaxID=33340 RepID=A0A2J7Q0D3_9NEOP  ali  16  211.GSWREEKFKPYNLDALGAPLNCGHLHPLLRLRAEFRQIFLEMG--FTEMTNNYIENSFWNFDALFQPQQHPAR-----DAHDTFFISNPQHFPPEYLQKVKQVH-SKGGYGSQGYDWKIEEAQKNLLRTHTTAVSARMLYLLAKEGFKPSKYFSIDRVFRNETLDATHLAEFHQVEGVIADYSLTLGDLIGTLYEFFNKLGITKLQFKPAYNPYTEPSMELGKWIEVGNSGIFRPEMLLPMGLDVNVIAWGLSLERPTMIKYGLNNIRDLVGAKIDLQMVHN.. 499
15 0.000e+00UniRef50_A0A1Y3B458 Phenylalanine-tRNA ligase alpha subunit B-like protein n=3 Tax=Bilateria TaxID=33213 RepID=A0A1Y3B458_EURMA  ali  15  22.GTWRTKTFKGYNFNALGIPPDRGHLHPLLKVREQFRQIFLEMG--FEEMTNNYVESSFWCFDTLFVPQKHPAR-----DLQDTFYLSDPAECDIPYMERIRSVHENGGNCGSIGYEWKESEARKNVLRTHTTAVSARMLYHAAQQYKRPIKLFSIDRVFRNETLDATHLAEFNQIEGVVADRNLTLGHLMGMTKAFFEKLGIHDIRFKPTYNPYTEPSMELGKWVEIGNSGLFRPEMLKPMELDINVLGWGLSLERPTMIKYGISNIRDLVGHKIDLQMVYDN. 319
16 3.000e-98UniRef50_A0A2P2I4I7 Phenylalanine--tRNA ligase alpha subunit-like n=1 Tax=Hirondellea gigas TaxID=1518452 RepID=A0A2P2I4I7_9CRUS  ali  15  213.GQWRNKTFKPFNFRSKGKQVRPGHLHPLMQLRSEFRQIFLEMG--FSEMTNSYVESAFWNFDALFQPQQHPAR-----DAHDTFYVKTPGRISVPYMQRVREVHSNGGGSSGYRYPWSEEEAHKNLLRTHTTAVSARMLHKLAQDGFKPAKYFSIDRVFRNETLDATHLAEFQQIEGVVADYNLSVKHLIGMFTAFYEKIGIKKLRFKSTYNPYTEPHDGLGKWVEVGNSGLFRPEMLRPMGLPENVLGWGLSLERPAMIMFGINNIRELVGPRVKMELVYSN. 503
17 4.000e-98UniRef50_Q9T034 Phenylalanine--tRNA ligase alpha subunit, cytoplasmic n=56 Tax=Eukaryota TaxID=2759 RepID=SYFA_ARATH  ali  14  191...WKELEFKEYNFKAKGAPVDAGHLHALLKVRKQFKDIFVQMG--FEEMTNNYVESSFWNFDALFQPQQHPARDS-----HDTFFLKVPSTTRTDYVERVKRVHESGGYGSRGYYDWKREEANKNLLRTHTTAVSSRMLYALAQKPFVPKKYFSIDRVFRNEAVDRTHLAEFHQIEGLICDRGLTLGDLIGVLEDFFSRLGMSKLRFKPAYNPYTEPHEGLGKWVEIGNSGMFRPEMLLPMGLDVRVIAWGLSLERPTMILYGIDNIRDLFGHKVDLDLIKRN. 478
18 2.000e-97UniRef50_A0A026WQG6 Putative phenylalanyl-tRNA synthetase alpha chain (Fragment) n=14 Tax=Hymenoptera TaxID=7399 RepID=A0A026WQG6_OOCBI  ali  18  194.GAWKSKKFKPYNFEALGAALQIGHLHPLLKVRHEFRKIFLEMG--FTEMANNYVESSFWNFDALFQPQQHPAR-----DAHDTFFISEPR-VSTPMLEKVKTVHSKGGGSQGYRYDWKLEEAQKNLLRTHTTAVSARMLHKLMQEGEKPVKYFSIDRVFRNETLDATHLAEFHQIEGVVTDYGLTLGDLIGTLYEFFKKLGITQLQFKPAYNPYTEPHNGLKKWIEIGNSGMFRPELLLPMDLDVNVIGWGLSLERPTMIKYGLNNIRDLVGPKVDMEMVHNN. 489
19 6.000e-97UniRef50_A0A0P4W1C9 Uncharacterized protein n=3 Tax=Eumalacostraca TaxID=72041 RepID=A0A0P4W1C9_9EUCA  ali  16  193.GQWKNANFKPYNFKSKGVELRSGHLHPLMQLRSEFRRIFLEMG--FTEMTNSYVESAFWNFDALFQPQQHPAR-----DAQDTFYVADPLEVPEDYLERVRKTHSEGG-YGSIGYKWNRAEADKNLLRTHTTAVSARMLYKLAQDGFKPAKYFSIDRVYRNETLDATHLAEFYQVEGVVADHNFSIKNLMGVIGSFFKKIGMTSVRFKPTYNPYTEPSMELKKWVEVGNSGLFRPEMLRPMGLSVKVCGYGLSLERPAMIMYGINSIRELVGPRVKMELILDN. 483
20 5.000e-96UniRef50_A0A1I7VQ56 Uncharacterized protein n=2 Tax=Loa loa TaxID=7209 RepID=A0A1I7VQ56_LOALO  ali  15  289.GSWRKKMFKKYNFDALGMMPAGGHLHPLMKVRNEFRQIFFQMG--FVEMTNRYVESSFWNFDALFQPQQHPAR-----DAHDTFFLSDPEKFSFPYLQRVKKVHAEGGYGSRGYYDWKLEEAQRNVLRTHTTAISAHQLYKLAKEGFKSTKMFSIDRVFRNETLDATHLAEFHQVEGVVAERNLTLGHVMGLFTEFFRKCGITNLRFKPTYNPYTEPHEGLGKWVEIGNSGMFRPEMLLPMGVDVNVAGYGLSLERPTMIRYGIDNIRDLFGPKVDLRMIYEN. 578
21 7.000e-95UniRef50_P15625 Phenylalanine--tRNA ligase alpha subunit n=600 Tax=Eukaryota TaxID=2759 RepID=SYFA_YEAST  ali  15  206....KDLKFKPYNFNSQGVQISSGALHPLNKVREEFRQIFFSMG--FTEMSNQYVETGFWNFDALYVPQQHPAR-----DLQDTFYIKDPLTADLPYMDNIKAVHEQGRGSIGYRYNWKPEECQKLVLRTHSTAISARMLHDLAKD-PKPTRLFSIDRVFRNEAVDATHLAEFHQVEGVLADYNITLGDLIKFMEEFFERMGVTGLRFKPTYNPYTEPHEGLQKWVEIGNSGMFRPEMLESMGLDLRVLGWGLSLERPTMIKYKVQNIRELLGHKVSLDFIETN. 492
22 1.000e-94UniRef50_G3AF86 Uncharacterized protein n=11 Tax=Eukaryota TaxID=2759 RepID=G3AF86_SPAPN  ali  16  36...WKDAEFKPYNFNSEGVYPPSGALHPLNKVREEFRQIFFSMG--FTEMSNQYVESGFWNFDTLFVPQQHPAR-----DLQDTFYLKDPVEAGLP--EDKEYWDRTSGKYGSIGYRWKGEESLRMVLRTHTTAISSAMLYQLAKD-PKPIRLFSIDRVFRNEAVDATHLAEFHQVEGVIAGYDITLGDLIGFMEDFFGKMGVNGLRFKAAYNPYTEPHKGLGKWVEIGNSGMFRPEMLETMGLPKNVLGWGLSLERPTMIKYGVSNIRELLGHKVSLDFVESN. 323
23 2.000e-94UniRef50_A0A2S4WN13 Uncharacterized protein n=1 Tax=Puccinia striiformis TaxID=27350 RepID=A0A2S4WN13_9BASI  ali  15  246.GRWKTATFKPYNFNAEGVPPNGGALHPLMKVREEFRNIFFEMG--FTEMTDKYIETSFWCFDSLFVPQQHPARES-----QDTFYLKDPSSTDFPYYEKVKNIHEVGG-HGSIGYRFQESETSKLVLRTHTTSVSANMLYQIAQESFKPSKLFSIDRVFRNEAVDATHLAEFHQVEGVVADKNITLGDLIGFMEVFFAKMGIHDIRVKPTYNPYTEPSMELKKWVEIGNSGLFRPEMLEPMGLDVRVLGWGLSLERPTMIKYGISNIRELLGHKVSLASVQ... 539
24 2.000e-94UniRef50_R9TBX4 Phenylalanine--tRNA ligase alpha subunit n=7 Tax=Thermoplasmata TaxID=183967 RepID=R9TBX4_METII  ali  19  219.GKWKDVAIRKYDVRTFAPAIYPGKKHPLSIIADEIRTIFTSMG--FKEIDEQYVQPAFWNMDALFTPQDHPAR-----ELQDTFYLAHPQELDDPVVEKVAAIHENGGNTGSIGWKWSKEEAEKLLLRTHTTVNSIKYLSQH---TEPPVKVFSLSKVFRKEAIDATHLPEFTQIEGIIMDEDANFDMLCGIIKEFYRRMGFTDIRFRPGYFPYVEPVKFRGKWMELGGAGVFRPEVTEPFGIKHPVLAWGMGFERLAMLRWNLKDLRDLY--ISDIEMLREN. 498
25 4.000e-94UniRef50_R1C468 Alpha subunit of phenylalanyl-tRNA synthetase n=2 Tax=Haptophyceae TaxID=2830 RepID=R1C468_EMIHU  ali  17  217.GTWRDALFKPVNVDAAGVAPAGGALHPLLKVRSMFREIFLEMG--FAEMTQQYVESSFWNFDALYQPQQHPAR-----DAHDTFFIKTPAQTELPYMERVRATHEVGGESTGWRYDWSEDEARKNLLRTHTTAASSRTLYQIAQLAKQPQKYFSIDRVFRNEALDATHLAEFHQVEGFVIDRNLSLGNLMGTIADFYRRLGFKHMKFKPTYNPYTEPHEGLGKWVEVGNSGVFRPEMLRPMGFDEDVIAWGMSLERPTMIKYGYDNIRDLFGHRIDLGMVR... 520
26 5.000e-94UniRef50_A0A1Y1IFG6 Phenylalanyl-tRNA synthetase class IIc alpha subunit n=3 Tax=Eukaryota TaxID=2759 RepID=A0A1Y1IFG6_KLENI  ali  18  225..AWKGATFKDYNFAALGLPPSGGSLHPLLKVRAQFRKIFLQMG--FEEMTNNFVESSFWNFDALFQPQQHPARDS-----HDTFFLKAPEKCRS---VPEDYMKRVKEMHEHGGGDWQYSEAAKNLLRTHTTAVSSRMLYKLAQDGFKPKKYFSIDRVFRNEAVDRTHLAEFHQIEGLICDRGVTLGDLLGTIEQFFSRLGMNEIRFKPAFNPYTEPHPQLKKWVELGNSGMFRPEMLQPMGLDVNVIAWGFGLERPTMILYNIDNIRDLFGHKVNLNVIRSN. 513
27 6.000e-94UniRef50_A0A0B7FNY9 Phenylalanyl-tRNA synthetase alpha chain n=60 Tax=Fungi TaxID=4751 RepID=A0A0B7FNY9_THACB  ali  15  206.GAWKSSTFKQYNFEAEGTPTNGGALHPLLKVREEFRNIFFEMG--FAEMTSQFVESGFWNFDTLFVPQQHPAR-----DLQDTFYLSDPAESHPPPKDYYDTVARTHGGFGSIGYRWREADSRRLLLRTHTTATSARMLKAIADRKGGPIKMFSIDRVFRNEAVDATHLAEFHQVEGLVADRGITLGDLIGFMQTFFKKMGVDNLRFKPAYNPYTEPHKGLNRWVEIGNSGMFRPEMLEPMGLDVRVLGWGLSLERPTMIRYGISNIRALVGHKVSIESVE... 495
28 1.000e-93UniRef50_A0A2P6TKZ9 Putative phenylalanine--tRNA ligase alpha subunit n=1 Tax=Chlorella sorokiniana TaxID=3076 RepID=A0A2P6TKZ9_CHLSO  ali  15  201.GTWKEETFKEYNFNALGLLPAGGHLHPLLKVRTQFRKIFTQMG--FEEMTNNYVESSFWNFDALFQPQQHPAR-----DAHDTFFLTKPA--ATPASNPADYMQRVKETHQHGGYGWATAEAEKNLLRTHTTAVSSRMLYRLAQEGFRPAKYFSIDRVFRNEAIDRTHLAEFHQIEGVVCDYGLTLSDLIGVLQEFFDRLGLSKLRFKPAFNPYTEPSMELGKWIEVGNSGMFRPEMLRPMGLPENVIAWGLGLERPTMILYNIDNIRDLFGHKVSLSM..... 488
29 1.000e-93UniRef50_D2VDQ1 Phenylalanine-tRNA synthetase family protein, alpha subunit n=1 Tax=Naegleria gruberi TaxID=5762 RepID=D2VDQ1_NAEGR  ali  17  246..EWQNASFKEYNFKATGKRNENGYLHTLLKVRTEFRKVFLELG--FEEMTNNFVESSFWNFDALFQPQQHPAR-----DAHDTFFLENPKQISLPTLEDVKKIHEEGGGSIGYRYDWKVEESKKNLLRTHTTAVSTRYLRKLGEELSKPRKYFSIDRVFRNEAPDATHLCEFHQIEGMVIDKGLTLGDMIGLFRVFFAKIGITDLKFKPAFNPYTEPHPMLKKWVEVGNSGMFRPEMLRPMGLDVTVLAWGLSLERPTMIKYSVDNIRDLVGHKVDLGGVQKN. 540
30 2.000e-93UniRef50_A0A226E465 Phenylalanine--tRNA ligase alpha subunit B n=3 Tax=Folsomia candida TaxID=158441 RepID=A0A226E465_FOLCA  ali  14  201.GDWKTKNFKAYNFDALGTPIPAGHLHPLMKVRSEFRSVLFEMG--FSEMTNRFVESSFWNFDALFVPQKHPAR-----DAQDTFFVSQPSTCNS---IPEDYMNRVKAAHEGGSYNWKKEEALKNVMRTHTTAVSARMLYEIGQKKEFPTKLFSIDRVFRNETLDATHLAEFHQVEGVVADKGINLGHLIGIMKEFFSRLGIKKLRFKPAYNPYTEPHEGLKKWVEVGNSGMFRPEMLLPMGLDVRVIAWGLSLERPTMIRYGYDNIRDLVGPKVDLGMVY... 489
31 5.000e-93UniRef50_I1IEX1 Uncharacterized protein n=26 Tax=Eukaryota TaxID=2759 RepID=I1IEX1_BRADI  ali  16  201.GDWKDLEFKDYNYGAQGQPIAIGYVQPLLEVREAIQNIFVEMG--FSEMTNMFVESSFWNFDALFQPQQHPARDS-----HDTFFLKAPATTKLPYLEKVKQVHQSGGGSKGYGYDWKRDEAEKNLLRTHTTAVSTRMLYKLAQEKPFPKRYYSIDRVFRNEAVDRTHLAEFHQIEGLICDYGLTLGDLIGVLEDFFSRLGVSKLRFKPAYNPYTEPHEGLKKWVEIGNSGMFRPEMLLPMGLPENVIAWGLSLERPTMILYGIDNIRDLFGPKVDFNLIK... 489
32 9.000e-93UniRef50_A0A0D8X9L6 Phenylalanine--tRNA ligase, alpha subunit n=2 Tax=Dictyocaulus viviparus TaxID=29172 RepID=A0A0D8X9L6_DICVI  ali  15  211.GSWKLKTFKQYNFDSLGVQPPCGHLHPLMKVRSEFRQIFFSMG--FSEMTNRYVESSFWNFDALFQPQQHPAR-----DAHDTFFISDPARTDFPYLERVKAVHSKGGGSIGYNYDWKIEEAQKNVLRTHTTAVSARQLYKLAQEGYRPVKMFSIDRVFRNETLDATHLAEFHQVEGVIAERNLSLSHLIGVFTEFFRKLGIENLRFKPAYNPYTEPSMELKKWVEVGNSGMFRPEMLLPMGLDVNVAGYGLSLERPTMIRYGINNIRDLFGPKVDLQMVY... 548
33 1.000e-92UniRef50_A0A151ERF5 Phenylalanine--tRNA ligase alpha subunit n=20 Tax=Euryarchaeota TaxID=28890 RepID=A0A151ERF5_9EURY  ali  19  222.GLWKKKSIRPYDINAFAPAHYGGKAHPLLDLISTIRQIFLEMG--FEEIKGDFVESCFWNMDMLFIPQDHPAR-----EMQDTLYCKTPSKIDSKLINTISKVHEDGGITTGWGYKFSKEEGEKALLRTHTTVNTIRYLYNNPK---PPSKVFSIGRVFRKENIDTTHLPEFYQIEGIIHESDSNFRQLIGILKEFYRRMGFEKIRFRPGYFPYTEPSMEVNKWMELGGSGIFRPEVTEPIGIKSPVLAWGLGLERLAMLKFELTDIRDLYISDL......... 496
34 2.000e-92UniRef50_Q54KS8 Phenylalanine--tRNA ligase alpha subunit n=5 Tax=Eukaryota TaxID=2759 RepID=SYFA_DICDI  ali  17  192..SWEKESFKV-NINAMGVVPEQGYRHPLNKVKNEFKQIFLDMG--FEEMTFNFVENGFWNFDALFQPQQHPAR-----ELQDTFFIKDPKTFSDEYCERVKQVHSVGGGSLGWIYDWKLEEAEKNILRTHTTAVSARMLYKLAQNGFKPKKYFSIDRVFRNETLDATHLAEFHQVEGVIADVDISLGHLIGVISEFFKRLGIDNVRFKPAFNPYTEPHPILKRWVELGNSGIFRPELLLPMGIPENVAAWGLSLERPTMIKYGLDNIRAIFGNSINVNFIKNN. 479
35 2.000e-92UniRef50_U5HFV3 Uncharacterized protein n=1 Tax=Microbotryum lychnidis-dioicae (strain p1A1 Lamole / MvSl-1064) TaxID=683840 RepID=U5HFV3_USTV1  ali  14  786.GAWEKSNFKKYNFEAEGAPTNGGALHPLMKVREEFRNIFFEMG--FTEMTNRFVESGFWNFDALYVPQQHPAR-----EVQDTFYLKDPVASSGFPQDYVKKTHEVGGGSTGYCYPFSKEETSRLVLRTHTTSVSAAMLYKIANQPGGPSKLFSIDRVFRNETVDATHLAEFHQVEGVIADYNLTLADLIGFMEVFFKKMGVTNLRFKPAYNPYTEPHQGLNKWVEIGNSGMFRPEMLEPMGLDVRVHGWGLSLERPTMIRYGISNIRDLLGHKVPLEMIE... 1075
36 2.000e-92UniRef50_A0A0D6EGA2 SPOSA6832_00250-mRNA-1:cds (Fragment) n=30 Tax=Dikarya TaxID=451864 RepID=A0A0D6EGA2_SPOSA  ali  14  263.GAWEKSAFKKYNFEAEGAPTLGGALHPLMKVREEFRNIFFEMG--FTEMTNRFVESSFWCFDSLFVPQQHPAR-----EMQDTFYLKGPLLVSADYYERVKKVHEVGDGSTGYRYPFSKEETSRLVLRTHTTSVSSAMLYELANQPGGPAKMFSIDRVFRNEAVDATHLAEFHQVEGVVADRNLTLADLIGFMEVFFSKMGVKNLRFKPAYNPYTEPHEGLGKWVEIGNSGLFRPEMLETMGLDVRVLGFGLSLERPTMIRYGISNIRDLLGHKVPLEMIE... 573
37 2.000e-92UniRef50_A3LRA4 Phenylalanyl-tRNA synthetase, beta subunit, cytoplasmic n=116 Tax=Eukaryota TaxID=2759 RepID=A3LRA4_PICST  ali  15  198..SWKEAEFKPYNFNSEGVYPTSGALHPLNKVREEFRQIFFSMG--FTEMSNQYVETGFWNFDTLFVPQQHPAR-----DLQDTFYLKDPAVAKPPYWENIKAVHQD-GKFGSIGYRWKAEESLRMVLRTHTTAISSAML-HKLAEDPKPVRLFSIDRVFRNEAVDATHLAEFHQIEGVLAGYDITLGDLIGFMEDFFGKMGVHGLRFKSAYNPYTEPHKGLNKWVEIGNSGMFRPEMLESMGLPKNVLGWGLSLERPTMIKYGVSNIRELLGHKVLLDFIESN. 486
38 2.000e-92UniRef50_K3WA38 Uncharacterized protein n=11 Tax=Eukaryota TaxID=2759 RepID=K3WA38_PYTUL  ali  15  208..AWKRETFKPYNFNTLGLAVGGGHLHPLMKVRAEFRRVLMDMG--FQEMTNRYVESSFWNFDSLFQPQSHPAR-----DAHDTFFLTKPQKCLTVPEEYYERVHDMHGGFGSIGHGFKRETSMTNILRTHTTAISAQMLYKLANQPGGPQKYFSIDRVFRNESMDATHLAEFHQVEGVVADYDLSLGDLIGVIKAFFEKIGITKMRFKPAYNPYTEPHPDLNKWTEIGNSGVFRPEMLRPMGLPENVIAWGLSLERPTMIKYRLSNIRDLFGHKVDLE...... 494
39 3.000e-92UniRef50_A0A2D4BJM7 Phenylalanine-tRNA ligase, alpha subunit n=2 Tax=Eukaryota TaxID=2759 RepID=A0A2D4BJM7_PYTIN  ali  15  93..AWKSETFKPYNFNTMGLTVGGGHLHPLMKVRAEFRRVLMDMG--FSEMTNRFVESSFWNFDSLFQPQSHPAR-----DAHDTFFLTKPASCLTVPEEYYERVHDMHGGHGSIGHGFKRETSMKNLLRTHTTAISAQMLYKLANQPGGPQKYFSIDRVFRNESMDATHLAEFHQVEGVVADYDLSLGDLIGVIKAFFNKIGITQMRFKPAYNPYTEPHPDLKKWTEIGNSGVFRPEMLRPMGLPENVIAWGLSLERPTMIKYRLSNIRDLFGHKVDLENTRT.. 383
40 5.000e-92UniRef50_A0A0R0FHB9 Uncharacterized protein n=6 Tax=Mesangiospermae TaxID=1437183 RepID=A0A0R0FHB9_SOYBN  ali  17  82.GEWKELEFKEYNYSAKGQPLEGGNLHPLLKVRAQLKQIFLCMG--FEEMTNNFVESSFWNFDALFQPQQHPARDS-----HDTF----FLEARTTKILPEDYVLRVTQVHESGGYDWKREEANKNLLRTHTTSVSSRMLYQLAQKPFAPKKYFSIDRVFRNEAVDRTHLAEFHQIEGLVCDRGLTLCDLIGVLHDFFSRLGMTKLKFKPAYNPYTEPHEGFKKWVEVGNSGMFRPEMLQPMGLDVQVIAWGLSLERPTMILYGIDSIRDLFGHKI......... 363
41 2.000e-91UniRef50_A0A0G4H9B2 Uncharacterized protein n=1 Tax=Chromera velia CCMP2878 TaxID=1169474 RepID=A0A0G4H9B2_9ALVE  ali  16  217.GSWEKLEYKKYNFNAEGQTLPSGHLHPLLKVRREFRNVLLLMG--FEEMTNRWVESSFWNFDSLFQPQQHPAR-----DAHDTFFLTRPEKSRFPYFDLVKKTHEDGGGSIGWRYDWSEDEARKNLLRTHTTSVSARMLYKLAQDVKKPKKYFSIDRVFRNETLDATHLAEFHQVEGLVADVGLSLGHLIGTIKDFFQRIGITNLRFKPAYNPYTEPHPMLNKWVEIGNSGVFRPEMLRPMGLDVNVVAWGLSLERPTMIQYGIPNIRELFGHKVNLQELKTN. 533
42 3.000e-91UniRef50_A0A098VT94 Uncharacterized protein n=1 Tax=Mitosporidium daphniae TaxID=1485682 RepID=A0A098VT94_9MICR  ali  14  192.GSWKDRPFKPYNFDSDGPKRPCGHLHPLLKVRSEFRQIFFEMG---------FVENSFWNFDALFVPQQHPARDS-----QDTFFTESPAKANLPEA-YVAQVQKIHGGFGSLGYRWSVEETQKNVLRTHTTAVSARMLYALAKE------------VFRNESVDATHLAEFHQIEGVIADVNLTLGDLMGVLNSFFSKLGMKNLKFKPTYNPYTEPR--LQKWIEVGNSGIFRPEMLRPMGFDESVLAWGLSLERPTMIKYKINNIRDLVGHKVDLNMIYSN. 452
43 4.000e-91UniRef50_A0A074T637 Phenylalanyl-tRNA synthetase alpha chain A, putative n=16 Tax=Sarcocystidae TaxID=5809 RepID=A0A074T637_HAMHA  ali  14  233..AWEKSNFKEYNFFAAGKKIRRGAVHPLMQVMKQFKQILYCMG--FEEMTNQYVESSFWCFDSLFMPQQHPAR-----DVQDTFFLQAPKSSDTKIFNSVKNIHERGG-HGSIGYEWSEEESMGNILRTHTTASSARMLYGLAQEYKKPRKFFSIDRVFRNETLDATHLAEFHQVEGLVADRGLTIGHLMGVMETFYKQIGIEQLKFKPAYNPYTEPSMELKRWIEVGNSGIFRPEMLLPMGLDVTVIAWGLSLERPTMIRYGISNIRQLFGHRALLG...... 523
44 4.000e-91UniRef50_G4YI34 Uncharacterized protein n=20 Tax=Stramenopiles TaxID=33634 RepID=G4YI34_PHYSP  ali  15  208..AWKKETFKPYNFKTMGLSVGGGHLHPLMKVRAEFRRVLMDMG--FQEMTNRYVESSFWNFDSLFQPQSHPAR-----DAHDTFFLTQPKHCLT---VPEDYYKRVHDMHENGGFGFKRETSMTNILRTHTTAISAQMLYKLANQPGGPQKYFSIDRVFRNESMDATHLAEFHQVEGVVADYDLSLGDLIGIIKAFFLKIGITQMRFKPAYNPYTEPHPDLKKWTEIGNSGVFRPEMLRPMGLPENVIAWGLSLERPTMIKYRLNNIRDLFGHKIDLEQTR... 497
45 6.000e-91UniRef50_A0A2U9CQN9 Putative interleukin enhancer-binding factor 3 n=1 Tax=Scophthalmus maximus TaxID=52904 RepID=A0A2U9CQN9_SCOMX  ali  16 1063.GSWKEKKFKPYNFDAMGVAPDCGHLHPLMKVRTQFRQIFLEMG--FTEMTNNFIESSFWNFDSLFQPQQHPARDQ-----HDTFFLSDPAEFPQDYLERVKKVHSEGG-FGSQGYKWKIEEAQKNILRTHTTAVSARMLYKLAQQEKFPVKYFSIDRVFRNETLDATHLAEFHQIEGVVADYGLTLGDLMGILHQFFTKLGITKLRFKPAYNPYTEPHEGLKKWVEVGNSGVFRPEML------------------PTMIKYGINNIRELVGHKVNLQMVY... 1331
46 1.000e-90UniRef50_D3BCX3 Phenylalanyl-tRNA synthetase n=3 Tax=Eukaryota TaxID=2759 RepID=D3BCX3_POLPP  ali  16  190..SWKDETFK-FNHLALGEIPSSGFRHPLSKVKAEFKQIFIEMG--FEEMTANFVENSFWNFDALFQPQQHPAR-----DAHDTFFLKDPATSHDFTDDYLAKVHKVHQEGDGWRYDWKLEEAEKNILRTHTTAVSSRMLYKLAQTGFKPKKYFSIDRVFRNETLDATHLAEFHQVEGVIADVDISLSHLIGIFTEFFKRLGITDISFKPAYNPYTEPSMEKLGRIELGNSGLFRPEMLLPMGLPPNVAAWGLSLERPTMIKYELNSIRSIFGNDLNINSIKSN. 476
47 2.000e-90UniRef50_UPI000846D055 phenylalanine--tRNA ligase alpha subunit-like n=2 Tax=Eumetazoa TaxID=6072 RepID=UPI000846D055  ali  14  184.GEWEELPFKPYNFDALGAVPARGHLHPLLKMRSEFRQIFLEMG--FAEMTNNYVEPSFWNFDSLFQPQQHPAR-----DAHDTFYVK----------QST--------GSRGYGYNWQLIEAEKNLLRTHTTAVSARTLYQLATRPNGPAKFFTIDKVFRNEALDATHLAEFHQVEGVIANVDFTLGDLIGTLQELFRKLGIEELQFKPTYSPYTEPSMELAEWLEVGNSGIFRPELVLPMGLPVNVLAWGLSLERPTMIKYGINNISDLVGPRVDLKMVE... 451
48 6.000e-90UniRef50_W9Y160 Phenylalanyl-tRNA synthetase alpha chain n=47 Tax=Eukaryota TaxID=2759 RepID=W9Y160_9EURO  ali  15  196.GAWKTAQLKPYNFKAKGTPAAAGALHPLNKVRQEFREIFFEMG--FEEMTNRYVETGFWNFDALFVPQQHPAR-----DLQDTFYISDPAKADPPYKQYWDDVRAVHGKFGSIGYRWSADESLRLVLRTHTTAISTYML-HKLAQNPRPARYFSIDRVFRNESVDQTHLAEFHQVEGVIADWGLTLGGLIGFMEVFFGKMGIKNLRFKPAYNPYTEPHEGLKKWVEIGNSGMFRPEMLEPMGLDMRIYGWGLSLERPTMIKYGVNNIRELLGHKVDLNFIKQN. 512
49 1.000e-89UniRef50_A0A226EPU4 Phenylalanine--tRNA ligase alpha subunit A n=2 Tax=Bilateria TaxID=33213 RepID=A0A226EPU4_FOLCA  ali  16  210.....KKNFKPYNFNAMGTTLQGGHLHPLLKVKAEFLSILTELG--FSEMTNRFVESSFWNFDALFVPQKHPAR-----DVQDTFFLARPENCRLPDEEYVARVEKVHGDYGSDGYQWRREETQRNIMRTHTTAITGRVLYDLAQQKPKPVKKFSIDRVFRNETLDATHLAEFHQVEGFVADRGLSLGHLIGIMKEFFGRLGIDQLRFKPAYNPYTEPHKGFKKWVEVGNSGLFRPEMLRPMGLPEDVIAWGLSLERPTMIRYGINNIRSLVGHKVDLRLVYSN. 497
50 2.000e-89UniRef50_A0A1Q9MYP7 Phenylalanyl-tRNA synthetase alpha subunit (Fragment) n=1 Tax=Candidatus Lokiarchaeota archaeon CR_4 TaxID=1849166 RepID=A0A1Q9MY  ali  18  227.GEWKNVTLKSFNVAARGPALFGGKLHPVTLLINKVREVFLSMG--FTEIRGPMVESAFYNFDALFQPQDHPAR-----EMHDTFYLDNPKTAKLPPEEYIRAVHETGGSTGSIGWKWSESIARQMILRTHTTATTIRRLSEGRNKEPLPARVFSIDRVFRNEKVDFKHLAEFTQIEGIVIDKGVTLSDLRGLLTSFFTRMGFSKVLTRPGYYPYTEPSEDHQRWFEMAGSGIFRPEVTEPWGIKDPVLAWGMGFERLAMLYFERKDIRDLYRNLSWLREVPV.. 517
51 2.000e-89UniRef50_A0A058Z2M9 Phenylalanyl-tRNA synthetase alpha chain n=2 Tax=Opisthokonta TaxID=33154 RepID=A0A058Z2M9_9EUKA  ali  16  271............NIDYVRGRVPTGHLHPLLKVREEYRKIFLNMG--FTEMTNNFVESSFWNFDTLFQPQHHPAR-----DAHDTFFVRSPAKAALPTSAYVEAVKKVHGDFGSIGHRWKEDEAQKNILRTHTTAASARALKELADQGERPVKYFSIDRVFRNETLDHTHLAEFHQIEGLIADRNLSLAHLLSTLKEFFRALGMKDLRFKPAYNPYTEPHPGLKKWIEVGNSGVFRPEMLRPMGLDVSVIAWGLSLERPTMILYGIDNIRDLCGHTIDLKLVKTN. 555
52 3.000e-89UniRef50_A0A0N0BHB1 Phenylalanine--tRNA ligase alpha subunit B n=3 Tax=Aculeata TaxID=7434 RepID=A0A0N0BHB1_9HYME  ali  13  193.GAWKDKKFKPYNFDALGATLEVGHLHPLLKVRSEFRKIFLEMG--FTEMTNNFVESSFWNFDALFQPQQHPAR-----DAHDTFFIAEPSRSTNFPMEYMEKVKKVHGGYGSLGYRWKIEEAQKNVLRTHTTAVSARMLYNLMQQGEKPVRYFSIDRVFRNETLDATHLAEFHQIEGVVADYN--------LTMEIFCY------------------HEGLKKWIEIGNSGMFRPEMLLPMGLPENVIAWGLSLERPTMIKYGINNIRDLVGPKVDLEMVYNN. 450
53 4.000e-89UniRef50_A0A0L1KR47 Phenylalanyl-tRNA synthetase alpha chain n=2 Tax=Kinetoplastida TaxID=5653 RepID=A0A0L1KR47_9EUGL  ali  15  235..SWVNAEFKPYNLQAEGARPLAGSLHPLMRVREEYREIFLELG--FSEMTSNYIESSFWNFDALFVPQNHPAR-----DMQDTFFISDPGHSKPDAADYVRNVHENGGGCGSKGYDWSIEESRKNVLRTHTTAVTARILYQLAQKSNSPSKFFSIDRVFRNEEMDKTHLCEFHQIEGVVVDRNLSLVQMMTILKQFFHRIGIEKIRFKPAYNPYTEPHEGHKSWMEVGNSGMFRPEMLVPMGFPKNAIAWGLSLERPTMIKYGLKSIHDLFGHKIDISFCK... 523
54 6.000e-89UniRef50_A0A0V0QTV2 Uncharacterized protein n=2 Tax=Eukaryota TaxID=2759 RepID=A0A0V0QTV2_PSEPJ  ali  16  200...WSELNFKPYNWNALGKEVDSGNLHPLQKVRKQFKEVLSEMG--FEEMTNNYVESCFWNFDTLFVPQKHPAR-----DLQDTFYISDPKVAKIDEREYLENVKKVHGDYGSIGYDFQEEESQKLVFRTHTTAASARMLYNIAQEAKKPRKIYSIDRVFRNEHLDATHLAEFHQIEGIIADKEVGLGHLMGVIEKFFNKIGIQKLMFKPTYNPYTEPHPILKKMVEIGNSGVFRPEMLRPMGIDVQVLGWGLGLERPTMIQYGYSNIRELFGDKVDLKMVKKN. 492
55 6.000e-89UniRef50_Q8SRG9 Probable phenylalanine--tRNA ligase alpha subunit n=13 Tax=Opisthokonta TaxID=33154 RepID=SYFA_ENCCU  ali  17  180.GSYRDLSFKHYNFNAEGNAPQCGSIHPLMKIREDFRRIFIELG--FSEMTNQYVESSFWNFDALFQPQNHPSR-----DAHDTFFLLNP---ELSTDFPSDYLKEVGETHRGGKYNWDIKEAQKNILRTHTTSVSARNLYRLAKKEFKPAKLFSIDKVFRNETVDATHLAEFHQVEGLVVGKGLNLTHLMGILREFFNRLGMGDIRFKPAFNPYTEPSMEMDRWIEVGNSGVFRPEMLRPMGFDVSVVAWGLSLERPAMIKYGLKNIRELVGHKVDIEFSR... 467
56 8.000e-89UniRef50_A0A0R0M5F8 Phenylalanine-tRNA synthetase, alpha subunit n=1 Tax=Pseudoloma neurophilia TaxID=146866 RepID=A0A0R0M5F8_9MICR  ali  16  187.GEYKNVDFKPYNFKTALRK-ESGSLHPLRKVQTEIRNIFLELG--FTEMTNNYVESSFWNFDALFQPQNHSAR-----EMHDTFFISDPSTYENPI--DPDLLKAVKEQHEKYLYDWSEKEARKNILRTHTTASSAKMLYKIAEDAKKSCKLFSIDRVFRNESVDATHLAEFHQIEGLVLGKNLSIGHLMGVLNDFFIKLGLKDVSFKPTYNPYTEPHEGLGKLIEVGNSGIFRPEMLEPLGISGEVIAWGLSLERPAMIKYGLNNIRELLGHKSDLKFIK... 474
57 9.000e-89UniRef50_M1V7X6 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Cyanidioschyzon merolae (strain 10D) TaxID=280699 RepID=M1V7X6_CYAM1  ali  16  230..SWRNATFKEFNFEAAGAPVDGGRLHPLLKVREEFRLIFLEMG--FTEMSNQYVESSFWNFDALFQPQQHPAR-----DAHDTFFLNEPALCKSPATE--AYVERVRGVHDQGGYGWDHTEAMRNVLRTHTTAISARMLYRMARELNFARRMFSIDRVFRNETLDATHLCEFHQVEGWVAGPDLSLADLKGIISQFFRRIGMHRLRFKPTYNPYTEPHEALGRWVEIGNSGIFRPEMLQPMGLPPNVIAWGLSLERPTMILYGLSNIRDLFGHRVSLQTIRDN. 533
58 1.000e-88UniRef50_A0A2A2HEQ1 Phenylalanine--tRNA ligase alpha subunit n=2 Tax=Methanosphaera cuniculi TaxID=1077256 RepID=A0A2A2HEQ1_9EURY  ali  17  230.GEWKNLHYRGYDINASAPKNYPGKIHPLQQTIEEIRSIFIDMG--FDEAKGTILESAFWNFDMLFQPQDHAAR-----EMQDTFYVKNPPKADLPDSELVKMTHEHGGGSTGWQYNWNEDVARQIVLRTHTTGLSVR----HLNENEPPLKMFSIGRVFRRETIDYKHLPEFHQVEGIVAGEDMSFKNLLGILKEFYRKLGFK-VRFRPAYFPYTYLVPEKRKWMELGGSGMFRPEVLEPLGIKTQVAAFGLGIERLAMIRYGIEDIRMLYQSDI......... 504
59 1.000e-88UniRef50_A0A1I3B690 Phenylalanine--tRNA ligase n=2 Tax=Planctomicrobium piriforme TaxID=1576369 RepID=A0A1I3B690_9PLAN  ali  14  223.GAWREITLRAYDVTLPAETVHPAKIHPLRKMIEQTRRAYLEMG--FTEVVSPIVESSFWNFDALFQPQDHPAR-----DMQDTFYMDEPSMTDLPLVDRVRRAHEDGGDTGSWGYKWSPERARQVVLRTHTTASTIRALARHPN---PPLKAFCVGWVCRNETMSYKHLPVFHQVDGIVIDEHASLATLLGTLETFYKKMGFKQVKFKPAFYPYTEPLESRKKWIEMGGSGIFRPEVTEPLGCKHPVLAWGLGMERLAMIRYGLSDIRELYQGRI......... 500
60 1.000e-88UniRef50_F4PXN0 Phenylalanyl-tRNA synthetase n=1 Tax=Cavenderia fasciculata (strain SH3) TaxID=1054147 RepID=F4PXN0_CAVFA  ali  16  600..SWKDETFK-FNTLSMGTKPDSGFRHPLNKVKAEFKQIFIEMG--FEEMTSNYVENSFWNFDALFQPQQHPAR-----DAHDTFFLSDPKTSHDFTDEHLEKVRKVHGGYGSWGYDWKLEEAEKNILRTHTTAVSSRMLYKLANQPGGPKKYFSVDRVFRNESLDATHLAEFHQVEGLVAGYDISLSNLIGIFSEFFKRLGIEDIQFKPAFNPYTEPSMEKLGRMELGNSGLFRPEMLLPLGLPEQVAAWGLSLERPTMIKYGLNTIRDIFGNNLNIEFIQSN. 888
61 2.000e-88UniRef50_A0A0P9G5L9 Phenylalanine--tRNA ligase alpha subunit n=4 Tax=Candidatus Bathyarchaeota TaxID=928852 RepID=A0A0P9G5L9_9ARCH  ali  18  214.GRWRRVKLRRFDVTAPGPVVYPRKVHPAQQIIQRVREIFLEMG--FTEIRGPIVETAFWNFDALFQPQDHPAR-----EMMDTFYLAHPTKGKLPIVNAVAKTHENGWITGSRGYTWSLDEAKRLILRTHTTAVTIRYLAEHK---EPPVKVFSVDRVYRNEKVDYKRLAEFHQIEGIVMDKKVTLRDLMGTLKEFYLKLGLKKVQFWPSYFPYTEPVPELKTWVELCGMGIFRPEVLAPFGIKYPVLAWGGGLERLIMLKLGVEDIRHLYKN--DLGWIR... 494
62 2.000e-88UniRef50_Q4WI02 Phenylalanyl-tRNA synthetase beta chain cytoplasmic n=11 Tax=Aspergillus TaxID=5052 RepID=Q4WI02_ASPFU  ali  17  195.GSWKTVTLKPYNFKAKGAPTPAGAFHPLNKVRQEFRNIFFEMG--FEEMTNRFVETGFWNFDALYVPQQHPAR-----DLQDTFYISDPATADPPYKEYWENVRQVHGKYGSIGYRWNADEALRLVLRTHTTSVST-YVLHKLAANPRPARYFSIDRVFRNEAVDATHLAEFHQIEGVIADFGLTLGGLIGFMEVFFAKMGIHQLRFKPAYNPYTEPSMELGKWVEIGNSGMFRPEMLEPMGIDMRVYGWGLSLERPTMIKYGVSNIRELLGHKVDLNFIETN. 510
63 3.000e-88UniRef50_A0A075ANU6 Phenylalanyl-tRNA synthetase, class IIc, alpha subunit domain-containing protein n=1 Tax=Rozella allomycis CSF55 TaxID=988480 Rep  ali  16  573........FKEYNLNAMGIPPKCGHLHPLMKVREEFRNIFFVLG--FEEMTNNYVESSFWNFDALFQPQQHPAR-----DAHDTFFLKSPKTSNKFPLDYLERVKKQHGGNGSIGYRWKIEEAQKNLLRTHTTAVSARMLYKLAQQKEKPVKYFSIDKVFRNESVDATHLAEFHQVEGLIADYDLTLGHLIGVLDAFFKMLGLTDLEFKPAYNPYTEPHPGLKKRIEVGNSGIFRPEMILPMGFDVTVIAWGLSLERPAMIKYGYNNIRDLVGHKVPIESIE... 854
64 5.000e-88UniRef50_B6HC26 Pc18g05340 protein n=146 Tax=Fungi TaxID=4751 RepID=B6HC26_PENRW  ali  17  195.GSWKTAHLKPYNFNAKGAPTPSGTLHPLNKVRQEFRNIFFDMG--FEEMTNRFVETGFWNFDALFVPQQHPAR-----DLQDTFYISDPAVADPPPLDYKKYWDNVHGKFGSIGYRWSADESLRLVLRTHTTSISTYML-HKLAANPRPARFFSIDRVFRNESVDATHLAEFHQVEGVIADFGLTLGGLIGFMEVFFAKMGIHKLRFKPAYNPYTEPHDGLGKWVEIGNSGMFRPEMLESMGLDLRVYGWGLSLERPTMIKYGVSNIRELLGHKVDLHFIETN. 504
65 5.000e-88UniRef50_V6M0E6 Phenylalanyl-tRNA synthetase alpha chain n=3 Tax=Eukaryota TaxID=2759 RepID=V6M0E6_9EUKA  ali  15  191.......RFKPLNFNARGKPVSVGALHPLLKFRTQFIAILTGMG--FQQMKTNYLESSFWNFDALFQPQQHPAR-----DMHDTFFVAGKRNVDKSYFEAVKAAHEAG-----YKYIFDDKETCKNLLRTHTTAVSARRLYELAQDYKKPIKSFSIDRVFRNETLDATHLCEFHQVEGFICDVNVSLRDLMGTIKAFFKELGMENVRFKPTYNPYTEPHPGLNKWIEVGNSGMFRPEMLRTMGFGPEVIAWGLSLERPTMIKYGINNIRDLIGPACDLDMI.... 472
66 5.000e-88UniRef50_A0A2E9QXX1 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Deltaproteobacteria bacterium TaxID=2026735 RepID=A0A2E9QXX1_9DELT  ali  17  255.GEWKNVTFREYDIQLDTAPVYAGKAHPLRRVLEETRRAFLNMG--FTEIRGPYVESAFWDFDALFQPQDHPAR-----EMQDTFYCANPGTFSLPLVETIRQIHEDGGETTGWRYDWDEEKAKQVVLRTHTTAVT---VEACHKNPNPPQKVFCVGRVFRRETIDYKHLPEFHQVDGIIVDEHASFAHLLGTLTEFYRQMGFEEIKFRPAFFPYTEPSVEVKEWFELGGAGVFRPEVIRPAGVNVPVLAWGLGLERLAMIRYRVEDIRHLYLSQLD........ 532
67 5.000e-88UniRef50_A0A0V1AYJ8 Phenylalanine--tRNA ligase alpha subunit B n=21 Tax=Trichinella TaxID=6333 RepID=A0A0V1AYJ8_TRISP  ali  15  200...WKEKKFKPYNFNAFGVVPVRGYLHPLMKVRTEFRQIFLEMG--FTEMTQRYVESSFWNFDALFQPQQHPARDE-----QDTFFISKPMCTKNLPSEYVKRVEKVHGDYGSYGYEWKIEEAEKNVLRTHTTASSIRMLYEIAKKPFKPVRYFSIDRVFRNESLDATHLAEFHQVEGLIAGENLSLGHLMGILQEFYKRLGIEKLRFKPAYNPYTEPSMELKKWVEIGNSGMFRPEVLLPLGLNVTVIAWGLSLER............................ 460
68 6.000e-88UniRef50_A0A2D6JBP6 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Euryarchaeota archaeon TaxID=2026739 RepID=A0A2D6JBP6_9EURY  ali  15  203...WKGKNIRGYDINAKTQPYFGGALHPHTLATEKIRRTFLELG--FEEMRGNYVESTFWNFDALFQPQDHPSR-----DLADTFYLKKPEKSKLPDKKYVDAVKRAHETGTQGSSGWQYDWKRSLVLRTHTTAVSARWLTK----LKPPAKVFCIGRVFRNETVDYKHLPEFTQIDGIVIDENASFRDLLGYLKEFFTRLGFDKIRFRPAYFPYTEMSTEKKEWIELGGSGLFRPEVTEPLGINVPVLAWGLSIERPLMMNLGLKDIRSFFYKN-DLKWLR... 480
69 7.000e-88UniRef50_C5LM70 Phenylalanyl-tRNA synthetase alpha chain, putative n=1 Tax=Perkinsus marinus (strain ATCC 50983 / TXsc) TaxID=423536 RepID=C5LM70_PER  ali  16  223...........YNLKALARDLGGGHLHPLLKVKTEIRNILLLMG--FEEMTNRYLESSFWNFDALFQPQQHPAR-----DAHDTFFITSPARIPEDYMNAVKNMHEVGGGSIGWRYDWSEKESRKNILRTHTTAVSTRVLYEMGRDVFKPKKCFSIDRVFRNETLDATHLAEFHQVEGFVADRNLTLGNLIGVIREFFRRMGLTDLRFKPAYNPYTEPHPMLDKWVEIGNSGIFRPEMVRPMGIDVSVIAWGLSVERPTMIQYGIGNIRELFGHKMDVTSLKKN. 508
70 1.000e-87UniRef50_A0A0K0DL13 Uncharacterized protein n=3 Tax=Eukaryota TaxID=2759 RepID=A0A0K0DL13_ANGCA  ali  16  162............................ITQVRSEFREIFFSMG--FSEMTNRYVESSFWNFDALFQPQQHPAR-----DAHDTFFISDPAEFPKDYLERVKAVHSKGGGSIGYNYDWKIEEAQKNVLRTHTTAISARQLFKLAQEGFRPTKMFSIDRVFRNETLDATHLAEFYQVEGVIAERNLSLSHLIGVFTEFFKKLGIEDLRFKPTYNPYTEPSMELKKWVEIGNSGMFRPEMLLPMGLDVNVAGYGLSLERPTMIRYGINNIRDLFGPKVDLQMIY... 422
71 2.000e-87UniRef50_J4GU14 Uncharacterized protein n=50 Tax=Agaricomycetes TaxID=155619 RepID=J4GU14_9APHY  ali  17  207.GSWKTATYKKYNFEAEGLQSNGGALHPLLKVREEIRNIFLEMG--FAEMTSCFVESGFWCFDALFVPQQHPAR-----EVQDTFYLSDPATSLPP---PAAYYSRVSKVHEHGGYGWSDAESRKLLLRTHTTASSAAMLWKLAARCRGPAKLFSIDRVFRNETMDATHLAEFHQVEGVVADRGLTLADLIGFMRVFFKKMGIENLRFKPAYNPYTEPHPQLRKWVEVGNSGMFRPEMLEPMGFDVHVHGWGISLERPTMIRYGINNIRTLVGHKVAIEAVE... 523
72 2.000e-87UniRef50_K7EPH2 Phenylalanine--tRNA ligase alpha subunit (Fragment) n=5 Tax=Eukaryota TaxID=2759 RepID=K7EPH2_HUMAN  ali  17  116.GSWRDRPFKPYNFLAHGVLPDSGHLHPLLKVRSQFRQIFLEMG--FTEMTDNFIESSFWNFDALFQPQQHPARDQ-----HDTFFLRDPAEALQLPMDYVQRVKRTHGGYGSQGYKWKLDEARKNLLRTHTTSASARALYRLAQKKPFPVKYFSIDRVFRNETLDATHLAEFHQIEGVVADHGLTLGHLMGVLREFFTKLGITQLRFKPAYNPYTEPSMELKKWVEVGNSGVFRPEMLLPMGLPENVIAWGLSLE............................. 378
73 2.000e-87UniRef50_A0A2N1JAN4 Oct1p n=1 Tax=Malassezia vespertilionis TaxID=2020962 RepID=A0A2N1JAN4_9BASI  ali  16  240.GSWKNADFKGYNFNAEGAVPTAGALHPLLKVRQEFRNIFFEMG--FTEMTNRFVDSSFWCFDSIFVPQQHPAR-----DVQDTFFVADPPAAELPE-EYLKRVVEVHGAFGSIGYRFDREVTEKLVLRTHTTAVSAAMLYAIANQPGGPAKLFSIDRVFRNESTDATHLAEFHQVEGVVADYSLTLGDLIGFMEVFFAKMGVNNLRFKPAYNPYTEPHEGLKKWVEIGNSGMFRPEMLRPMGIPENVLGWGLSLERPTMIRYGIKDIRHL.............. 518
74 3.000e-87UniRef50_A0A1V5X7R4 Phenylalanine--tRNA ligase n=1 Tax=Deltaproteobacteria bacterium ADurb.Bin207 TaxID=1852869 RepID=A0A1V5X7R4_9DELT  ali  15  225.GAWRDITLRPYDVTLPGKTVYPAKIHPLRKIMEQTRRAFLELG--FEEVVSPMVESAFWNFDALFQPQDHPAR-----DMQDTFYMLDPARIPLPPPEVVRRTHEHGGDTTGWGYKWSEREAERVVLRTHTTAATIRALAAHPN---PPYKAFCVGWTYRNETISFKHLPVFHQIEGIVIDEQASLATLLGTLTAFYQKMGFAKVRFKPAFYPYTEPSESRGKWIEMGGSGIFRPEVSEPFGCKHPVLAWGLGLERLAMLRLGFSDIRQLYQGSLD........ 502
75 5.000e-87UniRef50_Q6BFG1 Phenylalanyl-tRNA synthetase alpha subunit, putative n=3 Tax=Paramecium tetraurelia TaxID=5888 RepID=Q6BFG1_PARTE  ali  15  217.GEWKECEYKSINLNAEGEKISMGNLHPLLKVRKQFSQILIGLG--FEEMTNQFVESSFWNFDALFQPQKHPAR-----DAHDTFFCSDPEEVDTTLRDKVKSMHQTGGGSIGYQYEWSHEESRKNILRTHTTAVSSKMLYRIAQQYKFPKKYFSIDKVFRNETLDATHLAEFHQIEGVVIDKNASLGQLMGIIREFFRQIGINKLWFKPTYNPYTEPHPVLKKKVEIGNSGVFRPEMLAPLGFDVNVIAWGLGLERPTMIYYDIRDIRTMVGPEVKVETVRSN. 510
76 7.000e-87UniRef50_A0A1E4FVX4 Phenylalanine--tRNA ligase n=1 Tax=bacterium SCN 62-11 TaxID=1660156 RepID=A0A1E4FVX4_9BACT  ali  16  215.GEWRNVDFRPYDVSLASEAVYPGKEHPFVSIIAQTRKVFLELG--FEETVSPYVESSFWDFDALFQPQDHPAR-----DMQDTFYISKPAECKLPRQEWVDEVHRNGGQTGSWRYDWNDKLIKQPVLRTHTTASSIRALAENPN---PPRKVFCVGPVFRRETVDYKHLPVFHQVDGIIIDEKASFASLLGTLEAFYRKMGFKKFQFRPAFFPYTEPSERKEDWVEMGGAGVFRPEVTEPFGCKVPVLAWGLGLERLAMFRYELGSIGELYRARLN........ 492
77 8.000e-87UniRef50_A0A075FWD2 Phenylalanine--tRNA ligase alpha subunit n=14 Tax=Archaea TaxID=2157 RepID=A0A075FWD2_9ARCH  ali  17  222.GEWRNASLRPLNVESPAPTIYSGKKHPVRIFIDEVREIFVSLG--FQEVEGSIVQSSFWNFDALFTPQDHPAR-----EIQDTFYIENEKEVDEQILKNVESVHKDGANTGSWRYQWNIEQARRMVMRTHTTCVSVKNLADNK---PDEARVFSVGRVFRNEKVTFKNLVEFHQIEGIVVGKDVTLRDLMGLLTKFYKKLGFEKIKFWPSFFPYTEPHEGLGRWIELGGMGIFRPEVTRPLGVKNPVLAWGSGLERLVMLRYGIDDVRKLYENDLDLRGIPL.. 506
78 9.000e-87UniRef50_E6N4Y6 Phenylalanine--tRNA ligase alpha subunit n=6 Tax=Archaea TaxID=2157 RepID=E6N4Y6_9ARCH  ali  17  242.GRWRELRLSRYDVKAPTPPIFAAKRHPLTELIRMVRQAYVEMG--FEEIEGPIVELAFWNFDALFQPQDHPAR-----EMQDTFYLLEPRAGDPPAVEAVRKVHENGGDTGSWRYKWSLEEARRLLLRTHTTATTIRHLATVKQ---PPVKVFCVDRIFRNEKVDWKHLAEFHQIEGIVVERDASLRMLMGVLRDFYSRLGLREIRFKPSYFPYTEPSMEGGRWLELGGSGIFRPETTYPFGVKHPVLAWGLGLERLAMVIYGLEDIRTFHLNDLWLRSVS... 522
79 1.000e-86UniRef50_D7E861 Phenylalanine--tRNA ligase alpha subunit n=19 Tax=Methanomicrobia TaxID=224756 RepID=D7E861_METEZ  ali  17  230.GEWKKKNFRSYNIHTPPKPIYGAKIHPYQRLINQMRQIFIEMG--FTEIKGEIIQSSFWNFDALFQPQDHPAR-----DMQDTFHLESTSEIDEECKDNVCAMHEHGGDISSTGWRWDENIARRNVLRTHTTAVTIKYLADNP---EPPVKAFCIDRAYRRETIDPTHLPEFEQLEGVVMDKNMSFANLLGCLAEFYHRMGFENVRFRPGYFPYTEPSVEGMGWIELGGAGIFRKEVTDPLGIKHPVLAWGLGVSRVAMLKLGLRDLRELYQSDIN........ 503
80 2.000e-86UniRef50_A0A0F8DI86 Phenylalanine--tRNA ligase alpha subunit n=117 Tax=Dikarya TaxID=451864 RepID=A0A0F8DI86_CERFI  ali  15  200..SWDKATFKAYNFNALGADQGAGALHPLNKVRQEFRHIFFEMG--FQEMTNRYVESGFWNFDALFVPQQHPAR-----DLQDTFYISDPLVADPPRAEPIKAVHQDGKGSVGYQYPWAADEALRLVLRTHTTAVLRRLAAQKGPDRPPPARYFSIDRVFRNEAVDATHLAEFHQVEGVIADYNLSLGGLMEFMEIFFNKMGLKDLKFKAAYNPYTEPHEGLGKLVEIGNSGMFRPEMLESMGLDLRVYGWGLSLERPTMIKYGISNIRELLGHKVDLNFIEKN. 502
81 2.000e-86UniRef50_Q382C5 Phenylalanyl-tRNA synthetase alpha chain, putative n=31 Tax=Trypanosomatidae TaxID=5654 RepID=Q382C5_TRYB2  ali  15  199.GSWRTTEFKAYNLAAAGREVSCGQLHPLLKVRQEFREIFMEMG--FQEMTDHWVESSFWNFDSLFIPQNHPAR-----DMQDTFFISKPATSELKQQDVVENVRKMHEKNFK--YTWKESEARRNVLRTHTTSCSAFWLHHLARNSPRPGRYYSIDRVFRNEEMDRTHLCEFHQIEGCVIDRNISLANMMHTFELFFRRIGVERLRFKPVFNPYTEPSMELKRWIEVGNSGLFRPEMLVPLGFDEDVMAWGLSLERPTMIKYGLSSIHELFGHKVDLRFIRN.. 490
82 2.000e-86UniRef50_UPI000626BA27 phenylalanine--tRNA ligase alpha subunit isoform X2 n=2 Tax=Orussus abietinus TaxID=222816 RepID=UPI000626BA27  ali  15  153..............................KKRKLLHQIFLEMP------TNNFVESSFWNFDALFQPQQHPAR-----DAHDTFFVSEP---RISTKFPEEYLKRVKKVHSKGGYDWKIEEAQKNLLRTHTTAVSARMLYKLIQEGEKPVRYFSIDRVFRNETLDATHLAEFHQVEGVVADYNLTLGDLIGTLYEFFKKLGITQLDFKPAYNPYTEPHNGLNKWIEIGNSGMFRPEMLLPMGIPENVIAWGLSLERPTMIKYGINNIRDLVGPKVDLQMVHDN. 409
83 2.000e-86UniRef50_A0A1B0CKY7 Uncharacterized protein n=1 Tax=Lutzomyia longipalpis TaxID=7200 RepID=A0A1B0CKY7_LUTLO  ali  14  193...........YNFDALGATVERGHLHPLLKVRSEFRQIFLEMG--FSEMTNNYVESSFWNFDALFQPQQHPAR-----DAHDTFFLTHPANSSKFPMDYLERVKKVHGEYGSQGYDWKLEEAQKNILRTHTTAVSARMLYNTSA---------SIG-VFRNETLDATHLAEFHQVEGVIADVGLTLGDLIGTLYAFFSKLGITQLDFKPAYNPYTEPHPGLNKWIEIGNSGLFRPEMLLPMNLDVNVIAWGLSLERPTMVKYGINNIRDLVGPKVDLKMQEL.. 461
84 4.000e-86UniRef50_A0A1Q3DVF8 Phenylalanine-trna ligase n=2 Tax=Lentinula edodes TaxID=5353 RepID=A0A1Q3DVF8_LENED  ali  15  208.GTWKTSTFKKYNFEAEGIPPAGGALHPLLKVREEIRNIFLEMG--FAEMTSSFVESAFWCFDALFVPQQHPAR-----DLQDTFYISDPVKSLPPEPSYYKRVSTVHGGYGSTGYRWSHEESSKLLLRTHTTASSTFMLYKLAARCRGPAKLFSIDRVFRNETMDATHLAEFHQVEGVVADRGLTLADLIGFMRVFFKKMGIEKVRFKPAYNPYTEPHPMLNKWVEVGNSGMFRPEMLEPMGFDVRVHGWGLSLERPTMIRYGINNIRTLLGHKVSIE...... 522
85 5.000e-86UniRef50_A0A2A6D0F1 Fars-1 n=1 Tax=Pristionchus pacificus TaxID=54126 RepID=A0A2A6D0F1_PRIPA  ali  14  847.GSWKTTTFKKLNFEAMGVQPDSGHLHPLMKVRSEFRQIFFQMG--FSEMTNQYVESSFWNFDALFQPQQHPAR-----DAHDTFFISEPAKFPAEYLEKVKTVHSKGGGSDGYGYDWKEEEAQKNVMRTHTTAVSARQLYKLAQEGFKPTKMFSIDRVFRNETLDATHLAEFHQVEGVIADRNLSLSHVMGLFREFFRKCGIENLKFKPTYNPYTEPHDGLKKWVEIGNSGI------------------------PTMIRYGIDNIRDLFGSKVKLDMIYNN. 1110
86 6.000e-86UniRef50_Q57911 Phenylalanine--tRNA ligase alpha subunit n=24 Tax=Methanococcales TaxID=2182 RepID=SYFA_METJA  ali  18  203.GKWKKAYIRPYDVKVPTKPIYPAKVHPLTRIIREVKEILLAMG--FKEVKSPIVETEFWNFDMLFEPQDHPAR-----EMQDTFFLKYPNEGDIP----EDLLSKVKEVHERWKYKFDENVSRRLILRTHTTASSIRYLASLSDEEKKPHKVFCIDRVFRNEAIDYKHLPEFYQCEGIIMDDNVNFNNLIGVLKEFLNRLGFEKVRFRPAYFPFTEPSLEAKGWLEILGAGIFRPEVLEPIGIEKPVLAWGIGFSRLAMLRYGLTDIRDLHKNDLD........ 475
87 6.000e-86UniRef50_A0A060HBR9 Phenylalanine--tRNA ligase alpha chain n=3 Tax=TACK group TaxID=1783275 RepID=A0A060HBR9_9ARCH  ali  17  218.GKWKGVEFSALDVEAPAPAVYPGRSHPLVDIIEEVKEIFVGLG--FSEIDGPMVQSGFWNFDALFTPQDHPAR-----EMQDTFYISGERQA---IPAGKEQIAKVSGVHKSGWGGWKPEEAERVVLRTHTTPVT---LQHLAKKKPEVARFFSVGRVFRNEKVSYKHLVEFHQVEGVATAPKASLRDLMGLQKEFYARMGIKKVKFWPTFFPYTEPSDRLQKWVELFGMGIFRPEVTRPLGIKNPVLAWGGGLERIAMLRFGLDDVRDLYTNRVWLRSV.... 492
88 5.000e-85UniRef50_B0ERP0 Phenylalanyl-tRNA synthetase alpha chain B, putative n=11 Tax=Eukaryota TaxID=2759 RepID=B0ERP0_ENTDS  ali  17  189.GSWKDANWKEYNFNALGVYPKGGSRHQLSKVRMNFKNIFLEMG--FEEMTDMYVESSFWNFDSLYQPQQHPAR-----DAQDTFFLNEPATTSSADMNPVARVKKVHGDFGSIGWRWKVEEAQKTILRTHTTAVSSRTLAKLAADAFKPIKCFSIDRVFRNETVDQTHLAEFHQIEGFIADRNIGLPQLIAVIKEFFTKMGLPDVRFKPAYNPYTEPHPGLGKFVEVGNSGVFRPEMLRTMGVDITVIAWGFGLERPTMISYGIKSIRSIFGPKTDLDFIKN.. 485
89 5.000e-85UniRef50_A0A287UTW4 Uncharacterized protein n=9 Tax=Eukaryota TaxID=2759 RepID=A0A287UTW4_HORVV  ali  15  52.GDWKDLEFKDYNYGAQGQPIAIGYSQPLLEVLEAIQNIFVEMG--FSEMTNMFVESSFWNFDALFQPQQHPARDS-----HDTFFLKAPAT--TPQL-PDDYLEKVKQVHKGYGYDWKRDEAEKNLLRTHTTAVSTRMLYKVVQNSFAPKRYYSIDRVFRNEAVDRTHLAEFHQIEGLICDYGLTLGDLIGVLEDFFSRLGMSKLRFKPAYNPYTEPHEGLKKWMEIGNSGMFRPEVLLPMGLPENVIAWGLSLERPTMILNGINNIRKLFGPKVNFKVIKNR. 341
90 7.000e-85UniRef50_J8ZYS9 Phenylalanine-tRNA ligase, alpha subunit n=1 Tax=Edhazardia aedis (strain USNM 41457) TaxID=1003232 RepID=J8ZYS9_EDHAE  ali  17  188.......KFKKYNFDTVGNLPEKGNLHPLMKVREEFRSIFLTLG--FTEMTNKYIESSFWNFDALFQPQNHPSRDS-----HDTFFIENDLPIDADYINKVKNIHEKGG-HGSLGYTWNIEEARKGILRTHTTSCSARHLYNEKLKKNKVYKLFSIDKVFRNETVDATHLAEFHQIEGVIIGENLTLGQLMGVIDEFYQRLGLRQIKFKPAFNPYTEPHDGMKKWIEIGNSGIFRPEMLKPMGFDITVFGWGLSLERPTMIKYNIKNIRDLVGHKVKLNFIK... 487
91 9.000e-85UniRef50_A0A1L1RLP1 Phenylalanine--tRNA ligase alpha subunit n=6 Tax=Euteleostomi TaxID=117571 RepID=A0A1L1RLP1_CHICK  ali  17  3..................................................TDNFVESSFWNFDALFQPQQHPARDQ-----HDTFFLQDPAEAELPA-NYMARVKKVHGGYGSQGYKWKVEEARKNLLRTHTTSASARALYHLARQGKFPVKYFSIDRVFRNESLDATHLAEFHQVEGVVADRGLTLGHLMGTLQQFFTKLGISKLRFKPAYNPYTEPSMELKKWVEVGNSGVFRPELLLPMGLSVSVIAWGLSLERPTMIKYGINNIRELVGHRVNLQMIYDN. 245
92 9.000e-85UniRef50_D8PAB6 Phenylalanine--tRNA ligase alpha subunit n=38 Tax=Bacteria TaxID=2 RepID=D8PAB6_9BACT  ali  15  228.GAWRTKRFRKYTISLRAPRIAAGKRHPYREFLDLVKLKLVSMG--FQEMRGTLVETEFWNMDALFMPQFHPAR-----DIHDVYFVKNPTHARTPYLTQVTQVHETGAGSTGWGYTFDAERAKRLVLRSQGTAVSARTLASGASV---PGKYFSIARCFRYDQVDATHATDFFQVEGIVLGADINFRTLLGLLNLFAREVAAKEVKFLPAYFPFTEPSVEMHGWMELGGAGLFRPEVTTPLGVSVPVIAWGLGLDRMAMVALGIHDIRDLFS--ADLEFIRT.. 509
93 1.000e-84UniRef50_Q8TUA2 Phenylalanine--tRNA ligase alpha subunit n=75 Tax=root TaxID=1 RepID=SYFA_METAC  ali  17  209.GAWKGKKFRPYRLDIAPNPLYGVKIHPYRRLIEQMRQIFLEMG--FTEIKGGIIQSSFWNFDALFQPQDHPAR-----DMQDTFHLGSICQLPAEYSDKVAAMHESGGDIDSCGWGWDRELARRNVLRTHTTSVTIKYLADNP---EPPVKAFCIDRAYRRETIDPTHTPEFEQLEGVVMDKDMSFADLLGLLAEFYHRMGFEEVRFRPGYFPYTEPSVEGLGWVELGGAGVFRKEVTEPFGIKEPVLAWGLGVSRLAMLKLGLKDLRLLYQSDID........ 482
94 1.000e-84UniRef50_K0IH98 Phenylalanine--tRNA ligase alpha chain n=3 Tax=Thaumarchaeota TaxID=651137 RepID=K0IH98_NITGG  ali  15  214.GRWKQTKFSALDVEAPAPAVYPGRRHPLIDIIEEVKEIFVGLG--FSEIDGPMVQSGFWNFDALFTPQDHPAR-----EMQDTFYISGQRQHIPASDEQKKRIAKVHE--KGWGSKWDIKEAERVVLRTHTTPVTLRHLATIKPEVG---RYFSVGRVFRNEKVSYKHLVEFHQVEGVATAPRASLRDLMGLQKEFYAKMGIKKVKFWPTFFPYTEPSERLEKWVELFGMGIFRPEVTEPLGIKNPVLAWGGGLERIAMLRFGLDDVRELYGNRLWLRSV.... 489
95 2.000e-84UniRef50_A0A1D2W6I2 Phenylalanine--tRNA ligase alpha subunit n=3 Tax=Methanobacteriaceae TaxID=2159 RepID=A0A1D2W6I2_9EURY  ali  18  224.GSWKNLKFRGYDVHAEYPDFFPGKMHPLQRTIEDIRQIFLKMG--FTESKGSILESAFWNFDCLFQPQDHAAR-----EMQDTFYIKEPRTVNLPLVENVRRAHENGGATGSWGYSWDVDVAKQSVLRTHTTCLSTRYLAEH----EPPIKMFSVGRVFRRETITYKHLPEFHQVEGIVAAEDLTFKNLLGYLKEFYRKLGFKA-RFRPAYFPYTYLLPDKKTWIELGGSGMFRPEVLEPLGVETPVAAFGIGIERLAMLRLGIKDIRMLYKSDI......... 498
96 3.000e-84UniRef50_L2GWY9 Phenylalanine-tRNA ligase, alpha subunit n=1 Tax=Vavraia culicis (isolate floridensis) TaxID=948595 RepID=L2GWY9_VAVCU  ali  15  215....KGLEFKEYNFNTKI-RCESGNLHPLMKVKAEVKKIFLELG--FSEMTSRYVESSFWNFDALFQPQNHPAR-----DMHDTFFLANPEKTRLTPTSYSRRVKDVHEESYRC--KWSLEESLKNVLRTHTTGCSARVLYEIGQNKENPIKLFSIDRVFRNESVDSTHLAEFHQIEGLMLGKNLSIGHLMGTLQAFYEKLNLKNIKFKPAFNPYTEPHEQMNKWIEIGNSGMFRPEVLEPMGIKDDVIGWGLSLERPAMIKYSLSNIRDLLGPKVDLEFIK... 494
97 3.000e-84UniRef50_A0A1B8DJE2 Carbamoyl-phosphate synthase, large subunit n=11 Tax=leotiomyceta TaxID=716546 RepID=A0A1B8DJE2_9PEZI  ali  15  203.GAWKTAAFKPYNFKALGADQHAGALHPLNKVRTEFRQIFFEMG--FEEMTDKFVETGFWNFDALFVPQQHPAR-----DLQDTFYISDPKQGD--------EAPRGDGKYGSIGYRWSADETLKLVLRTHTTSISTHMLYKLAQTRPPPARYFSIDRVFRNETVDATHLAEFHQVEGVIADYDLTLGGLMEFMTIFFNKMGITDLRFKPAYNPYTEPHKGLNKLVEIGNSGMFRPEMLESMGLDMRVYGWGLSLERPTMIRTKCSNIRELLGHKVDLGFIQ... 485
98 3.000e-84UniRef50_A0A2D5YJR1 Phenylalanine--tRNA ligase alpha subunit n=25 Tax=Euryarchaeota TaxID=28890 RepID=A0A2D5YJR1_9EURY  ali  18  228.GTWSKGRFQRYSLETQAESAPQATLHPLTRFTEEIRGIFLQMG--FTEIEGDYVESAFWNMDALFIPQDHPAR-----ELQDTLYLDDPKSFDEAAVEAVKAVHETGGDTGSWQYDWSREVAQQALLRTHTTVNTIRYLSEH---SEPPVRVFAVGRVFRREAVDATHMPEFTQVEGIIMEEEASFGMLIGVLKEFYRRMGFPDVRVRPAYFPYTEPSMEIEVWLELGGSGIFRPEVTAPFGIDTPVLAWGLGLERLAMLRLGLKDIRMLYQSDLWLKTAR... 509
99 3.000e-84UniRef50_A0A1J4JAF8 Phenylalanyl-tRNA synthetase, alpha subunit family protein n=1 Tax=Tritrichomonas foetus TaxID=1144522 RepID=A0A1J4JAF8_9EUKA  ali  15  222.GEWKDVDFAPLNFNALGSKISCGHEHPLLKVRYEFRQIFLQMG--FEEMTSKWVESSFWNFDSLFQGQQHPCR-----DMHDTFFLKTP-EYGNPIFQRVKTTHEKGGGSIGLRYEFDDKIPYTNILRTHTTAVSSRMIADHYKATGRPRKFFSIDRVYRNETLDATHLAEFSQVEGFVIDKDLSLADLMSYIFEFFSRIGLNEIEFKPAYNPYTEPHEGLGKWIEVGNSGMFRPEMLNPMGLPENVVAWGFSLERPTMIDYKIDEIRKLEGPNVSLDLIEN.. 516
100 4.000e-84UniRef50_A0A2P4Z2P1 Phenylalanine--tRNA ligase alpha subunit n=4 Tax=Cryptosporidium TaxID=5806 RepID=A0A2P4Z2P1_9CRYT  ali  14  211..SWENSEFKPYNFNAKGKRLPRGNIHPLTRTSRKFKRILSQMG--FEEMTNRWVESSFWNFDALFQPQKHPARDS-----HDTFFLETPMELSNDHIDKVKKVHEVGGGSIGLSYNWSIEEASKNLLRTHTTAVSVRMLYENGLSFDNFQRYFSIDRVFRNESIDATHLAEFHQVEGLIVDKNLTLADLIGTLKTFYEKIGISDLKFKPAFNPYTEPSMELKKWIEVGNSGLFRPEMLRPLGFDIVVIAWGLSLERPTMISYNIPNIRDLFSFKAKI....... 507
101 4.000e-84UniRef50_A0A2H9KZ25 Phenylalanine--tRNA ligase subunit alpha n=1 Tax=Candidatus Micrarchaeota archaeon CG10_big_fil_rev_8_21_14_0_10_45_29 TaxID=1974  ali  16  208.GSWKGKTFRKYGIGGDFPSTPAARRHPISRLREKICQIFSQMG--FEQMEGPLIESAFWNFDALFQPQDHPAR-----DLADTFYIDAPSPLPNP-----ALVKKVAEAHGGWGYEWESSAAQESVLRTHTTAVSARTLHDLQKD-PAPKKFFSIGKVFRNEATDYKHLAEFFQVEGIISWEGAQFPHLLGTLKAFYQKLGFEKIRFRPSFFPYTEPHPARKEWIELGGAGILRPEVTLPLCSKYPVLAWGLSLERPLMLSGKISDIRTLYRNDL......... 477
102 5.000e-84UniRef50_A0A257AJW1 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Candidatus Bathyarchaeota archaeon ex4484_205 TaxID=2012510 RepID=A0A257AJW1_9AR  ali  20  220.GVWKKIGFKKYKVEASGPKIYPGKRHPLREIIDKIRRIFLEMG--FKEARGPIVESSFWCFDALFQPQDHPAR-----ELADTFYLKG-LESKLPERDLVEKVKKTHEGSRGWRYEWKEEIAKKSVLRTHTTAVSARYL----QKVSPPSKVFSIGKVYRNEKTDWRRLHEFFQVEGIVVDEEATFRDLLGYLSTFFRKLGFEKIRFRPAYFPYTEIVEERDTWLELGGAGIFRPEVTEPFGIDCPVLAWGLGLERPIMLILGMRDIRDFYKN--DLNWIR... 498
103 5.000e-84UniRef50_A0A1W2THC7 Putative phenylalanyl-tRNA synthetase alpha chain n=27 Tax=Fungi TaxID=4751 RepID=A0A1W2THC7_ROSNE  ali  16  205.GRWQSVTFKKYNFNALGARQSHGAFHPLMKMREEFRQIFLQLG--FEEMSNQFVESGFWNFDTLFVPQQHPAR-----DMQDTFYLEDPVKALRPYFDNIKEVHQDGKGSTGYRYPWSEDECLKLVLRTHTTAISTAMLHKLATETGGTARYFSIDRVFRNESVDATHLCEFHQVEGVIADYGLTLGGLMEFLTTFFEKMNVTNLQFKPAYNPYTEPHPGLGKIIEIGNSGLFRPEMLEAMGLDKNVYGFGLGLERPTMLKYGLTNIRELLGHQVDITSIQNN. 508
104 6.000e-84UniRef50_A0A1Q6DTG3 Phenylalanine--tRNA ligase alpha subunit n=2 Tax=Archaea TaxID=2157 RepID=A0A1Q6DTG3_9EURY  ali  16  215.GSWEKKKFINYDIEAEAKPKYPGKRHPYQRLLDKVRRIFRDMG--FQEIKGNTVESSFWNFDALFQPQDHPAR-----EMQDTLYLKKPDSSKLPLVEKTKSMHEKGNEINSKGWTWDKKLAEKPVLRTHTTATTIRYLYKNPD---PPQKVFSIDRAYRRETIDATHLPQFYQVEGIVSDKEVDFENLLGFLSEFYERMGFEEIRFRPGYFPYTEPSVELEEWVELGGAGIFRKEVTKPVNVNNPVLAWGLGIGRLAMLKLGLSDLRELYRSDIWLREVPI.. 499
105 6.000e-84UniRef50_A0A1X0QG91 SYFA n=2 Tax=Hepatospora eriocheir TaxID=1081669 RepID=A0A1X0QG91_9MICR  ali  16  195.....DLYFKKYNFDTTGKIPQCGSLHPLLKMKDEFKRIFLEMG--FHEMTNQYVENSFWNFDSLFQPQNHPSRDE-----HDTFFVSKPASAKLEYLNKVKNIHEKGYEME-----WDVKESEKNILRTHTTAVTARYLYALNNNFTEPVKLFSIDKVYRNETVDATHLAEFHQMEGVIAGYNLGLGDLMGIIKEFFNRLGISNIKFKPASNPYTEPHKGLNKWIEMGNSGIFRPEMIEPMGYDITVLGWGLSVERPSMIRYGLNNIRELVGHKVDLSFIKN.. 492
106 8.000e-84UniRef50_A0A1Z8YMJ3 Phenylalanine--tRNA ligase subunit alpha (Fragment) n=1 Tax=Euryarchaeota archaeon TMED85 TaxID=1986696 RepID=A0A1Z8YMJ3_9EURY :_  ali  18  102.GEWKDKSFQRYGVETKVEVEDFSTLHPLTRFTEDIRSIFLQMG--FTEIEGDYVESAFWNMDALFIPQDHPAR-----ELQDTFYLSEPASFEKEIVESVKEIHENGGNTGSKGWSWSKETAQQALLRTHTTVGTIRYLADNP---TPPARVFSVGRVFRREALDSTHLPEFTQVEGIIVEPEANFGMLIGVLKEFYRRMGFNDVRVRPAYFPYTEPVKFGDKWLELGGAGIFRPEVTAPFGIDCPVLAWGLGLERLAMLHLDIKDIRMLYQSDL......... 376
107 9.000e-84UniRef50_H8Z9Z9 Phenylalanyl-tRNA synthetase subunit alpha n=6 Tax=Nematocida TaxID=586132 RepID=H8Z9Z9_NEMS1  ali  17  199...ELAKNLKKYNFNIVTPSKYAGALHPLSMEREKVKNIFLQMG--FEEMDGKYIESSFWNFDALFQPQRHPARNE-----QDTFFMEDPANAKDPESEYLERVRMVHGGFGSSGYKWSLEESRKNVLRTHTTAVTTRLLYKKAQEHEYSRKYFSIDRVFRNETLDATHLAEFHQVEGIIMGVGLTISHLMGFMEEFFKNLGITKIKYKPAYNPYTEPHEEMKRWMEIGNSGMFRPEMLLPMGYPENVIGWGISLERPVMIGRQMNNIRDLVGHRVDLSFIRNGL 496
108 1.000e-83UniRef50_A0A1Y2K4Q3 Phenylalanine--tRNA ligase alpha subunit n=3 Tax=Proteobacteria TaxID=1224 RepID=A0A1Y2K4Q3_9PROT  ali  17  227.GSWRNYQFRPYDVTLDSFKVAPGKVHPLIRMMEKTRRVFLEMG--FEEIESGYVDSSFWVFDALFQPQDHPAR-----EMQDTFYVSNPGICDLPEVEAVRATHENGGETGSIGYDWSARVASTPVLRTHTTAATIRALGENPN---PPRKIFCVGPVFRRETVDYKHLPMFHQVEGVVVDKEASFAQLLGILKVFYGKMGFDKLQFRPAYFPYTEPSVEKQDWVELGGAGMFRPEVTEPMGCQTPVLAWGLGLERLAMISYGLSNLSQLYQARLN........ 504
109 2.000e-83UniRef50_A0A075GW94 Phenylalanyl-tRNA synthetase subunit alpha (FARSA, pheS) n=1 Tax=uncultured marine group II/III euryarchaeote KM3_193_D07 TaxID=1  ali  17  83...WRDARFKPFDVNAPAPTPSGGRPHPMQALIETIRSVFLEMG--FSEIEGDFVQSAGWNMDALFIPQSHPAR-----TMQDTFYLSEPEEVDSEYLDLWAKVHEHGHDTGSRGWGFDRDEARKALLRTHTTVNTVRHIADNPH---QPCRVFGIGRVFRQESIDRTHLPEFYQIEGIIHEAEANLPMLISTLKTFYSKMGFPDVRVRPAYFPYTEPVMWKGEWLELGGSGIFRPEVTEPLGTEWPVCAWGLGLERLAMLILELDDIRELYLPDL......... 354
110 3.000e-83UniRef50_A0A2P6VTV7 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Thermoplasmatales archaeon SW_10_69_26 TaxID=1919232 RepID=A0A2P6VTV7_9EURY  ali  19  228.GAWKDADIRSYDVKAFASAEHPGKRHPMRDIIEKIRRIYLDMG--FHELGGHYARSAFCNLDALFIPQDHPAR-----EMQDTFYLADPDETDLEVVEKVEAVHEAGGDTGSKGWDWSREEARRTLLRTHTTVDTITRLAQNPEA---PQRVFEIGRVFRKEKIDATHLPEFHQVEGIVVEEDASLDMLVGLLETFYEKMGFDDVRVRPAYFPYTEPVVYNDEWLEMGGAGIFRPEVTEPLGVDVPVLAWGLGLERLAMVVLGLDDIRDLYMSDV......... 503
111 3.000e-83UniRef50_S7WA80 Phenylalanyl-tRNA synthetase subunit alpha n=1 Tax=Spraguea lophii (strain 42_110) TaxID=1358809 RepID=S7WA80_SPRLO  ali  16  232.....YKNLKDYNFNTAGNLPKNGALHPLNKIKEEFRQIFLQLG--FEEMTSRYVESSFWNFDALFQPQDHPSR-----DLQDTFFLSNPK---TTKDIPEEYMKKSIGGYGSDGYKWKEEETRKNVLRTHTTAISTKYLYEIMKQRKKPFKLFAIDRVFRNESLDATHLSEFQQIEGLVCDKNLNLSNLMGILEEFFKKLKFEKIKFKPAYNPYTEPHPILKKWMEVGNSGIFRPEMLRPMGEDVRVIAWGLSLERPAMIKYGINNIRDLVGHTVGLDFIR... 521
112 5.000e-83UniRef50_O26837 Phenylalanine--tRNA ligase alpha subunit n=8 Tax=Euryarchaeota TaxID=28890 RepID=SYFA_METTH  ali  18  223.GAWRKLHYRGYNIDAEYPLVYPGKMHPLRRIIDEIRSIFLKLG--FTESRGPIVESAFWNFDCLFQPQDHAAR-----EMQDTFYVKNPAVTDLPCEDLVRAVHETGGSTGSEG--WQYEWDRDVVLRTHTTCVSARFLSEN----EPPLKMFSVGRVFRRETITYKHLPEFHQVEGIVAGDEVNFRNLLGILREFYRKLGFE-VRFRPAYFPYTECLPEKKSWIELGGAGMFRPEVLEPLGVETPVAAFGLGIERLAMIRFDIKDIRMLYQSDLWLRGLPV.. 505
113 6.000e-83UniRef50_Q2FLL0 Phenylalanine--tRNA ligase alpha subunit n=52 Tax=root TaxID=1 RepID=SYFA_METHJ  ali  18  193.GAWKDLSLRRYDITKHPRPVWPGKIHPYQRMIDEMRRILLDMG--FTELHGSIIQGAFWNFDALFQPQDHPAR-----EMQDTFHLAGKQE--LPVWEKVRDMHESGGETSSTGWKWDPEKAKATVLRTHTTSLSIQHLAAHP---EPPVKAFCIGRVYRREAIDPTHLPEFEQLEGIVMDTHVNFRNLLGYLKEFYGRMGFESVRFRPGYFPYTEPSVEGLGWVELGGAGIFREEVTAPWGITCPVLAWGLGVSRVAMLRMGLTDLRELYQSDID........ 465
114 8.000e-83UniRef50_A0A1S4G6L9 Uncharacterized protein n=1 Tax=Aedes aegypti TaxID=7159 RepID=A0A1S4G6L9_AEDAE  ali  17  200.GIWKDLKFKPYNFDALGVPPERGQLHPLMKVRSEFRSIFLEMG--FSEMTNNFVESNFWNFDALYVPQQHPARDQ-----QATFFVSHP--------------------------KLSNKEAXKNVLRTHTTRVSARMLYKVARQEGGPVKYFSIDKVFRNKTLDATNLAEFYQVEGVVADNGLTLGDLIGTFNAFFNKLGITKLQYKPTINRCTEPHPGLQRWIEVGNSGVFHAEMLRSLGVPENVIAWGLSLERPTMIKYGINNIRDLIGPKVDLKMVQ... 459
115 9.000e-83UniRef50_A0A177B950 Uncharacterized protein n=1 Tax=Intoshia linei TaxID=1819745 RepID=A0A177B950_9METZ  ali  15  201...WSNYKFKEYNFAAEGLKHVGGNLHPLMKMRQHYRSLFLRMG--FSEMTNQFVESSFWNFDALFQPQKHPSR-----DLQDTFFTKEPSKAQNLPNKYVKIVAKVHGGYGSIGYNYNWKLAEKLVLRTHTTATTTKMLYNIAQKEKFPAKLFSIDRVFRNETLDSTHLAEFHQVEGVVVDYNLTLGNLMAIISHFFEQLGMTKLRYKPAYNPYTEPHDGLKKWVEIGNSGMFRQEMLRSMGFDENVIAWGLSLERPTMIKYNISNIRDMFGSKVKMSTIYNQV 490
116 9.000e-83UniRef50_A0A1G1GS94 Phenylalanine--tRNA ligase (Fragment) n=2 Tax=unclassified Nitrospirae TaxID=1298915 RepID=A0A1G1GS94_9BACT  ali  15  13.GSWKNKKFRAYNISLNPPRQSIGRKHPYKEFLDFVKYKFIGMG--FEEMRGPLVENEFWDMDALFMPQFHPARN-----IHDVYFVKEPRKIEEPFARNVAAAHKDGGGSTGWRYAFDIERAKRLILRSQGTAVSARTLASGPKV---PGKYFSIARCFRYDAVDATHAPDFYQVEGIVLGEEINFKTLLGLLKLFGQEIAAKEFQFRPAYFPFTEPSVELHGWMELGGAGMFRPEVTKPLGVNVPVIAWGLGLDRMAMVALGIQDIRDLFSKDLDF....... 291
117 2.000e-82UniRef50_A0A1Q9N5P2 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Candidatus Odinarchaeota archaeon LCB_4 TaxID=1841599 RepID=A0A1Q9N5P2_9ARCH  ali  17  223.GGWRKAEFKKFDLESPVSRIYPGKLHPITLLIDEIREIFLEFG--FEEIESPLVENTFWNFDVLFVPQDHPAR-----DAWDTFYLKKPSRGDSEIILNVKAAHENGWVTGSWGYTWDRSEAEKLILRTHTTAATIRYAATNPK---PPKKVFCIDRVYRNERTDYRHLAEFTQIEGIIIDENASLRELLGFLKEFYNRLGFNKIRFRPGYFPFTEPSDKLNQWIEMVGAGIFRPEVTAPLGVRTPILAWGMGFERLAMLRLDLNDVRILYRNDIN........ 500
118 2.000e-82UniRef50_A0A136JXQ0 Phenylalanine--tRNA ligase alpha subunit n=2 Tax=Nitrospirae TaxID=40117 RepID=A0A136JXQ0_9BACT  ali  15  228.GTWRTKRFRKYTISLRAPRIAAGKRHPYREFLDLVKLKLVSMG--FQEMRGTLVETEFWNMDALFMPQFHPAR-----DIHDVYFVKEPTHARSPYLTRVVQAHETGAGSTGWGYQFDVERAKRLVLRSQGTAVSARALAGGASV---PGKYFSIARCFRYDQVDATHATDFFQVEGIVLGADINFRTLLGLLNLFAREVAAKEVKFLPAYFPFTEPSVEMHGWMELGGAGLFRPEVTTPLGVSVPVIAWGLGLDRMAMVALGIHDIRDLFSADLDF....... 506
119 2.000e-82UniRef50_A0A1V0N2M0 Phenylalanyl-tRNA synthetase subunit alpha n=3 Tax=Thermoplasmatales TaxID=2301 RepID=A0A1V0N2M0_9EURY  ali  19  202.GKWRDAKFRPYDLNSRVEPLNGAGLHPLTYLIEKVRKIFLEMG--FTEMHGHFIEYTGWNMDMLFIPQDHPAR-----DLQDTYYSKNPVEFENPILDKVKRVHEHGGKYSGWNYKWSEDEAKKLILRTHTTVNTIRYLYNHRD---KPQYIFSIEKVFRHESVDWKHLSELYQIEGAVYGSDVNLSTLKWLLTEFYSRLGFKNIRLIPSYYPYTEPVDINGKEVELGGSGIFRPEVTKPMELKEPVLAFGLGLERLAMLYYNFNDIREIYNSDLD........ 476
120 2.000e-82UniRef50_I7MF63 Phenylalanyl-tRNA synthetase alpha chain, putative n=1 Tax=Tetrahymena thermophila (strain SB210) TaxID=312017 RepID=I7MF63_TETTS  ali  17  213...ELAKQFKKYNWNSVGKDIKTGNLHPLMKVRKQFREVLIEMG--FEEMTNQYVESGFWNFDALFQPQQHPAR-----DAHDTFFIREPAHSKNLDPEYWERVKKTHGGYGSIGYRWSYDEAKKNIFRTHTTAVSSKMLRQIAIEYAKPRKFFSIDRVFRNESLDATHLAEFHQIEGVIADKNVGLGELLGVITEFFAKIGITGLKFKPTYNPYTEPHPGLNKVIELGNSGVFRPEMLRPMGLDIQVLGWGLGLERPTMIQYKFKNIRDLLGYGVDMKLLKEN. 505
121 5.000e-82UniRef50_O28324 Phenylalanine--tRNA ligase alpha subunit n=10 Tax=Euryarchaeota TaxID=28890 RepID=SYFA_ARCFU  ali  15  191.GTWRGKQFLKYDITIPAKEIYGGKIHPYERIIEECRKVFLEMG--FTEIKGHYVQPAFWNFDALFQPQDHPAR-----DMQDTFYLDRYIDLEGEIVERVKATHENGWGSTGWGGEWSLEKARQLVLRTHTTAITIHYLAENP---EPPQKAFCIDRVYRRETIDATHLPEFDQLEGVVLDRDVGFKHLLGLLKEFFTKMGFEDVRFRPGYFPYTEPSVEGLGWVELGGAGVFRKEVTEPLGIRGKVLAWGLGIGRLAMLKIGLKDLRRLYLPDLWLRSMPV.. 471
122 5.000e-82UniRef50_A0A0B3ADH8 Phenylalanyl-tRNA synthetase alpha chain n=1 Tax=Archaeon GW2011_AR3 TaxID=1579365 RepID=A0A0B3ADH8_ARCG1  ali  15  213...WKDKKFRRYDLNIPVKQLFAGRRHYVREAIEYIRKIWLDMG--FREMTGPMVQTSFWNFDALFTAQDHPVR-----EMQDTFFVQNPKSGKLPLVSLVRNMHEHGGGIGSKGYQWSESEARKNVLRTHTTCLSAQTIASLKLA-DLPAKFFSVGSNFRNETLDWSHLFELHQAEGIVIDENANMRHLIGYLKEFFRKMGFDKVRARPAYFPYTEPHPVHKKWVELGGSGIFRPEVTVPLGKDIPVLAWGLGVSRIIPDYYGITDIRDLFRNDL......... 490
123 5.000e-82UniRef50_A0A2P8ZPM7 Uncharacterized protein n=1 Tax=Blattella germanica TaxID=6973 RepID=A0A2P8ZPM7_BLAGE  ali  14  189.GSWKEKNFKPYNFDALGVPPNCGHLHPLLRVRTEFRQIFLEMG--FTEMTNNFVENSFWNFDALFQPQQHPAR-----DAHDTFFVSNP---RTSSRFPPEYLQKVKQVHSKGGYDWKVEEAMKNLLRTHTTAVSARMLYLLAREGFKPSKYFSIDRVFRNETLDATHLAEFHQVEGVIADYNLTLGDLIGTLYEFFKKLGITRLQFKPAYNPYTEPSMELGKWIEVGNSGIFRPEMLLPMGLPENMV.................................... 441
124 6.000e-82UniRef50_B8P378 Predicted protein n=10 Tax=Dikarya TaxID=451864 RepID=B8P378_POSPM  ali  16  176.GSWKTSTYKKYNFEAEGLPPNGGAFHPLLKVREEIRNIFLEMG--FAEMTSSFVESGFWCFDALFVPQQHPAR-----EVQDTFYLSGKRNPSTSLPPPASYYSRVSKVHEHGGYGWSDAETRKLLLRTHTTASSASMLYKLAAKCRGPAKLFSIDRVFRNETMDATHLAEFHQVEGVVADRGLTLADLIGFMRVFFKKMGIENLRFKPAYNPYTEPHPQLGKWVEVGNSGMFRPEMLEPMGFPKDVHAYNDSV-RGALRRYGISNIRTLVGHKVSIEGVET.. 502
125 9.000e-82UniRef50_G7YMK7 Phenylalanyl-tRNA synthetase alpha chain (Fragment) n=6 Tax=Eumetazoa TaxID=6072 RepID=G7YMK7_CLOSI  ali  16  210.GSWKTTRFKAYNFNALGAALPSGHLHPLLRVREEFSKILSDMG--FTEMTNNYIECSFWNFDSLFQPQQHPAR-----DAHDTFFISDPATTELSRVAPADYVDRVSGSFGSRGYEWLVSEAEKNLLRTHTTAVSARMLYALAKQTPVPVRYFSIDRVFRNETLDATHLAEFHQVEGLVADFGLGLGHLKAVIRAFFNKLGLTKLRFKPAYNPYTEPHPGLQKWVEIGNSGIFRPEMLRPMGLPETVIAWGLSLE............................. 475
126 1.000e-81UniRef50_Q648W3 Phenylalanine--tRNA ligase alpha subunit n=9 Tax=Archaea TaxID=2157 RepID=Q648W3_9ARCH  ali  19  250.GSWRGRKFKRYDVNLASKEVFPAKIHPYQRLLDRMRRIFTEMG--FVEIKGEVVQSAFWNFDALFVPQDHPAR-----EMQDTFYLAARKPIDAPLIKNVEQMHEHGGNSTGWGGEWKRELGEELLLRTHTTAVTLSYLASH---LEPPVKVFCIDRVYRRETIDPTHIPEFDQLEGIVMDKGVTFSNLLGCLATFYNKIGFPSIRFRPGYFPYTEPSVEVRGWIELGGAGIFREEVTNPVGVDYPVLAWGLGIGRLAMISLGLTDIRDLYQPDID........ 525
127 1.000e-81UniRef50_A0A1J4UGC1 Uncharacterized protein n=2 Tax=unclassified Candidatus Micrarchaeota TaxID=1801634 RepID=A0A1J4UGC1_9ARCH  ali  17  201.GSWKGAHLREYNISAPSEEPLIGKRHIIAKLAKKISGIFTEMG--FEEMEGGMIESSFWNFDALFQPQDHPAR-----DLADTF----YLEGDSPLPKDSELVKRVKRSHQKGWYSWQKKEAEKAILRTHTTCVSARTLYEKCTGKKEGRKFFSIGKVFRNEATDYKHLAEFFQVEGIVMWEDATFSHLMGFLTEFYKKMGFEKIRFVPSFFPYTEPHEPKKCWMELGGAGIFRPEVSIPLCGRYPVLAWGLSLERPLMLSLGIEDIRSFYKNN.......... 471
128 2.000e-81UniRef50_A0A147JWP5 Phenylalanine--tRNA ligase alpha subunit n=8 Tax=Euryarchaeota TaxID=28890 RepID=A0A147JWP5_9EURY  ali  18  257.GRWREVRLKKYDVTAPGVPIYPGKAHPLQQMIEELREILLEMG--FVEIKSRIVESEFWNFDALFQAQDHPAR-----EIHDSFSLSRPRQTSLP---PPDLLNRVVRAHERGVTGWKYKFNTDVSRRPQTTAATVRYLSSHPD---PPAKVFCIDRVYRHEKIDYKHLAEFYQAEGIVMDKGLTLRDMLGYLKQIMVKLGLPKIRFRPGYFPYTEPSPEKKEWLEILGAGMFRPELLRPLGIRYPVLAWGIGFSRLSMIRLEIDDIRDLYNNDI......... 532
129 2.000e-81UniRef50_A0A2J6WSJ9 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Aciduliprofundum sp. TaxID=2060325 RepID=A0A2J6WSJ9_9EURY  ali  19  202.GSWKNKELKRYDIRMFTPLPDMGREHPISEFISRVRRIFLSMG--FMEIDGDYIVPAFWNMDALFIPQDHPAR-----DMQDTFYMD--SVGNLPYAQTVKKIHENGGGISRGWYSWDSNLAVKNILRTHTTVNSIKYLYDHREE--DIIRVFMIGRVFRRENMDPTHLPEFHQIEGIMVEPGSNFSMLLGTLHRFYSSLGFEKIKFKPSYFPYTEPSVEVGGWLELGGAGVFRPEVTLPLGIKNRVLAWGLGLERLAMLYYGLKDIRDLYIADLD........ 473
130 2.000e-81UniRef50_A0A2D6WQ32 Phenylalanine--tRNA ligase n=150 Tax=cellular organisms TaxID=131567 RepID=A0A2D6WQ32_9BACT  ali  17  217..EWKTAEFRSFDVTLEAATPRTGRSHPMQALIERIRAIFLEMG--FSELVDDYVQSAGWNMDALFIPQDHPAR-----EMQDTFYLDQPSSIDLDVLQAWKAIHEHGGETGSTGWGGSYEVSQRPLLRTHTTVNTIQYLAEHPTEA---CRVFSVDRVFRKEAIDRTHLPEFHQIEGIIMEEGANLQMLVTTLKTFYAKMGYPEVRVRPAYFPYTEPVKWRGKWLELGGAGIFRPEVTEPLGITSPVLAWGMGLERLAMLVLGLDDIRQLY--ISDLEWLRN.. 494
131 2.000e-81UniRef50_A0A0B3B1G1 Phenylalanine--tRNA ligase alpha subunit n=2 Tax=cellular organisms TaxID=131567 RepID=A0A0B3B1G1_ARCG9  ali  20  222..EWKDKEFRSYDVKSQVPKLIGGRGHPLQETIDYIRTIFLDMG--FKEMEGPLVETAFWCMDSMWIPQDHPAR-----EVQDTFYLN--KEGKLPIKELVKKVAEVHEGSKGYGYKFDENVAKQLLLRTHTTATTFRYFGE--RNIKPPAKYFYIGRIFRNEAIDATHLPEFHQVEGFIMDEGLTLRDLMGYVKEFYNKMGINKIKFKPTYNPYTESSMELGKWIELINSGIFRPEALEPYGIKVPVIAWGLGLERLAMMIHEQKDVRNMLGATSDLRWLR... 502
132 3.000e-81UniRef50_A0A2H9MT82 Phenylalanine--tRNA ligase subunit alpha (Fragment) n=1 Tax=Nitrosopumilales archaeon CG15_BIG_FIL_POST_REV_8_21_14_020_37_12 Tax  ali  18  33............DVEAKVPQVYVARTHPLKDTIDEIREIFVTLG--FSEIIGSMTQPSFWNFDALFTPQDHPAR-----ELQDTFYLDGIKKIGTP--EQIKKVSASHKQ--GWRYLWDINEARKMVLRTHTTCVTIKHLAE---AKPDEARVFSVGRVFRNEKVSYKHLVEFNQIEGVVVGKNATLRDLMGIQKEFYKRIGITKIKFWPTFFPYTEPSDRLGKWVELFGMGIFRPEVTRPLGISKPVLAWGGGIERIAMLKYGLDDVREFYKNDLN........ 292
133 3.000e-81UniRef50_D3E4E7 Phenylalanine--tRNA ligase alpha subunit n=53 Tax=Archaea TaxID=2157 RepID=D3E4E7_METRM  ali  19  226.GSWAKLKYRPYDINAEYPIFFPGKEHPLRRIIQEIREIFLNLG--FTEAKGEYLESAFWNFDSLFQPQDHAAR-----EMQDTFYVKNPLTCDLPDDDLVERVAKTHEDSEGWHYDWDADIARQSVLRTHTTGISTQALAN----WELPIKMFSVGRVFRRETFDYKHLPEFHQVEGLVAAPGINYQNLLGTLKEFYKKLGFE-VRFRPAYFPYTECLEEKESWIELGGCGMFRPEVLEPLGVKVPALAFGLGIERLAMIRYDLSDIRMLYKSDIWLREVPLE. 509
134 4.000e-81UniRef50_A0A1D2R333 Phenylalanine--tRNA ligase alpha subunit n=7 Tax=Euryarchaeota TaxID=28890 RepID=A0A1D2R333_9EURY  ali  19  223.GKWQEVELRRYNVDTFAPKMYGGAVHPMQRLILKIRDIFLQMG--FTEIETDFIHSCFWNMDALFIPQDHPAR-----DAQDTFYLKKPLKLDETLTQKIKDMHEQGGDSTGWRYRWDLREAEKAILRTHTTVNTIKYLSENPD---PPVKVFSVGRVFRREALDSTHLPEFQQIEGIVMEEGANLRMLIGILTEFYKKIGFEKIRIRPGYFPYTEPIQLGGKWLEYGGAGIFRPEVTSPFGVKHPVLAWGLGLERLVMLRYDIKDIRNLYFNDI......... 496
135 5.000e-81UniRef50_A0A1W9MMT9 Phenylalanine--tRNA ligase alpha subunit n=6 Tax=root TaxID=1 RepID=A0A1W9MMT9_9EURY  ali  20  212..SWEGAEFRKYDVNVFVEPQYPAKVHPLTNLINQIREIFV--GTGFKEMQGNLIEPTFWDFDALFQPQDHPAR-----DMQDTFYLKNFKEIYG--FEKFK--DKVKNAHEKGWYKWNEEDAKKFILRTHTTAVSAHYLTTLKKQ-DLPAKIFTIGKVFRNETIDFKHLPEFYQVEGIIVGEDVNFRNLLGILKNFYNSLGFEKIRFRPGYFPYTEMSVEKEQWMELGGAGIFRPEVVKPLGFECPVLAWGLGLDRIAALRLNLSDIRDLYISDID--WLRKN. 489
136 8.000e-81UniRef50_A0A256Y4L0 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Archaeoglobales archaeon ex4484_92 TaxID=2012529 RepID=A0A256Y4L0_9EURY  ali  15  194.GSWRESEFLKYDIQLPSREVYGGKVHPYEGIIQECRKIFLEMG--FKEIKGHYVQTSFWNFDALFQPQDHPAR-----DMQDTFYLDHYLDLDRKLVDKVKKTHENGWVTGSLGWRWDTEKARQLVMRTHTTAVTIHYLAKNPN---PPQKAFCIDRVFRREAIDATHLPEFDQLEGVVLDRDVGFRHLLGLLKEFFAKMGFEDIRFRPGYFPYTEPSVEGLGWIELGGAGVFRKEVTEPLGIRGKVLAWGLGIGRLAMLKIGLKDLRKLYLPDIN........ 467
137 9.000e-81UniRef50_A0A0F8VJ55 Uncharacterized protein (Fragment) n=7 Tax=root TaxID=1 RepID=A0A0F8VJ55_9ARCH  ali  17  203...WENFELKPFDVSKSGPRLKAGKIHPIINLINEIREIFLSMG--FTEIRGPIIESAFYNFDALFQPQDHPAR-----EMQDTFYLKNPNIAHLPERDRVKETHESGGESGSIGYEWDEKIAKKTVLRTHTTATTMRRLAQFYRDNEKPVKVFCVDRVFRNEKVDKSHLAEFTQVEGIVIDDNVNLCDLIGLLSEFYRKMGFKKIFTRPGFFPYTEPSDKLGEWLEMGGSGIFRPEVTYPWGIKEPVLAWGQGLERIAMLYYNRTDIRDFY............. 479
138 1.000e-80UniRef50_A0A2H9MF56 Phenylalanine--tRNA ligase alpha subunit n=8 Tax=Archaea TaxID=2157 RepID=A0A2H9MF56_9ARCH  ali  15  215...WKTQLIRPYDVTLPSTKINPGKKHYITQIIEYIRGIWTDMG--FKEMTGPLLDISFWNFDSLFQPQDHPAR-----DLADTFYMKIPEKGKLPLVEKVKLTHENGWDTGSLGYKWNPEFARRCVLRTHTTSLSARTIA-KLKSEDLPVKYFAVGRCFRNETLDWKHLAEFYQTEGIVVGEDVTFRQLQGYLRRFFEKMGFPKTRFRPGYFPYTEMHPAHKQWMELGGSGIFRPEVVKPLGKDVPVLAWGLGFDRIIMDKYKVDDIRKLYLSDL......... 492
139 2.000e-80UniRef50_A0A2N1PRG6 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Candidatus Wallbacteria bacterium HGW-Wallbacteria-1 TaxID=2013854 RepID=A0A2N1P  ali  15  234.GKWRDVIFRKYDVQADAELIEQGKFHPFMKIIDQTRKVFLEMG--FDEVESPYAESGFWDFDALFQPQDHPAR-----EMQDTFFLERPGTCSLPSAELVKNVHENGGSTGSWGYKWGEEKAVQAVLRTHTTASTIRALSRN----PEPAKVFCVGRVFRRETIDYKHLPVFFQVDGIIIDKKANFASLLGTLEAFYRKMGFEKFQFRPAFFPYTEPHEKRRDWMEMGGAGIFRPEVTEPLGCDCPVMAWGLGLERIAIFRYGLNDIREIYMPDIWLREV.... 516
140 2.000e-80UniRef50_A2DJE6 Phenylalanyl-tRNA synthetase, alpha subunit family protein n=1 Tax=Trichomonas vaginalis TaxID=5722 RepID=A2DJE6_TRIVA  ali  16  209.GEWQNVDFAPLNFEAQGTKIPCGHEHPLLKVRAEFRNIFFQMG--FEEMTSKWVENSFWNFDSLFQGQQHPCR-----DMHDTFFLSNP-EFAQPIPDH-DYFLRVKGGNGSIGYDFSEQIPLTNIMRTHTTAVSSRTLKMLADEFKRPRKFFSIDRVYRNETLDATHLAEFHQVEGFIIDKNLSLGDLMRNIREFFSRIGLNDISFKPAYNPYTEPHPGLGREIEIGNSGMFRPEMLESMGIEYTVIAWGFGLERPTMIEYKIDEIRKLEGPNVSLDLIEN.. 503
141 3.000e-80UniRef50_W7JJX6 Phenylalanine-tRNA ligase, alpha subunit n=3 Tax=Plasmodium (Laverania) TaxID=418107 RepID=W7JJX6_PLAFA  ali  17  287..EYKKYDIKKYNFFSSGKKINKGNIHLLTKQMRTFKEIFFSLG--FEEMTHNYVESSFWCFDALYIPQQHPSR-----DLQDTFFIKEPETVDTEYIDNIKRVHTHGDGSFGWNYKWKLEESKKNVLRTHTTANSCRALFKLAKEYKKPKKYFSIDRVFRNENLDSTHLAEFHQVEGLIIDKNIGLSHLIGTLAAFYKHIGIHKLKFKPTFNPYTEPHEQSKKWLEVGNSGIFRPEMLRSMGFSEEVIAWGLSLERPTMIKYNIKNIRDLFGYKS......... 574
142 3.000e-80UniRef50_A0A257A8X0 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Desulfurococcales archaeon ex4484_217_1 TaxID=2012518 RepID=A0A257A8X0_9CREN  ali  19  230..EWLIKEIKPYNIKAMPPRLYPGKKHFYLEFIDMIREILLSMG--FEEAEGPIIEVELWNFDVLFQPQDHPAR-----EIHDTFRLKFPMKVDENIALKVKEVHERGGKAGSWRYKWSIDVAERLILRTQTTSVSVRFLAKRK---EPPIKMFTIGKVYRPDTIDAKHLPEFHQLDGIIMDKELNFRNLLGILQEFFRKLGIEKVKFKPSYFPFTEPSVEGVGWVETFGAGMFRPEVLEVLDVKYPTAAWGIGVDRVAMIIMGIDDIRDLYSSISYLRNRRV.. 511
143 3.000e-80UniRef50_A0A2A5P130 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Candidatus Geothermarchaeota archaeon ex4572_27 TaxID=2012530 RepID=A0A2A5P130_9  ali  16  245.GRWRGVEFKEYDVSMPAPPVYGGKRHPLHQLIDEIREIFVSMG--FIEEWGPLIELAFWNFDALFQPQDHPAR-----EMHDTFYLKEPRAGSLDVVERVRRTHEDGGDTGSWRYRWRLEEAARYVLRTHTTAVTARKVYEYG---ERPVKIFAIGKVFRNETVDYKHLPEFYNVDGIVIDPRTNLRELLGVLKTVFERLGFRRVMFRPSYFPYTEPSERARGYVELAGSGIFRPEVTIPLGVRWPVLAWGMGVERILMMRYGIEDIRQIYRNDI......... 522
144 4.000e-80UniRef50_A0A0B3APE0 Phenylalanyl-tRNA synthetase alpha chain n=2 Tax=Archaea TaxID=2157 RepID=A0A0B3APE0_ARCG7  ali  17  110.GAWAKASFRRYDVATNVPQIHGGRRHYVEQAISHIKRIWLDLG--FTEMEGNLVQTAFWDLDALFVPQDHPAR-----EMQDTFYLKEPSSGKLPLTQKIKDMHEHGGNTGSKGWSWSADLASKNLLRTHTTVLSAQTIAAL-KDSDIPAKYFTVGRVFRNEALSWKHLFEFTQVEGIVVDPEANFKHLKGYLSEFFQKMGFEKVRIRPAHFPYTEPHPIKKTWVELGGAGIFRPEMVVPLGKDVPVLAWGLGLERSIMEYYGFNDVRLLYQNDL......... 388
145 5.000e-80UniRef50_A0A1W0E500 Phenylalanine--tRNA n=1 Tax=Enterocytozoon hepatopenaei TaxID=646526 RepID=A0A1W0E500_9MICR  ali  17  195.....EKKLKPYNFDVESNQVQCGSIHPLMKIKDEYKKIFLEMG--FTEMTNKYVESSFWNFDALFQPQNHPSRES-----QDTFFNNSLEEVDAKYLKRVSDIHSSTYDNIKEEFKWKIEEATKNILRTHTTAISARLLYKIAEKIRKTYKFFSIDKVFRNETVDATHLAEFHQVEGIVVGKELTLKELISVLQSFFKKLGIEKLRFKPAFNPYTEPHEGLGKWVELGNSGIFRPEMLLPMGFDVTIIAWGLSLERPAMIRYGLNNIRDLVGHKVDLNFIR... 492
146 6.000e-80UniRef50_A0A1V4UZ63 Phenylalanine--tRNA ligase alpha subunit n=3 Tax=Methanomicrobia TaxID=224756 RepID=A0A1V4UZ63_9EURY  ali  18  76.........RPYDVSLPADRIFPGKRHPYQRLIDNMREIMLEMG--FVEIKGPIVQTSFWNFDALFQPQDHPAR-----EMQDTFYLN--SQGDIPDYARIKEMHECGGGSTGWGGCWSPEVARQEVLRTHTTGVTIKYLAEHPR---PPVKAFGIDRVYRREAIDSTHTPEFEQLEGIVMDESVSFCHLLGILKEFYGKMGFEEVRFRPGYFPYTEPSVEGLGWVELGGAGVFRKEVTAPFGIDHPVLAWGLGVSRVAMLRLGLKDLRLLYQSDI......... 338
147 9.000e-80UniRef50_I3D3U5 Phenylalanyl-tRNA synthetase, alpha subunit n=2 Tax=Nitrosopumilus TaxID=338191 RepID=I3D3U5_9ARCH  ali  18  109............DVEAKVPDVFVARTHPLKDTIDEIREIFVTLG--FSEIIGNMTQSSFWNFDALFTPQDHPAR-----ELQDTFYLDGIKKIATP-----EQIRKVSDSHKKWRYHWDINEARKMVLRTHTTCVTIKHLAENK---PDEARVFSLGRVFRNEKVSYKHLVEFNQIEGVVVGKDANLRNLMGIQREFYKRIGITKIKFWPTFFPYTEPSERLEKWIELFGMGIFRPEVTKPLGITKPVLAWGGGIERIAMLKYGIDDVREFYNNNL......... 367
148 1.000e-79UniRef50_A0A0G4KSF9 Uncharacterized protein (Fragment) n=1 Tax=Verticillium longisporum TaxID=100787 RepID=A0A0G4KSF9_9PEZI  ali  16  119..........PYNFKALGADQNSGALHPLNKVRHEFRQIFFEMG--FEEMTNKYVESGFWNFDALFVPQQHPAR-----DLQDTFYISDPKVAGRPGPEYWENVKQVHGKYGSIGYRWEADESLKLVLRTHTTSVSTAMLHKLADGRPPPARYFSIDRVFRNESVDATHLAEFHQVEGVIADYGLTLGGLMEFMEIFFNKMGITDLKFKPAYNPYTEPSMELNKLVEIGNSGMFRPEMLESMGLDMRVYGWGLSLERPTMIKYGISNIRELLGHKDKLEAASN.. 413
149 2.000e-79UniRef50_Q0W0X9 Phenylalanine--tRNA ligase alpha subunit n=4 Tax=Methanocella TaxID=570266 RepID=SYFA_METAR  ali  14  205.GSWQGKTFRKFDVSLPVQTEYGGRKHILRMGMDAVKRTLIEMG--FKEMEGPMVDAEFYVNDLLFMPQDHPARTHW-----DQFNLKEPKYISLPLVERVRRVHRDGGSSGSLGYEWDETIARKLVLRGHTTSLTARYLAKHSK---PPQKYFSVSQVFRNDTIDVTHLLEFCQIEGWIMDDNLSMKELMGTFKEFYSRMGITVLKFKPTYNPYTEPHPKTGRWIEVGNSGMFREEMMEPYGINSTVVAWGLALERLMMINYGYTDIRDLHGPLCDINFLR... 487
150 2.000e-79UniRef50_A0A2N9HQY2 Uncharacterized protein n=1 Tax=Fagus sylvatica TaxID=28930 RepID=A0A2N9HQY2_FAGSY  ali  17  1.....................................MIFLQMG--FEEMTDRYVESSFWNFDALFQPQQHPARDS-----HDTFYLKDPRELPEDYVERVKRVHESGGYGSRGYYDWSREEANKNLLRTHTTAVSTRMLYMLAQKPFTPKRYFSIDRVFRNEAVDRTHLAEFHQIEGLICDRGLTLGDLIGVLHDFFSRLGMSKLRFKPAYNPYTEPHDGLKKWVEIGNSGMFRPEMLLPMGLDVRVIAWGLSLERPTMILYGIDNIRDLFGHKVDLGLIKTN. 306
151 2.000e-79UniRef50_A0A235BN66 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=candidate division WOR-3 bacterium JGI_Cruoil_03_51_56 TaxID=1973747 RepID=A0A23  ali  15  226.GKWRDVVLKRYDPGLETAPRYPGKPHPLQRIIQETRRAFFEMG--FEEAASPVVETAFWDFDALFQPQDHPAR-----EMQDTFYMRKPVQGRLPLVMRVGRTHENGGGTTGWRYEWNRSLAKRLVMRTHTTATTIRALAANPEA---PRKVFCVGKVFRRENIDPTHLPEFVQIDGVIIDEQASFATLLGTLQEFYRKMGAEELKFRPSFFPYTEPSVELGAWIEMGGAGIFRPEVTLPLGCKAPVLAWGLGLERLVMLRFGVPDMRKLYWCDID........ 503
152 2.000e-79UniRef50_A0A1X1BIU4 Phenylalanine--tRNA ligase alpha subunit n=8 Tax=Piroplasmida TaxID=5863 RepID=A0A1X1BIU4_9APIC  ali  16  225...WSAEDMKPYNFFSSGKRIPRGALHPLTRTMRHFREIFTSMG--FEELTANYVESSFWCFDALYIPQQHPARDS-----QDTFFTRVPELHDETRLNYIDAVAEAHGDSTGWMYNWKIEESRKLVLRTHTTACTARLLKRMAENFDLPCKFFSIDRVFRNENMDATHLCEFNQVEGVMVGFGLGMGHLIGVLASFYAAIGIEKLRYKPAYNPYTEPHPELKKWVEIGNSGIFRPEMLLPMGLPISVVGWGLSLERPTMISHNIRNIRDLVG............ 509
153 4.000e-79UniRef50_A0A2D4BJU2 Phenylalanine-tRNA ligase, alpha subunit n=1 Tax=Pythium insidiosum TaxID=114742 RepID=A0A2D4BJU2_PYTIN  ali  15  482..AWKSETFKPYNFNTMGLTVGGGHLHPLMKVRAEFRRVLMDMG--FSEMTNRFVESSFWNFDSL-------------------CVVFKPASCLTVPEEYYERVHDMHGGHGSIGHGFKRETSMKNLLRTHTTAISAQMLYKLANQPGGPQKYFSIDRVFRNESMDATHLAEFHQVEGVVADYDLSLGDLIGVIKAFFNKIGITQMRFKPAYNPYTEPHPDLKKWTEIGNSGVFRPEMLRPMGLPENVIAWGLSLERPTMIKYRLSNIRDLFGHKVDLENTRT.. 758
154 4.000e-79UniRef50_A0A0G1L921 Phenylalanine--tRNA ligase n=1 Tax=Candidatus Jorgensenbacteria bacterium GW2011_GWA2_45_13 TaxID=1618662 RepID=A0A0G1L921_9BACT  ali  17  191.GSWKKSSFRKYDASAPVEIPPIAKRHMVSRLKRKIAGIFVEMG--FEEMQGPEIQSSFWNFDALFQPQDHPAR-----DLADTFYLK--AASILPS--DKAMVSRVKKVHEKWGGSWLEENAEKTVLRTHTTAVSAAYLYRHCQG-KTPKKYFSIGKVYRNEATDYKHLAEFFQVEGIVVFEKATFRDLLGCLKEFYRKLGFKKIRFQPSYFPYTEPSEKKKQWLELGGAGIFRPEVSLPLCSRYPVLAWGLSLERPLMLLNDMDDIRDFYRSNV......... 461
155 6.000e-79UniRef50_A0A0B5HV31 Phenylalanine--tRNA ligase alpha subunit n=20 Tax=Archaea TaxID=2157 RepID=A0A0B5HV31_ARCG3  ali  17  220.GSWQKKEFRKYDVEINVPKISGGKRHFTNQAVEYIKNIWLDLG--FREMTGNMVQTSFWDLDALFVPQDHPAR-----DMQDTFYLKTPKKGKLPFVKRVKATHENGWTTGSQGWKWDAEKAKENLLRTHTTVLSAQTIASLKKE-DLPAKFFAVGKCFRNETMDWKHLFEFYQVEGIVVDPDANFRNLLGYLKEFFRKMGYPDVRIRPGHFPYTEPHPVKKEWVELGGSGIFRPEVTKPLGTEVPVLAWGLGLDRIIKENWNIKDIRELYKNDL......... 499
156 1.000e-78UniRef50_A0A2D6PCS1 Phenylalanine--tRNA ligase alpha subunit n=7 Tax=Archaea TaxID=2157 RepID=A0A2D6PCS1_9ARCH  ali  15  279...WDKKTFRRYDIKINVPKIYGGKRHFVNQALDYARNIWLEMG--FKEMTGSIVQTSFWNFDALYTPQDHSVR-----EMQDTFFIENPEKGQLPLMDRIKRMHENGGGSTGWRYPWNSEEARKNVIRTHTTVLSAQTLAEIKKT-ELPVKFFGIGKCFRNETVDWSHLFEFNQTEGIVVDEDANLRHLIGYLKQFFKKMGFPEARFRPAYFPYTEPHPVHKKWIELGGAGIFRPEVVIPLGKDIPVLAWGPGIDRIVMDYYKIKDLRMLYKNDI......... 556
157 1.000e-78UniRef50_B7XI98 Probable phenylalanine--tRNA ligase alpha subunit n=1 Tax=Enterocytozoon bieneusi (strain H348) TaxID=481877 RepID=SYFA_ENTBH  ali  18  181.......LLKKYNFNLSKVSRFFGSLHPLTKIKSEFKRIFLEMG--FSEMTGKYVESSFWNFDSLFQPQNHPSR-----EIQDTFFLKVPRDVDSQYINRVESIHSSTSIPVDEGYDWSVAEAKKNILRTHTTAISSQMLYKLAQSNLKNIKLFSIDKVFRNETVDATHLAEFHQVEGLISGENLGIKELIHTIKTFFTKLNIHQIRFKPAFNPYTEPHPQLKKWIELGNSGIFRPEMLLPMGFPKNVIAWGLSLERPAMIKLGLKNIRDLVGHKISVEFIR... 479
158 2.000e-78UniRef50_T0MU27 Uncharacterized protein n=1 Tax=Thermoplasmatales archaeon I-plasma TaxID=667138 RepID=T0MU27_9EURY  ali  20  205.......TLRPYDPTLYAPRYLPGKIHPLSEFIEEVREVMLEMG--FKELKGQIVETAFWNMDMLFIPQNHPAR-----DMQDTFYLKGKGELDASKVRKVKRVHERGIAGSRGWYKWSKDEASKLLLRTHTTVNTIRYITEHPTEE---CKIFSVEKIFRRENLDAQHLAEFSQVEGVISGKGVTFGVLIDTLETFYHRLGVKDVWVKPSYFPYTEPSTFKGRDMELGGAGMFRPEVLKPWGIKYNVAAWGLGLERLLMTVLKLDDIRDIYRNDL......... 469
159 2.000e-78UniRef50_A0A075I5Y9 Phenylalanyl-tRNA synthetase subunit alpha (FARSA, pheS) n=4 Tax=Euryarchaeota TaxID=28890 RepID=A0A075I5Y9_9EURY  ali  17  216...WRDARFKPFDVNAPAPTPSGGRPHPMQALIEMIRSVFLEMG--FSEIEGNFVQSAGWNMDSLFIPQSHPAR-----TMQDTFYLSEPEQVEVEYLDLWARVHEHGHDTGSRGWEFDQEEAKKALLRTHTTVNTVRYIAENPHE---PCRVFGIGRVFRQESIDRTHLPEFYQIEGIIHESEANLPMLISTLKTFYSKMGFPDVRVRPAYFPYTEPVMWRGEWLELGGSGIFRPEVTEPLGTEWPVCAWGLGLERLAMLILELDDIRELYQPDL......... 487
160 2.000e-78UniRef50_A0A256ZVB4 Phenylalanine--tRNA ligase subunit alpha n=2 Tax=Candidatus Aenigmarchaeota archaeon ex4484_14 TaxID=2012502 RepID=A0A256ZVB4_9AR  ali  18  172.......................GKQHIITTYIEKIRKIFIELG--FTELAGPFVESSFWNFDALYQPQDHPAR-----DMADTFFLKNPSVARLPIVEKVKAMHEHGGDSTGWGYSWSSEIAKQLVLRTHTTSVSARQLAK----TSGPGKFFCIGRVFRNETIDFKHLPEFTQIDGIVVDKDVGFKDLLGYLKEFYKRLGFKKIRFRPAYFPYTEMSEEKDEWLELGGAGIFRPEVTKPLGIEYPVLAWGLSLERPIMMRT...................... 411
161 2.000e-78UniRef50_A0A2H9MKF6 Phenylalanine--tRNA ligase alpha subunit n=2 Tax=unclassified Euryarchaeota (miscellaneous) TaxID=115531 RepID=A0A2H9MKF6_9EURY :  ali  19  218.GNWNEKKFRRYDVSTFAPSVYPGKVHPLTKIINEIREIFVSMG--FMEIEYDYIQPCFWNMDALFVPQDHPAR-----DMQDTFYMNKRIRVDKRIAEKIKKIHENGGNTGSEGWKWGMDEAEKTVLRTHTTVNSIRYLSEHP---EPPLKVFTIGRNFRRENIDSTHLPEFTQIEGILSEENADFNMLVGILKEFYKRIGFEKIKIKPSYFPFTEPSLEKAGKLEMGGAGIFRPEVTAPFNVKAPVLAWGLGLERLAMIRLGLKDIRALYMSDI......... 509
162 3.000e-78UniRef50_Q5ZJQ2 Phenylalanine--tRNA ligase alpha subunit n=14 Tax=Euteleostomi TaxID=117571 RepID=SYFA_CHICK  ali  17  203.GSWRKLPFKAYNFSALGLPPTCGHLHPLLKVRSQLRQIFLEMG--FTEMTDNFVESSFWNFDALFQPQQHPARDQ-----HDTFFLQDPAEAELPA-NYMARVKKVHGGYGSQGYKWKVEEARKNLLRTHTTSASARALYHLARQGKFPVKYFSIDRVFRNESLDATHLAEFHQVEGVVADRGLTLGHLMGTLQQFFTKLGISKLRFKPAYNPYTEPHEGLKKWVEVGNSGVFR.................................................. 442
163 3.000e-78UniRef50_A0A1F7RRM1 Phenylalanine--tRNA ligase (Fragment) n=1 Tax=Candidatus Schekmanbacteria bacterium RBG_13_48_7 TaxID=1817878 RepID=A0A1F7RRM1_9B  ali  15  5...................PVYPGKIHPFVKIQEETRSVFLSMG--FKEVTTSYVESSFWNFDALFTPQDHPAR-----EMQDTFYLKTPSKTRIPAPELVEQIHENGGDTGSIGWKWDDKKSQMPTLRTHTTAASIRALAAHP---EGPGKYFCIGPVFRRETTDYKHLPAFMQIDGIIVEENASFADLLGTLAEFYSKMGFAKFQFRPGFFPYTEPSVEKKDWVEMGGAGIFRPEVTIPLGCSVPVLAWGLGLERIAMFRY...................... 250
164 5.000e-78UniRef50_A0A2G9LLP7 Phenylalanine--tRNA ligase alpha subunit n=6 Tax=Candidatus Altiarchaeum TaxID=1803512 RepID=A0A2G9LLP7_9EURY  ali  19  220..SWKGAEFRKYDVSVFVEPQYLAKFHPLTNLINDIREIFVGMG--FKEMRGNLIEPTFWDFDALFQPQDHPAR-----DMQDTFYLKNFVEVDG--FEKFKNPIR--DAHEKGWYQWNEEEAKKFILRTHTTAVSAHFITTLKKH-DLPAKIFTIGKVFRNETIDFKHLPEFYQVEGIVVSEDVNFRNLLGILKNFYNSLGFEKIRFRPGYFPYTEMLESKEQWIELGGAGIFRQEVVKPLGFECPVLAWGLGLDRIAALRLNLSDIRDLYISDID........ 492
165 5.000e-78UniRef50_A0A1A8XAF0 Phenylalanine--tRNA ligase alpha subunit n=56 Tax=Plasmodium TaxID=5820 RepID=A0A1A8XAF0_PLAMA  ali  17  280..EYKKYDIKEYNFFSSGKKIIKGTLHVLTKQMRIFKDIFISLG--FEEMTHNYVESSFWCFDALYIPQQHPSR-----DLQDTFFIKDPEFIDIGYIENVKRVHSVGDGSFGWNYEWKIEESKRNVLRTHTTSNSCRTLFKLAKEYNRPKKYFSIDRVFRNENLDSTHLAEFHQVEGLIIDKNLGLAHLIGTLSAFYKYIGIHKLKFKPAFNPYTEPHEQSRKWLEVGNSGVFRPEMLRAMGFDVSVIAWGLSLERPTMIKYNVKNIRDLFGYRSTL....... 570
166 8.000e-78UniRef50_A0A0M0BQP3 Phenylalanine--tRNA ligase alpha subunit n=2 Tax=root TaxID=1 RepID=A0A0M0BQP3_9ARCH  ali  15  219.GGWRDAFFQRYDVALPVPTLYPGKRHFISQVIDYIRRFWVELG--FREMTGPLLELAFWNFDALFQPQDHPAR-----DLADTFYMKRPRSGRLPDPELVRRVRETHEGSTGWQYDWDPELARRCCLRTHTTSLSVNAIARLG-EEDLPAKFFSVGRVFRNETIDWNHLMEFYQTDGIVIGDGVTFRDMQGYLKAYIEGLGARRFRFRPGYFPYTEMVEEKGAWMELFGAGMFRPEVVKPLGREVPVLAWGPGFDRLVMQSYGINTIRELYGNDIFLRKARL.. 506
167 1.000e-77UniRef50_B6AG10 Phenylalanyl-tRNA synthetase, alpha subunit family protein n=2 Tax=Cryptosporidium TaxID=5806 RepID=B6AG10_CRYMR  ali  15  210..SWEGSDFKPYNFFAKGKRLIRSHIHPLTRSLLKFKRILLHMG--FEEMTNRWVESSFWNFDALFQPQQHPARDSN-----DTFFLNKPLELDEVHINRVRDIHQIGGGSVGLGYNWDIEEASKNILRTHTTAISARMIYYLAKSLTNFKRLFSIDRVFRNESIDSTHLAEFHQVEGLIIDRNLCLGDLLGTFSTFYEKIGISKLKFKPTFNPYTEPHEILKKWIEIGNSGMFRPEVLRSLGLPEGVIAWGLSLERPTMIHYNIPNIRDLFSYRANI....... 506
168 1.000e-77UniRef50_A0A023B7K5 Phenylalanyl-tRNA synthetase alpha subunit n=1 Tax=Gregarina niphandrodes TaxID=110365 RepID=A0A023B7K5_GRENI  ali  15  191.GEWRGAEFKPYNFNAAGIAPCFGSIHPLIKTMNMFRQILQQM--NFEEMTRRWVESSFWNFDALFQPQTHPVR-----DAHDTFFLKHPARLDGPYFERVKEIHESGDHESHGWFPWDAEESYKLILRTHTTAVTSRILRHLAMEYQKPDRFFSIDRVFRNETLDATHLAEFHQIEGIVASTTASLSELMGIIKTFFAKIGINDVEFKPAYNPYTEPSMELNKWTEIGNSGVFRPEMLRPMGLPEDVLGWGLSLERPTMINYNVKDIRELIGPKAKL....... 513
169 1.000e-77UniRef50_A0A1F6QV41 Uncharacterized protein n=1 Tax=Candidatus Micrarchaeota archaeon RBG_16_36_9 TaxID=1801632 RepID=A0A1F6QV41_9ARCH  ali  14  164.GEWKSGKFRKYDVNAPAPKIYPGKKQPYIQVMEMVKEKLIGMG--FQEMKGPLVETSFWNDDALFMPQDHPARG-----IHDVLFLKNPTKGTLPDENLVAKVKATHEESTGWGNAWSKEEASKLLMRSQGTAVSARTLYENKDN---PAKYFMIDRNFRYDIIDAQHLMEFDHCEGIVIGENMTFRHLLGFLKEIAELFGAEKIKFKPGYFPFTSPSVELLGWVEAGGAGMMRPEVLRPLGLEKQVLAWGLGIGRLAMIALGIADIRMLYSD--DLEWLRNK. 446
170 2.000e-77UniRef50_A0A2J6H0Y5 Phenylalanine--tRNA ligase subunit alpha n=1 Tax=Candidatus Woesearchaeota archaeon TaxID=2026803 RepID=A0A2J6H0Y5_9ARCH  ali  15  209.GKWKDVEFREYDVEVNVPKINVGRKHFVNKSIEYMKRIWLDLG--FTEMSGDMVQTIFWDLDTLFVPQDHPARQ-----MQDTFYIKDPKSGKLPLFKKVKEVHENGGDTGSTGWKWSKDEASQNMLRTHTTVLSAQYLEKKNGEYKMPAKFFSVNKVFRNEALDWKHLFEFNQVEGIVVDPNANLKHLKGYLKEFFGKMGFTDVRMRPAHFPYTEPSPRKKTWVELGGAGIFRPEVTKTLGVEVPVLAWGLGMERIIVEYFGFKDLRDLYNNKLNL....... 490
171 2.000e-77UniRef50_A0A2V2U3H4 Phenylalanine--tRNA ligase subunit alpha n=1 Tax=Thaumarchaeota archaeon TaxID=2026795 RepID=A0A2V2U3H4_9ARCH  ali  19  224.GKFNSVNLPPMDVQAPVRPLFPGRKHPIANLIDEISEIFVGLG--FTEIEGPITQSSFWNFDALFTPQDHPAR-----EIQDTFYL---AQIKQDKFATEDQVHKISSAHKDGWYEWNIDDAKGIVLRTHTTAVTIKYLADN---IPENARIFSIGRVFRNEKVSYKHLAEFTQIEGIVTGSRVSLQDLMGLQLEFYARLGIKKIKFWPTFFPYTEPSEKLEKWVELFGMGVFRPQVTKALGIHNPVLAWGGGLERIAMLRFGLTDVRDLYENKLWLRSI.... 499
172 2.000e-77UniRef50_T0ND13 Uncharacterized protein n=2 Tax=unclassified Thermoplasmatales (miscellaneous) TaxID=1919231 RepID=T0ND13_9EURY  ali  16  217.GSWKTIPFQRYDMNSRVERILGAGIHPISFLSRMVREIFLDLG--FTEMSGHYIEHAAWNMDALFIPQDHPAR-----DMQDTFYIDSSTDLEMEHPEVLEIFRKVHEGYTGWGYRWSSEKAAELLLRTHTTVSTIRYLYEHKQA---PQAVFSVEKVFRHESVDWKHLAELHQIEGAYYGKDASLASLKWLMKEFYRRLGFTELRFIPSYYPYTEPSMDVGKEMELGGSGVFRPEVTRPLGLKHPVIAWGLGLERLAMIYFGLDDIRDIYQSDLDLRSYRVKI 500
173 2.000e-77UniRef50_B1L7B9 Phenylalanine--tRNA ligase alpha subunit n=2 Tax=Candidatus Korarchaeota TaxID=51967 RepID=B1L7B9_KORCO  ali  17  205.GEWKKKKLKAYDVKASPPVVYPGKPHPYVYFLEEVREILIGMG--FTEVKSPIVESEFWNFDVLFQAQDHPAR-----EVHDSYKLAYPEAADLSYDELVNRIARTHEDSKGWGYKWSFEIARRLILRSQTTAASARSLANGLEV---PSKIFAIDKVFRPEAPDKTHAFEFHQCEGVVLAEGMNVRNLMGFLAEFSKNLGFKEVKFKPAYFPFTEPSVEKLGWIEIAGSGLFRPEMLIPLGYDYPALAWGIGIGRLAMIKLGLEDIRELHSQNLDY....... 486
174 2.000e-77UniRef50_A0A151BFX5 Phenylalanine--tRNA ligase alpha subunit n=4 Tax=unclassified Candidatus Bathyarchaeota TaxID=1700837 RepID=A0A151BFX5_9ARCH  ali  15  223.GKWREVEFQRYDVSAAPPTLHPGKKHFYLEFLEEVRDILVAMG--FEEVWGPYVETEFWNFDVLFQPQDHPAR-----EIHDSYQLKHPRFGRLPSRSLTLKVGKTHEDSKGWNYKWNPEVARRLVMRSQTTAVSVRQLSARQN---PPVKVFCLSRVFRPDVLDAKHSMEFHQCDGIMGDWGLNLKHLLGFFEEFCGALGFKEVKFRPGYFPFTEPSVETLGWVEVAGSGVFRPEVTLPLGASFPVLAWGAGIGRLAMVKLGIGDIRELHTRNLEL....... 500
175 5.000e-77UniRef50_A0A1J4UJY2 Phenylalanine--tRNA ligase alpha subunit n=13 Tax=unclassified Candidatus Micrarchaeota TaxID=1801634 RepID=A0A1J4UJY2_9ARCH  ali  16  182.GAWHEKNYAEYDLKTVAAEAYPGKKNAYKEFLNEVRMRLVGMG--FREVHGPLVELEFWNMDALFMAQDHPAR-----EIHDVFQVEDPCKGRKPLFERVRKAHEKGIGSTGWGYAWDPEVALRLVLRSQTTAVSARKLAEGIH---PPERLFCIGTVFRPDEIDWKHFIEFTQCEGIVADENTSFRELLGYLRNFVEVFGAKEIKFAPSYFPFTEPSVEMRGWAEVGGAGLFRPEMLEPLGVKVPVIAWGLGVDRLAMIRLGIDDIRDINAKDL......... 457
176 6.000e-77UniRef50_A0A256XPD6 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Thermofilum sp. ex4484_79 TaxID=2012527 RepID=A0A256XPD6_9CREN  ali  16  229.GEWRRIRIKKYDVTARPPVIYPGKKHPYLEFLEEVRRILIGMG--FEEVQGPLVELEFWNFDALFQAQDHPAR-----EIHDSYILKHPREALLEENEYVKRIRDTHEGSKGWGYKWDFSIARRLILRSQTTAVSVRTLYRRNR---PPLKVFTIDKVFRPETLDSKHSMEFHQVEGIVLAEGLNLKHLLGYLKQFALELGFKKIKFKPAYFPFTEPSVEKLGWIEILGAGLFRPEVLVPLGIDYPCLAWGIGIGRLAMIRLGIDDIRYLHSQ--DLNWLRN.. 512
177 6.000e-77UniRef50_A0A151BE09 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Candidatus Bathyarchaeota archaeon B24 TaxID=1779368 RepID=A0A151BE09_9ARCH  ali  17  211.GRWRSVVLKKYDVSLPSYRIPIGRLHFWRDILNHIRRVWVEMG--FKEMEGPILETCFWDYDALYVPQDHPAR-----DLQDTFYVKTPGRGRLPSPEFVDKIRQTHEDSIGWGYKWDVEEAKRTLLRTHTTAVSVRTLAAL-KEAELPAKFFSVGRVFRNEKPDRTHLCEFYQTEGIVVDENANMKHLVGYLKEFFKRLGFPEARFRPAYFPYTEPHPPTGRWIELGGAGIFRPEVVKPLGRDIPVLAWGLGPERMVMLNYGLKDIRELVMN--DLEMLR... 494
178 6.000e-77UniRef50_K6UCB8 Phenylalanyl-tRNA synthetase beta chain n=2 Tax=Aconoidasida TaxID=422676 RepID=K6UCB8_9APIC  ali  16  145..EYKKYDVKKYNFFSSGKKMNKGNTHLLIKQMRTFKDVFVSLG--FEEMTHNYVESSFWCFDALYIPQQHPSR-----DLQDTFF------IETPEFDNVKRVHSVGDGSFGWNYRWELKSTKKNVLRTHTTASSCRALFQLAKEYRKPKKYFSIDRVFRNENLDSTHLAEFHQVEGLIIDKNLGLSHLIGTLAAFYKYIGILKLRFKPTFNPYTEPHEESKKWLEVGNSGIFRPEMLRAMGFPPEVIAWGLSLERPTMIKYNIRNIRDLFGYRSVL....... 434
179 7.000e-77UniRef50_A0A256Y590 Uncharacterized protein n=3 Tax=Archaea TaxID=2157 RepID=A0A256Y590_9ARCH  ali  15  225.GLWREKNFRQYDISSPVPKIQRGRRHPVKEVCNLIKNIFIQMG--FKEMIGPWVETAFWCMDSMWIPQDHPAR-----DVQDTFFIG--KQGNLPLVQRVREAHENGGETGSTGYKWNEKKAKELILRTHSTATTFRMFGLHNINYD--CKYFYIANTFRNEAIDATHLPEFLQAEGFIMADDLTLSDLMGFVKEFYSKLGIKKIKFKPTYNPYTEPSMEAHYWDEKNNSGIFRPEALYPYGIKKTVIAWGMGVSRMASLLAKKNNLRQLIGAGCDIDWIQN.. 507
180 2.000e-76UniRef50_S2E3M1 Phenylalanyl-tRNA synthetase, alpha subunit n=47 Tax=Archaea TaxID=2157 RepID=S2E3M1_9ARCH  ali  18  195............DVESKVPGVFVARTHPLKDTIDEIREIFVTLG--FTEVIGEFTQPSFWNFDALFTPQDHPAR-----ELQDTFYLDG---ISAKKIGTVEQIRKISESHKKWRYYWDINEARKMVLRTHTTCVTIKHLAE---TKPDESRIFSLGRVFRNEKVSYKHLVEFNQIEGVVVGKNATLRDLMGIQREFYRRIGITKIKFWPTFFPYTEPSDRLGKWVELFGMGIFRPEVTKPLGITKPVLAWGGGIERIAMLKYGLDDVREFYNNNLWLRSV.... 459
181 4.000e-76UniRef50_P57693 Phenylalanine--tRNA ligase alpha subunit n=10 Tax=Archaea TaxID=2157 RepID=SYFA_THEAC  ali  18  206.GEWKTKNFRKYDLNSPSSVIRSSLKHPMTYLIEEIREIFLNMG--FTEMGGHYIESTLWDMDSLFIPQDHPAR-----DMQDTFYVEDSFDIDHPISKKIRKIHEKGDGYSGWGYRWSDAEARKLVLRTHTTVSTARYLYENN---EPPQAIFSVEKVFRHESVDWKHLAEFYQIEGAVYSKDVSVSTLKWILRDFYAKLGFNDIKLIPSYYPYTEPVRVNGKEVELGGSGLFRPEVLKILGLKAPVMAWGMGLERLAMMYYGLTDVRDLYNTDFFLSSFRFNI 488
182 4.000e-76UniRef50_A0A2G9P8L5 Phenylalanine--tRNA ligase subunit alpha n=1 Tax=archaeon CG10_big_fil_rev_8_21_14_0_10_43_11 TaxID=1975556 RepID=A0A2G9P8L5_9ARC  ali  19  217.......LFREYDIHVTAPRVYGGRKHVLREIEKRVKEIFIEMG--FEEMRSNFVDTAFWNFDVMFFPQDHPGR-----EIMDTYYLDFPKEGNIPLAKKIKDIHETGGSTGSKGYEWSERVANQLLLRAHTTQTSFRYLAKGR---APPYKYFSVDRVFRNETLDATHLNEFHQIEGFVVAKGLTLKNLCGMFKEFYQKIGVNKVKFKPTYNPYTEPSMEIKKWLELGNSGMFRPETLKPLGITVPVIAWGLALERLVPFQYKVDDIRQVLGHFVDIDSIRN.. 493
183 1.000e-75UniRef50_A0A075HS04 Phenylalanyl-tRNA synthetase subunit alpha (FARSA, pheS) n=17 Tax=Thaumarchaeota TaxID=651137 RepID=A0A075HS04_9ARCH  ali  17  198......EKLDTGDVEADVPHVHAARIHPLKDTINEIRETFVHLG--FTEITGNLSQSSFWNFDALFTPQDHPAR-----ELQDTFYLKNAKQLATSTIKNVSNAHKKG-----WRYYWDIQEAKKMVLRTHTTCVTIKYLADKK---PDEARIFSLGRVFRNEKVSYKHLVEFNQVEGIVVGKHITLRDLMGIQKEFYRKIGLTKVKFWPTFFPYTEPSERLGKWIELFGMGIFRPEVTKPLGITKPVLAWGGGIERIAMLKFGLDDVREFYNNNL......... 464
184 1.000e-75UniRef50_X1XK36 Uncharacterized protein n=3 Tax=Bilateria TaxID=33213 RepID=X1XK36_ACYPI  ali  15  1............................................MGFTEMTNNFVESLFWNFDALFQPQQHPARDS-----HDTFFLDNPQ---TSENFPQEYLNKVKIVHSKGGYDWSLDEAKKDVLRTHTTDVSARMLYGLAKDF-KPTKYFSIDRVFQNETLDATHLAEFQQVEGVIADYNLTLGDLIGVLHMFFERLGMTEIKFKPAYNPYTEPS------MEIFNSGMFRPEMLLPMGLKVNVIAWGLSLERPTMIKYGINNIRDLVGPRVNLQMVQDN. 239
185 1.000e-75UniRef50_A0A1Q9PBA8 Phenylalanine--tRNA ligase alpha subunit n=4 Tax=Candidatus Thorarchaeota TaxID=1706441 RepID=A0A1Q9PBA8_9ARCH  ali  15  216.GAWKEESFRPYNVGIVPAYANYGKKHPYAEFNDWLREIMVGLG--FTEWFGPYVETEFWGHDTLFVPQDHVSR-----EVQDQFRVASPYDTDRKYFKAVRAVHENGGDTGSKGWDWSEEIATRLCLRPHTTPVSMRYLYEHR---EGPQKMFIIDRNFRSETLSATHAQEFNQCEGIIMDKGLSLRDLLGYLTSICKAVGIEKLKFKPGQFPFTEPSVEKLGWIELGGSGIFRPEVTQPLGIKEPVLAWGIGSGRLYMAAMGINDIRDLFSRDLN........ 493
186 1.000e-75UniRef50_M0DT56 Phenylalanyl-tRNA ligase subunit alpha (Fragment) n=5 Tax=Archaea TaxID=2157 RepID=M0DT56_9EURY  ali  15  9.GEWRDAEFAEYNVEAEAETARGGRKHVLRRTADRVKDVLVGMG--FQEMEGPHADADFWINDCLFMPQDHPARTHWDRFALDV----DPMEIPDELIDRVESAHRDGWGEDGDGYHWSEDFAREVALRGHTTSLSMRYLSGIAAELEPPQRYFSVEKVYRNDTLDPTHLLEFFQIEGWVMAEDLSVRDLMGTFEEFYRQFGITDIKFKPHYNPYTEPHPETGEEIEIGNSGVFREEVTGPLGVECDVMAWGLALERLAMLTTGAEDIRDLHGTLADIDFLRN.. 295
187 3.000e-75UniRef50_A0A2D6NDL1 Phenylalanine--tRNA ligase subunit alpha n=1 Tax=Candidatus Woesearchaeota archaeon TaxID=2026803 RepID=A0A2D6NDL1_9ARCH  ali  15  220.GTWKGKKFRSYDIKINVPKIFGGKRQPYSEFIEQVREKVVSMG--FVEMNGPIIELELYNFDALYQPQGHPARTWTA-----TYKIKEPKAGLLPILNAIKSAHETGGGSTGWGYNWNEKIASRLVPRAHDTAISPRFLS---KGVKIPGKYFSLVRCFRPDVIDSTHGVEFNQLGGFIVGKDLSFRNLLGLLKDFIEMTGAKEIKFLPDYFPFTEPISAKHPWMEVAGAGIFRPEMTEPLGIKEPVIAWGFGIDRLAMLKLEIEDIRDLFSQKLDF....... 498
188 3.000e-75UniRef50_A0A061HUU5 Phenylalanyl-tRNA synthetase alpha chain-like protein n=6 Tax=Eukaryota TaxID=2759 RepID=A0A061HUU5_CRIGR  ali  18  1............................................MGFTEMPDNFIENS-WNVDGLFQPQQHPACDQ-----HDAFFLKDPAELQLPM----DYVQRVKGSYGSQGYTWKLEEARKNLLRTHSTAASARTLYSLAQKKPFPAKYFSIDRVFRNETLDATHLAEFHQIEGVIANHGLTLGHLMGVLREFFTKLGITQLLFKPAYNPYTQPSMELKKWVEVGSSEVFRPEMLLPMGLPKNVIAWGLSLERPTMIKYGINNIRELVGNKVNTQMVY... 247
189 5.000e-75UniRef50_A0A1Q9P4E2 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Candidatus Heimdallarchaeota archaeon AB_125 TaxID=1841596 RepID=A0A1Q9P4E2_9ARC  ali  18  212.GSWRDTKLREYNLKASPPIFYGGRKQPYAAFLDDVKQKLCALG--FKEMRGPAVELEFWNFDALFQAQDHSAR-----EWSDVYQVSEPKHGKLPEADYVENVKKAHEGSKGWRYKWNPMKSARLVLRAHGTSVSARTLV----DLEVPSKYFSISRCYRPDTVDATHLSEFTQVEGIVVDPSITFRDLLGILKAFAVDIANENFKFKPDYYPFTEPSVELNGWIEFGGAGIFRPEVTKPFGIEAPVIAWGLGIERLFMVKHGVADIRELFSHKSWLRTAK... 494
190 5.000e-75UniRef50_A0A1Q7PZ44 Phenylalanine--tRNA ligase alpha subunit n=13 Tax=Archaea TaxID=2157 RepID=A0A1Q7PZ44_9ARCH  ali  15  216.GEWEKVKLRSYNVSSAVPRTFPGKYHPYLRFLRMVKRKLVALG--FREAVGPLVETAFINCDCLYMPQDHPAR-----EIHDLYYVKDPSRASLELVDRVAQTHENGWKTGSWRYKFSRDEASKLILRSHGTALSVRTMLSKDLQIPG--KYFAVARCFRPDMLDKTHLTEFNQAEGIILDPSLNLRNLLGILEMFAKEVGADKVRFKPDYFPFTEPSVELQGWMEFGGSGIFRPEVTEPLGVKVPVLAWGLGIDRLYMMSRKIQDIRQLFTS--DLEWIR... 498
191 6.000e-75UniRef50_A0A1Q9C6S8 Putative phenylalanine--tRNA ligase alpha subunit n=1 Tax=Symbiodinium microadriaticum TaxID=2951 RepID=A0A1Q9C6S8_SYMMI  ali  16  784.GTWSSTTFKPFNLTNVSGVPTGGHLHPLNKVKTEMRQILMQMG--FEEMTNQWVESSFWNFDALFQPQQHPAR-----DAHDTFFMEEPSRADIPYLAKVKEMHEKGGGSIGWRYDWSEDEAKKTLLRTHTTAVSARTLYKLGEEYRKPKKYFSIDRVFRNETLDATHLAEFHQIEGFVADRNIGLPQLIGTLRDFFSRIGISKLRFKPAYNPYTEPHPILKKWIEVGNSGVFRPEMLLPMGLDVSVIAWGIGCESVLMLR....................... 1058
192 1.000e-74UniRef50_A0A2T7IBJ6 Uncharacterized protein n=1 Tax=Theileria orientalis TaxID=68886 RepID=A0A2T7IBJ6_THEOR  ali  16 1066.GKWQEAEFKKYNFFSSGKRVNCGDLHPLVHSMYEFRRILTSMG--FQELTSRYLESSFWCFDAMYIPQQHPAR-----DTQDTFFLRDPERVDVKFFDPVEDVRAAHGNASKWQYEWSLEESMRTVLRTHVTPCTARKLKQIAEDHQKPCRYFAIDKVFRNEATDSTHLCEFHQVEGFVVGFDLGLADLIGIMETFYGAIGINPLKFKPAYNPYTEPHKLLNTWIEVGNSGIFRPEMLLPMGLPENVIAWGLSLERPTMVNSNIRNIRDLIG............ 1352
193 1.000e-74UniRef50_A0A2N1R393 Phenylalanine--tRNA ligase (Fragment) n=2 Tax=Bacteria TaxID=2 RepID=A0A2N1R393_9SPIR  ali  14  28.GSWKGAAFRSYNIMSRPARLIPGRRNPYVQFLESVKDKLVSLG--FEEFDGGLVETEFWNGDALFMPQFHSAR-----DIHDVYYLAEPTKIEEPYLTRVAATHENGGATGSWRYGFDREFTKRLVLRSQGTVLSARQL----PRAAVPGKYFGIARCFRYDKVDATHLSDFYQTEGIVLGEDVNLRTLLGFLEMFAVEVGAKEVKYVPGYFPFTEPSVEVHGWFELGGAGIFRPEVTEPLGVSVPVLAWGIGIDRMALMALGLNDLRELFSY--DIENVRLR. 309
194 2.000e-74UniRef50_A0A2D6RJE2 Phenylalanine--tRNA ligase n=17 Tax=cellular organisms TaxID=131567 RepID=A0A2D6RJE2_9GAMM  ali  13  215..WNRGKKFRKYDISSQLPQIYGGRKHFVNQAIEYGKQVWLDLG--FKEMSGNKVQTSFWNFDALFTAQDHPVR-----EMQDTFFIKG-IKGSLP---STDIVKKVKQAHESGVYKWSEDEAKSLCLRTHTTCLSARTLASINPKTDLPAKFFAIGKNFRNETVDWSHGFEFNQSEGIVIDKDANLRHLIGYLKEFARKMGFEDIRIQPAYFPYVEPHPEKKQWIEVLAAGILRPEVVIPLGEDIPVLAWGPGFDRLMMLAYEMDDMRKLYSNDLDLRNKR... 499
195 4.000e-74UniRef50_A8BZP3 Phenylalanyl-tRNA synthetase alpha chain n=6 Tax=Giardia intestinalis TaxID=5741 RepID=A8BZP3_GIAIC  ali  14  239........IKPLNFESLGSVPHAGAFHPLMEMRRLFVEAFVGMG--FEQMKTPLVESSFWNFDALFQPQSHPARDS-----QDTFFVGGYSQLDAELVERIRTAHESGGEAMRYRYVWKVSEALRNVLRTHTTAVSARVLYEIGQHYQKPRRFFSIDRVYRNETLDATHLCEFNQVEGMVIDRNLTLGNLIATLRAFFARLGMTQLKFKATYNPYTAPHPQLKRWVEVGNSGLFRPEVLLPLGLDVQVLAWGLSLERPTMIVHEISNIRDLIGPSTSLELIR... 529
196 4.000e-74UniRef50_A0A1J1J0D7 CLUMA_CG019055, isoform A n=1 Tax=Clunio marinus TaxID=568069 RepID=A0A1J1J0D7_9DIPT  ali  15  198.GAWKNLKFKDYNFDAMGAQPASGHLHPLLKVRSEVADIFVQMG--FQEMTNNYVESSFWNFDALFQPQQHPAR-----DAQDTFFITNPQKFPTEYLQRVKKSHEEGG-NGSIGYRYDWSLAQKNVLRTHTTAVSARMLYKLANQEGGPTKYFSIDKVFRNETLDATHLAEFHQVEGVIAGVDITLGDLMGIIGGFFAKMGLTDIEFKPAYNPYTEPSME................................................................ 417
197 5.000e-74UniRef50_A0A2D6WWP8 Phenylalanine--tRNA ligase subunit alpha n=1 Tax=archaeon TaxID=1906665 RepID=A0A2D6WWP8_9ARCH  ali  14  153.GLWKNATLKPYNVTATGKRIYPGKKHPYRAFLEDTKLKLVEMG--FQEMTGPNIEMEFWNFDALYQAQNHPSRDWTE-----TYRMFYPKEKMEKIIDNVAKTHENGGGSTGWKYKWERAQAMQLMPRAHDTAISPRYLSEISGEIEIPGKYFSLVRCYRPDVIDATHGVEFNQFGGIIVDKNLSFRDLLGLLKDAVMEIDAEDVKFYPDYYPFTEPISAKHPWVELAGAGIFREEVTKPLGIDETVLAWGFGIDRLAMFKLGITDIRDLFSRDLAL....... 437
198 5.000e-74UniRef50_A0A150J1M6 Phenylalanine--tRNA ligase alpha subunit n=10 Tax=Euryarchaeota TaxID=28890 RepID=A0A150J1M6_9EURY  ali  16  208...WRNVTLKRFDVSSDVKVVYPSRKHFVNQAIEYIRKIWLEMG--FREMSGPMIDTSFWVFDALFQPQDHPAR-----DMQDTFFVESFGQIDPKLSDKICAMHEHGGDINSWGYNWDKKISEEYVLRTHTTSLSVRTLSTLKPE-DLPAKFFSVGKVFRNEKLDWKHLFEFYQTDGIVVDEDANFKHLLGYLKRFLNKMGHSKIRFRPAYFPYTEPSIEKGEWVELLGAGIFRPEVVVPLGKDVPVLAWGPGFGRLIMEYYGLTDIRQKYMNDLDM....... 486
199 6.000e-74UniRef50_A0A1J5X7V8 Phenylalanyl-tRNA synthetase alpha subunit n=1 Tax=Amphiamblys sp. WSBS2006 TaxID=1866961 RepID=A0A1J5X7V8_9MICR  ali  16  190..EWEKLSFKEYNYDALGKRERKGGLAPLMKMRDEFREIFLQMG--FTEMTDKYIETSFWNFDTLFQPQSHPSR-----DLQDTFFVSSCAESRIPLLATTRRAHEEGIEGSEGRYTWKLSETQKCILRTHTTAVTSRTLHEHSKQSPRPGRYFSIDRVFRNETLDATHLAEFFQVEGVIVDRNIGVAELISVLSSFFGRLGMEDLRFKPAFNPYTEPSMELKKHVEIGNSGLFRPEMLQAYGFESDVIAWGLSLERPAMIKFGVDDIRKLVGS........... 469
200 6.000e-74UniRef50_UPI000781E3E4 phenylalanine--tRNA ligase subunit alpha n=1 Tax=Treponema endosymbiont of Eucomonympha sp. TaxID=1580831 RepID=UPI000781E3E4  ali  14  233.GEWKDGAFRRYNISVPPARIVPGRTNPYADFLEGVKDKLCSLG--FEEFDGPLVETEFWNSDALFMPQFHPAR-----DIHDVYSVKNPERIDEPFLSNVAAAHENGGDTGSWGYAFDRDFTRRLILRSQGTALSA----HRLAAAKVPGKYFGVVRCFRYDKVDATHLSDFYQTEGIVLGEEVNLRTLLGFLEMFAVEIGAADVKYVPGYFPFTEPSVEVHGWFELGGSGIFRPEVTKPMGVNVPVIAWGIGIDRMALMALGLNDLRELFSTDI......... 508
201 7.000e-74UniRef50_A0A1N6LXQ1 Phenylalanyl-tRNA synthetase alpha chain n=1 Tax=Babesia microti (strain RI) TaxID=1133968 RepID=A0A1N6LXQ1_BABMR  ali  16  205.GTWMEYEIKPYNYYSSGKRMLMGQIHPISKCIEEFSYILTCMG--FEELPSCYVTSSFWSFDALYMPQQHPSRDQ-----QDTFFTKDPESVPKDYLENVKKVHGNGKDSTGWRYQWDIKESEKLIMRTHLTSGTSRLLKKMAEEIKQPIRYFIIEKVFRNESIDSTHLAEFHQMEGIVFGENQSLSHLIGILDMFYKKIGLTEIKYKPAYNPYTEPHPKLNKWIEVGNSGIFRPEMLLPMGLPSNVLGWGLSIERPTMIKYDIHNIRDLVG............ 491
202 7.000e-74UniRef50_A0A1R4A6Q2 Phenylalanyl-tRNA synthetase subunit alpha n=4 Tax=Thermoplasmatales TaxID=2301 RepID=A0A1R4A6Q2_9EURY  ali  17  208.GTWKNRRFRTYDLNMPGKVTPRHGLHPLTVLINDVREIFLSMG--FEELKDPYVEFTGWNMDALFIPQDHPAR-----DMQDTFFLSTKKKVE-PDEDDRLLFRRAGKIHEGWGYKWRPEEAEKLMLRTHTTASTMRSL----HRTPKMEKVFSVDKVFRHESVDWKHLAEFHQVEGAIHARNANLGTLKWYLRKFYSALGFDHIELIPSYYPYTEPVQIDGKELEMGGSGLIRPEVTKALGLEYNVIAWGLGLERLALLYYGLNDLRKLYESDLWLQEYRLKL 493
203 1.000e-73UniRef50_UPI00096A5873 phenylalanine--tRNA ligase subunit alpha n=1 Tax=Natronomonas sp. CBA1134 TaxID=1906246 RepID=UPI00096A5873  ali  15  211.GEWEDVEFAEYNVEADAEPVTGGKTHILRQTAESVKDTLVGMG--FQEMQGPHADADFWINDALFMPQDHPARTHWDRFTLDT----DPM-TDLPLVGRVEDAHRNGVGPDGEGYHWSREFAEEVALRGHTTSLSMRYLSEEIGDLEPPQRFFSVEKVYRNDTLDATHLLEFFQIEGWVMAEDLSVRDLMGTFEEFYAQFGITDIEFKPHYNPYTEPHPTTGEIVEIGNSGIFREEVLSPLGVECDVMAWGLALERLLMLMYGFEDIRDVHGTLCDLDLLRN.. 497
204 1.000e-73UniRef50_A0A2E3J4G5 Phenylalanine--tRNA ligase n=2 Tax=Gemmatimonadetes bacterium TaxID=2026742 RepID=A0A2E3J4G5_9BACT  ali  15  253.GEWKGVDFRRYDLSIKPPRITIGRHHPYRAYLDSTRRKLLALG--FEEMKGPLVETEFWNMDALYMPQFHAARN-----IHDAYYVKEPDRVEEPYFSNVAEAHSTGGDTGSWRYEFNPERSRQLLLRSQGTALSARTLASGPNI---PGKYFGIARCFRQDDVDATHSADFFQVEGIVLGESINFRSLLGLLKLFALEIAQEEVRYVPDYFPFTEPSVELQGWIELGGAGLFRPELTRPLGVNVPVIAWGLGVDRMAMVALGIDDIRDLFSS--DLDFVRNE. 535
205 1.000e-73UniRef50_A0A2H9QAV4 Uncharacterized protein n=4 Tax=unclassified Candidatus Micrarchaeota TaxID=1801634 RepID=A0A2H9QAV4_9ARCH  ali  17  228..AWKDVEIRGYNVLAPVEVPFAAKRHIVGRAIRRIKDIFLSLG--FEEMGGSLIEAGFWNFDVLFQPQDHPAR-----ELADTFYLD--KAVKLGSGGERALIKRVKEVHENWGTPWLEAEASKCVLRTHTTAVSARYLAKLAGSKIK-KKYFSVGKVYRNESIDFKHLAEFHQIEGIIVDENATFADLLGTLKQFYSRLGFEKIRFMPSYFPYTEPSEDRKEWLELGGAGIFRPEVSKPLCGRYPVLAFGLSMERPLMLKLGISDIRILYENNMTL....... 503
206 1.000e-73UniRef50_A0A2R7Y4K7 Uncharacterized protein n=1 Tax=Desulfurococcaceae archaeon NZ3(B) TaxID=1973259 RepID=A0A2R7Y4K7_9CREN  ali  12  219.GSWRNVILKEFDLSIDVPEKPIKKKHPYVQFMNYVKEVLIGMG--FEEVKGPFLETALWNFDVLFVPQYHPARR-----VSDVFYVSN---VSLNVAE-VDVLNKVKEIHESWRYSWSVEEALKTVLRTHTTPVSMRTIYAKK---GGEYRVFSFDRVFRPDTPDPTHLMEFHQLEGIIVGKSVTFKHLLGFFKEFARYLGMSDVKFKPAYFPFTEPSVEKIGWVEVFPGGMFRPEVTEAVGLPPEVAAWGIGIDRLAMIVLGLDDIRDLYTHDLDV....... 490
207 1.000e-73UniRef50_A2BL75 Phenylalanine--tRNA ligase alpha subunit n=5 Tax=Pyrodictiaceae TaxID=2307 RepID=A2BL75_HYPBU  ali  16  208.GRWRTVRLRRYNVAAEPPRRRLGRLNFFVEFIEYLRDVMKEMG--FQEVDDAPVELEFWNYDVLYQPQYHPARSPT-----DTFYLSNPSRGELPS-ELTPRVAEAHEGSRGWRYRWSQELAARLILRSHTTAVSARVLASKPR---PPFRFFTIGRVYRVETIDPRHLPEFHQLDGIASEDGVSLRWLLGLLAEFLERIGIREYKFRPAYFPFTEPSVEADQWLEVLGAGLFRPEMLAALGIDYPVAAWGMGIERLAMALYDLTDIRQLYSHDV......... 480
208 1.000e-73UniRef50_B0R806 Phenylalanine--tRNA ligase alpha subunit n=257 Tax=Archaea TaxID=2157 RepID=SYFA_HALS3  ali  15  210.GEWADVEFADYNVAADAADHTPGKTHVLRQAAERVTDVLVGMG--FQEMAGPHVDADFYINDCLFMPQDHPARNHW-----DRFALSNPARIELPLVERVERAHREGAGDDGDGYHWDEDFARALALRGHTTSLTARHLAGLADDVEAPARYFSVEKAYRNDTLDATHLLEFFQIEGWVLADDLSVRDLMGTFREFYSQFGIHDLQFKPTYNPYTEPHPETGELIEIGNSGIFRPEMLDPLDVDGDVMAWGLALERLLMLMTGFEDIRDVHGTLCDVGFLRN.. 497
209 2.000e-73UniRef50_A0A0Q1B973 Phenylalanine--tRNA ligase n=1 Tax=Desulfuromonas sp. SDB TaxID=1735325 RepID=A0A0Q1B973_9DELT  ali  14  226..KWENKKFRKYNIDLAPKPILSGRLHPYGRFLDLVRSKLTSMG--FMEMRGPVVESEFYNSDLLYMPQYHPAR-----DIHDIYLVKDPSKARLPILNNVAQAHRDGGGSKGWGYDFDVDKTQQLILRSQGTAISARTLASKPHI---PGKYFAIARCFRYDQVDATHAPDFFQIEGIVIEEKINFCHLLGLLSTFAKKLGADNIKFVPGYFPFTEPSVEAHGWIELGGAGIFRPEITESVNILCPVIAWGLGLDRMAMNALKINDIRELFT--IDLEKIR... 505
210 3.000e-73UniRef50_V4M1C2 Phenylalanine--tRNA ligase alpha subunit n=5 Tax=Acidilobus TaxID=105850 RepID=V4M1C2_9CREN  ali  18  209.GEWKGSIIKPYDVTAEPPRLLPARKHPLAVFIEELKDIMVELG--FVEVEGPLIEVELFNFDALFQPQDHPAR-----EIQDTLWP------DLPISVYGELVERVKETHEKWGYPWNNEIASRRILRSQTTAVSIRVLSGRPK---PPIRFFTIDKVFRADPVDATHLSDFHQLDGIMGWPGYSFRDLLGFLTQFARKLGL-NIKFKPAYFPFTEPSVEGDSLVEVFGAGLFRPEVLRIAGVDYPVGAWGMGVERLALAKYGLKDVRDLYSKD.......... 474
211 3.000e-73UniRef50_A0A2D6EVK5 Phenylalanine--tRNA ligase subunit alpha n=1 Tax=Candidatus Woesearchaeota archaeon TaxID=2026803 RepID=A0A2D6EVK5_9ARCH  ali  15  196.GSWKGKNFRRYDLTSVAPRLHGGKLQPYKKFLDSVRKQFISLG--FQEMDGPIVESDFWDMDALYMPQFHSAR-----DIHEGYYVKN-----APLADDSGVMKRVKEAHEKGVKGWQYDFDIDHSLRTQGTACSARMLASKDLKIPG--KYFAMSRCFRYDVIDATHLPDFNQVEGIVVDKNLTLRHMIGLLKQFAKTFATEEVKVVPGYFPFTEPSVELLGWIELGGAGLFRPELVQPLAKDVQVLAWGIGVDRLGMFNLGIKDIRNLFSKDLYLRKAKV.. 480
212 5.000e-73UniRef50_T2K094 Lysine--tRNA ligase n=3 Tax=cellular organisms TaxID=131567 RepID=T2K094_CROWT  ali  14  118....LKKLTDTGDIIGVKGSIKRTEKGELSVKVKEYEILTKSLPDKWHGLTDTEKRYRQRYVDLIVNPQVRRRRAQITASIRRYLDNQGFIEIETPVLQS-----EAGGAEARPFITYHNTLEMDLYLRIATELHLKRLI------VGGFEKVFEMGRIFRNEGVSTKHNPEFTSIELYQAYADYN--DMMELTEAIITT-AAEEVLGTLNITYQGEQIDLSTPWRRVTMNDI----VKEKSGLDFEAF.................................... 350
213 5.000e-73UniRef50_E0SS25 Phenylalanyl-tRNA synthetase, alpha subunit n=1 Tax=Ignisphaera aggregans (strain DSM 17230 / JCM 13409 / AQ1.S1) TaxID=583356 RepID=  ali  15  196.GMWRKAVLKPYNVEANPPVVYPGKKHFFKEFIDMIREIMERLG--FVEVRDDYVIPEIWNFDILFQAQDHPSR-----DIHDILVVDGYANLDSDIVERTRNVHEFGGSCGSIGYSWSLEKASRLILRSHTTAVTARFLS---IYREPPVRLYTIARVFRRDNPDARHSPEFTNFDGVIMEKDFSFRKLLGLLSQILRYMGIEKYRFKPAYFPFTEPSVEGYGWIEVFGAGMFRPEVLEILGVNSPVGAWGMGVERLAMVVYGIDDIRLLFSK--DIEFIR... 474
214 8.000e-73UniRef50_Q8DMA9 Lysine--tRNA ligase n=139 Tax=cellular organisms TaxID=131567 RepID=SYK_THEEB  ali  15  100MGEAAFADLDVGDILGAVGTLKRTEKGELSVVVESYTMLTKSLPDKWHGLTDVEKRYRQRYVDLIVNPQVRRKRALITAAIRRYLNEQGFIEIETPVLQ-----VEAGGAEARPFITYHNTLEMQLYLRIATELHLKRLI------VGGFEKVYELGRIFRNEGISTKHNPEFTSIEVYQAYADYN--DMMTLTEAIITT-GAMEVLGTLKITYQGETIDLTPPWRRVTM----HDAVLAATGIDFRQLG-DLTAAKIAAQKVGVKDLDT............... 360
215 8.000e-73UniRef50_A0A0Q2M0Z3 Phenylalanine--tRNA ligase alpha subunit n=4 Tax=Thermococcus TaxID=2263 RepID=A0A0Q2M0Z3_9EURY  ali  14  213.GKWREVEFKRFNIHAPVRKLHPGKKQPYRAFLDKLRRRLIEMG--FIEMTDSLIETQFWNFDALFQPQNHPARDWT-----DTYQLKYPKSGHLPAEELVARVKAAHEGSRGWGYVWSPKRAMLLMPRAHGTALDAR---QLAKGVEIPGKYFTIQRVFRPDVLDRTHLIEFNQIDGFVVGEDLTFRHLLGILKRFAVEIGAKKVKFLPDYYPFTEPSVQMSGWVEFGGAGIFREEMTKALGVDVPVIAWGIGIDRLAMFKLGIDDIRYLFSYDLWLREARL.. 497
216 9.000e-73UniRef50_A0A2D6P9D4 Phenylalanine--tRNA ligase subunit alpha n=1 Tax=Candidatus Woesearchaeota archaeon TaxID=2026803 RepID=A0A2D6P9D4_9ARCH  ali  16  218..KWESQRFRRYDVETPVPRLHIGKTQPYLDFLDELKLKLMQLG--FEEMEGPIIDTEFYNFDALYQPQNHPARTWT-----DVYKLKYPKEGKLKLVERVKNSHETGGDITGWNYKWSEKIAKSLMPRSHTTSVSARKMSSNPKI---PGKYFTIGRVFRPDVLDATHLIEFNQLEGIVIGDELSFKNLLGILKKFAEEVGAKKIRFLPDYYPFTEPSEKLNKWVEFGGAGIFRPELTHPLGITQPVIAWGLGVDRMFQQRIKSKDIRELFSDNLWLREVK... 501
217 9.000e-73UniRef50_Q76KA8 Phenylalanine--tRNA ligase alpha subunit n=44 Tax=Archaea TaxID=2157 RepID=SYFA_THEKO  ali  14  214.GKWREVEFRKFDIKAPVRRIYPGKKQPYRAFLDKIRRRLIEMG--FIEMTDSLIETQFWNFDALFQPQNHPAREWT-----DTYQLKYPKVGSLPDEERVKAAHEHGGDTGSWGYVWSPERAMLLMPRAHGTALDAR---QLAKGVEIPGKYFTIQRVFRPDVLDRTHLIEFNQIDGFVVGEDLNFRHLLGILKRFAVEIGAKKVKFLPDYYPFTEPSVQMSGWVEFGGAGIFREEMTKALGIDVPVIAWGIGIDRLAMFKLGIDDIRYLFSYDLWLREARL.. 499
218 9.000e-73UniRef50_A0A2G9PKZ0 Phenylalanine--tRNA ligase alpha subunit n=3 Tax=Candidatus Woesearchaeota TaxID=1801616 RepID=A0A2G9PKZ0_9ARCH  ali  14  262.GSWKKKGFRAFDVKAKLPEIYGGRKQHYRAFLDEVKQRFAAMG--FIEMTGPIVESEFWDMDVLFMPQFHSAR-----DIHDAYYVKGPKYADLPLVKRVAASHEHGEGTASRGWRYRFDLKRRLLLRTQGTALSARTLASKELKIPG--RYFAIARCFRYDVIDATHNCDFFQTEGIVVEEGLTIKHLFGLLEMFAREFAADEIKITPAYFPFTEPHPELG-WIELGGSGIFRPEMTKPLGIEQPVIAWGIGIDRIAMFRLGITDIRTLFSNDL......... 539
219 9.000e-73UniRef50_A0A2G6LY03 Phenylalanine--tRNA ligase n=1 Tax=Candidatus Fermentibacteria bacterium TaxID=2044591 RepID=A0A2G6LY03_9BACT  ali  16  239.GSWKNGQFRRYQVDIPPARIHTGRLHPYGIFLNTVRSKLLAMG--FREMKGSLAESEFWNNDALFMPQFHPAR-----DIHDAYYLEDGVSVSPPEEEAVRKAHEDGGETGGRGWEYTFDWKRSLILRSQGTALSARRLASEPNI---PGKYFGIAKCFRYDQVDATHLPDFYQVEGIVLGEKINLRHLLGLLKLFSEEVGATEYKFVPAYFPFTEPSVEIHGWMEMGGAGLFRKEVCLPLGVDVPVIAWGLGLDRMALMALGLSDIRDLVTPDLKLRSIRIR. 524
220 9.000e-73UniRef50_T1BJI9 Phenylalanyl-tRNA synthetase, class IIc, alpha subunit n=1 Tax=mine drainage metagenome TaxID=410659 RepID=T1BJI9_9ZZZZ  ali  16  90.GKWKDMRFRKYDLNLQGQHVDRIGRHPLRYLIKEIREIFLEMG--FTEMTGNYIESAGWNMDSLFIPQDHPAR-----EMQDTFYLYNFST------EELALFRKFGEVHVNGVRSWNIEESKKMVLRTHTTPNTIRYLSRIKAKEIG---LFSVEKVFRHESVDWKHLAEFHQIEGAVHSKSASLATLKWLMRYFYERLGFSEIRLVPSYYPYTEPSMDVGKDVEMGGSGIFRPEVTKPLGLKYPVMAWGLGLERLALIYYGLEDLRELYQSDIWLRNFKIKI 375
221 1.000e-72UniRef50_H9ZZU1 Phenylalanine--tRNA ligase alpha subunit n=3 Tax=Fervidicoccus TaxID=685950 RepID=H9ZZU1_FERFK  ali  15  208.GKWREVKFKEYNVEAEPPKVYPGIQHFYSKFIEKIKMILLELG--FKEVYGSIIEQEFWNFDVLFQAQDHPSR-----EIHDTFWIKEVKEIRKELIEKTREVHEYGGKTGSIGYKWDQEVAKRLILRTQTTVVSGRTLS---LSPEAPFRFFTIGKVFRPDVIDARHLPEFYQFDAIISEKDMSFSKFLGMLKLFFKKMGFEELIFKPAYFPFTEPSVEGLGYVEVFGAGMFRPEVLEIFDIKHPVGAWGMGLDRLAMALLNLSDIRMLYRNLENLRNSYSN. 492
222 1.000e-72UniRef50_J4DAE8 Phenylalanyl-tRNA synthetase n=2 Tax=Theileria orientalis TaxID=68886 RepID=J4DAE8_THEOR  ali  17  222.GKWQEAEFKKYNFFSSGKRVNAGDLHPLVHSMYEFRRILTSMG--FQELTSRYLESSFWCFDAMYIPQQHPAR-----DTQDTFFLRDPERVDVKFFDPVEDVRAAHGNAAKWQYEWSLEESMRTVLRTHVTPCTARKLKQHQKGIPQPCRYFAIDKVFRNEATDSTHLCEFHQVEGFVVGFDLGLADLIGIMETFYGAIGISPLKFKPAYNPYTEPHKLLNTWIEVGNSGIFRPEMLLPMGLDLTVIAWGLSLERPTMVNSNIRNIRDLIG............ 518
223 2.000e-72UniRef50_A0A2E8S8F6 Uncharacterized protein n=1 Tax=Euryarchaeota archaeon TaxID=2026739 RepID=A0A2E8S8F6_9EURY  ali  21  4...............................LIERIRSIFLEMG--FSEMVENYVQPAGWNMDALFIPQDHPAR-----EMQDTFYLTNPEMIPIPLTSTWKSIHETGGETESVGWTFDESVSKKGLLRTHTTVNTIQYLHQKPTE---PCRVFAVDRVFRKESIDRTHLPEFHQIEGIIMEEGANLPMLVNTLKTFYAKMGIDEVRVRPAYFPYTEPVKWKGKWLELGGAGIFRPEVTEPLGCKWPVCAWGMGLERLAMLVLGLDDIRQLYISDL......... 247
224 3.000e-72UniRef50_H0EDX1 Putative Phenylalanyl-tRNA synthetase alpha chain n=1 Tax=Glarea lozoyensis (strain ATCC 74030 / MF5533) TaxID=1104152 RepID=H0EDX1_G  ali  14  105.GAWKTAAFKPYNFKSLGADQNAGALHPLNKVRHEFRQIFFEMG--FEEMTNRYVETGFWNFDALFVPQQHPAR-----DLQDTFYISDPKTADKPHAESQD----------DKGDYESYWENVQEV---HQDAS-----QKGPDGRPPPARYFSIDRVFRNETVDATHLAEFHQVEGVIADYGLSLGGLMEFMEIFFNKMGIEDLRFKPAYNPYTEPSMELNKLVEIGNSGMFRPEMLESMGLDMRVFGWGLSLERPTMIKYKVS................... 354
225 3.000e-72UniRef50_A0A0M2PS77 Phenylalanine--tRNA ligase n=11 Tax=Cyanobacteria TaxID=1117 RepID=A0A0M2PS77_PROHO  ali  15  214...WRSVQFKPYNIQDAVPNIPHGRPSILGECIQRIRTLFLTMG--FDEMAGTIVESAFWNFDALFTPQDHPAR-----EVQDTFYLADPAALPLPADET--LVQRV-----QQVHEHHYDGASRALLRAHTTPFTARQLY---KTQGQPGKYFSIDKVFRNENVDRTHLAEFHQIEGVVIGELLSIRSLMGYLGYFYEQLGFQDLKFKPTYNPYTEPSLESDSYLEVGNSGMFRREMLEPLGCEVSAIAWGLGLERIALLLYGVDRLSDLIGADS......... 483
226 5.000e-72UniRef50_A0A1Q7LPS1 Phenylalanine--tRNA ligase alpha subunit n=6 Tax=Archaea TaxID=2157 RepID=A0A1Q7LPS1_9CREN  ali  14  219.GDWERVQLRTYNVSSNVPNTWPGRLHPYAKFLRNAKQQLIGLG--FQEVTGPLVEYAFINCDCLYMPQDHPAR-----EVHDLFYLKDPSKGDLSIVDRVEETHENGDKTGSKGWRYSYDEAARLIMRSHGTALSVRAMLSK--NVKIPGKYFAVARCYRPDPLDKTHLMEFNQVEGIIIDPNLNLRNLLGVLEMFAKEIGADKVRFKPDYFPFTEPSVELQGWVEFGGSGIFRPEVTIPLGIKAQVLAWGLGIDRLYMMNKRIIDIRQLFSP--DLEWIRN.. 502
227 1.000e-71UniRef50_A0A163VGG0 Phenylalanine--tRNA ligase n=3 Tax=FCB group TaxID=1783270 RepID=A0A163VGG0_9BACT  ali  16  223.GSWRGLRFRRYEMDIPAARIHSGRLHPYRVFLDSVRRKFLALG--FSEMRGSIAESEFWNNDALFMPQFHPAR-----DIHDAYFLRRFAPA-ADILAKVASAHRDGGDTGSRGWSYDYDESRAPILRSQGTALSARWMASSPSV---PGKYFAIARCFRYDQVDATHLPDFFQVEGIVLGEDINLRHLVGLLRLFAERIGATEHKLYPGYFPFTEPSVEMHGWMEMGGAGLFRPEVTKPLGVEVPVIAWGLGLDRMAMTAMGLADIRDLMTDDL......... 499
228 1.000e-71UniRef50_Q8ZX61 Phenylalanine--tRNA ligase alpha subunit n=15 Tax=Thermoproteaceae TaxID=2267 RepID=SYFA_PYRAE  ali  16  194.GRWRNYTLKPFDLNIEPPEYPAPVPHFFNEFLDYVREVMIGLG--FEEVRGPVLEVEFWNFDALFQAQDHPAR-----EVHDTFYVQWSGPLETPPEHLMESVGRVHEE--KWRYKWDRKKALNPVLRTQTTATTIRALAERGD---GEYKVFTIGRVFRPEKLDPKHSMEFHQLDGIVVGPGLTFKHLLGQLEEIAKALGMTKVKFRPAYFPFTSPSVEKLGWVEFGGAGIFRPEVTEPLGVKKRVLAWGWGLDRIAMILLGIDDIRELFTKDL......... 463
229 1.000e-71UniRef50_A0A0K0WJT7 Phenylalanine--tRNA ligase alpha subunit n=10 Tax=Leptospirillum TaxID=179 RepID=A0A0K0WJT7_9BACT  ali  15  222..SWKGGAFRPYSLETPPPRPMLGQSHPYREYLEEVRRQLVRLG--FEEMTGPIVESEFWNMDTLFIPQTHPAR-----DIHDIYFVRDPREVDKDILSRVRAVHAGEGETRGWRQPFNEKQARRLLLRSQGTALSARKLASGPKI---PGKYFALARCFRYEQVDQTHAVDFYQAEGIVVEEGASFRTLLGLLTLFAREVGAREVHFKPAYFPFTEPSVEVHGWMELGGAGLFRPEVLRPLGVNTPVIAWGLGIDRMAMMRLGLSDIRDLFSGSL......... 498
230 2.000e-71UniRef50_A0A2U3CDS1 Phenylalanine--tRNA ligase subunit alpha n=1 Tax=Candidatus Heimdallarchaeota archaeon B3-JM-08 TaxID=2012493 RepID=A0A2U3CDS1_9A  ali  16  211.GEWRSLQLKKYKIATRPKHIPIGRKHPYLLFLQEVKEKLLGLG--FSEMRGPIVETEFWNFDALFAAQDHPAREPT-----DVYSIQDPPYGKLPLVNAVKTVHETGEGSRGWRYNWSPKKASLLLLRPQGTSVSARTLYN----LEIPAKFFSIARCYRPDSVDATHLSEFNQLEGIVCDPSITFRDLLGILKTFAVEVAATKVKFRPDYYPFTSPSVEKLGYIEFGGAGMFRPEVTAPFEIKDPVIAWGIGVDRLYMVKRGINDIRELFTQKLWLRTVPV.. 495
231 2.000e-71UniRef50_A0A0S8DPQ3 Lysine--tRNA ligase (Fragment) n=2 Tax=root TaxID=1 RepID=A0A0S8DPQ3_9BACT  ali  17  89.GYWVFENLDIGDIVGLKGKTFKTKTQEPTINVSEITVLSKSLPEKWHGLKDIELRYRQRYLDLLVNKEVREIRSRLISRIRTFLDGKGFLEVETPMMQPLP-----GGATARPFKTHHEALGVDLYLRIAPELYLKRLL------VGGFEKVYEINRNFRNEGISPRHNPEFTMLEVYAAYANY--QDMMELACELILD-AAKHIFGKYKVNYKDGDIDLSPPWANLT----FHEAVTKYAGIDYKAVAKGLGL.............................. 336
232 2.000e-71UniRef50_UPI000C1D660D phenylalanine--tRNA ligase alpha subunit, cytoplasmic-like n=1 Tax=Olea europaea var. sylvestris TaxID=158386 RepID=UPI000C1D6  ali  16  226.........................................................SFWNFDALFQPQQHPARDS-----HDTFFLKEPS---TTKILPEDYVERVKGVHESGGYGWKREEANKNLLRTHTTAVSTRMLYALAQDFA-PKKYYSIDRVFRNEAVDRTHLAEFHQIEGLICDRGLTLGHLIGVLEDFFSRLGMSKLKFKPAYNPYTEPHEGLGKWVEIGNSGMFRPEMLLPMGLDVQVIAWGLSLERPTMILYGIDNIRDLFGHKVDLGLIKRN. 459
233 3.000e-71UniRef50_A0A0B3ARX7 Phenylalanyl-tRNA synthetase alpha chain n=26 Tax=Archaea TaxID=2157 RepID=A0A0B3ARX7_9ARCH  ali  16  227..SWRGKKFRRYDITSPVPSIAGGKRXXXXXXXXXXXXXXXEMG--FQEMSGDYIQNSFWNFDALFTAQDHPVR-----EMQDTFFID--KNLELP--ENKKLVKAVREAHETGVYKWDEEKAKKLVLRTHTTCLSAQTLANL-KISELPAKFFAVGKCFRNETVDWKHGFEFNQTEGIVIDKNANFRHLLGYLKEFFKKMGFEKIRFRPAYFPYTEPSVEKKEWLELGGAGIFRPEVVIPLGENIPVLAWGPGLDRTLMNYYGIKDLRELYKNDI......... 503
234 3.000e-71UniRef50_A0A2J6N992 Phenylalanine--tRNA ligase subunit alpha n=1 Tax=Candidatus Korarchaeota archaeon TaxID=2056630 RepID=A0A2J6N992_9ARCH  ali  16  192.GRWK-QGLKPYDLSALPQPSRGGKKNFFQEFLSWVREILEDMG--FQESLGPYVETEFWNFDALFQAQDHPAR-----EMHDVLYIEGKGKI-----NDEDLIRRVAREHEGWGYSWSLDKASSLVLRSQNTAVSARFLAEHK---ERPIKMYSVDRVFRKDEIDQKHHIEFYQSEGIVVDKSLSLADLIGFLTQFARQLGFDEVRFYPSYFPFTEPSIEVLGWMEALPGGVFRPEVTRTLGTDEPVLAWGIGISRLAMAKFGLNDIRFLYSPDVDF....... 459
235 4.000e-71UniRef50_X1DWK7 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X1DWK7_9ZZZZ  ali  17  49.GTWKDYDIKPFDVTKPGPSLKAGKTHPLVNLINEIREIFISMG--FTEIRGPIVESAFFNFDALFQPQDHPAR-----ELQDTFYLNNPKFAKLPEKDRVKATHENGGDSNSWRYQWDENIAKQTVLRTHTTATTMRRLAQYRNNDKTPVKVFCIDRVFRNEKLDKSHLAEFTQIEGIVIDENVNLSDLIGLLSEFYKKMGFEKIITRPGFFPYTEPSDKLGEWLEMGGSGIFRPEV............................................... 291
236 5.000e-71UniRef50_A4YIL1 Phenylalanine--tRNA ligase alpha subunit n=36 Tax=Sulfolobales TaxID=2281 RepID=SYFA_METS5  ali  16  191.GSWREYEFKPYNVEANPPFFPIGKTHYFRDFIEKVKDLMVGLG--FVEVSGDFVETEFFNFDMLFQPQDHPAR-----EIHDSFVIEG--KGNLP---GSDLVRKVKEVHEKWWYSWSEDNARRLVLRSQTTAVTARVLS----GAPKRIRAFTIGKVFRPDSIDATHLIEFHQMDGLVIEEDFTFRDLLSTLRDIFQGLGVKQVKFKPGYFPFTEPSVEGLGWVEMAGAGLLRKEVTEPAGVFSPAGAWGIGIDRLAMLFLGVKDIRDLYSLDIYLRSRRV.. 464
237 6.000e-71UniRef50_A0A2D6KWW9 Phenylalanine--tRNA ligase alpha subunit n=4 Tax=Candidatus Woesearchaeota TaxID=1801616 RepID=A0A2D6KWW9_9ARCH  ali  13  221.GSWKDKRLRAYDIKINVPKKYPGRKQPYRRFLETVRKKFSSLG--FTEMTGPTVETDFWNMDALFMPQFHSAR-----DIHDAYYIKEPKYGEL----DEALMKKVKQAHENGFNTWQYKFDTKRTLRTQGTACSARMLTSENLKIPG--KYFALVRCFRSDVIDATHLVDFYQTEGIILEEGLNFRHLKGVLRMFAEEFCTDQIKIVPGYFPFTEPSAELHGWIELAGSGIFRPEMCKPLGIDVPVLAWGIGIDRIGMFKLGIKDIRQLFSQ--DLEFLRN.. 502
238 1.000e-70UniRef50_A3PFA8 Lysine--tRNA ligase n=153 Tax=cellular organisms TaxID=131567 RepID=SYK_PROM0  ali  17  102..EDIKEIVDIGDWIGVYGTIKKTNKGELSIKVEKWEMLSKSLPDKWHGLTDIEKRYRQRYLDLIVNPHVFKTRAKCISFIRKWLDNRNFLEIETPILQS-----EAGGAEARPFITHHNTLDIPLYLRIATELHLKRMV------VGGFEKVYELGRIFRNEGISTRHNPEFTSVEIYEAYSDYV--DMMNLTEELIKDI-LADACGSLTINYQNKEIDFSKPWLRISMKDI----VKKYTGIDF....................................... 333
239 1.000e-70UniRef50_A0A2H9M1E3 Phenylalanine--tRNA ligase subunit alpha n=4 Tax=unclassified Archaea (miscellaneous) TaxID=93506 RepID=A0A2H9M1E3_9ARCH  ali  13  222...WESTDFRRYNVKEAVPKKYYGKLHPYQEFIEKTKDKFASMG--FKEMTGPYVENNFTNCDALFMPQDHPARG-----IHDIFYIKEPE--KTELKEYKNFLKKVKKAHEKGIKGFDEEFTKKHVLRSQTTSASVRMLMNEDLEIPG--KYFVIDRNVRPDVIDWKHGAEFLQMEGIVLGEDMNLRSLFGLLRMFAEKVAVEKYKIMPDYYPYTEPIFWRGKWMELGGAGIFRKEVTEPLGVKVPVIAWGLGFDRAFMAERSINDIRQLFTNDL......... 496
240 2.000e-70UniRef50_A0A256ZD92 Phenylalanine--tRNA ligase subunit alpha n=1 Tax=Desulfurococcales archaeon ex4484_204 TaxID=2012517 RepID=A0A256ZD92_9CREN  ali  11  220.GAWRNAIFKKYDLSIDVPTVYPVRKHPYIQFLNYVRYVISSMG--FFEVKGPYVESELWNFDILFVPQYHPARRDT-----DVYFIKG----LPPASEDEGLLKVVKEIHEGWGYRWDPLKALRLILRTHTTPVSIRTICERG---GGEYRAFSLDRVFRPDTPDPTHLMEFHQLEGIIVGRRVAFKHLLGFFKAFAKFLGLGEVRFKPAYFPFTEPSVEKLGWIEVFPGGMFRPEVLKAVGLEYNVAAWGIGIDRIAMLILGIDDIRNLYTNNL......... 488
241 2.000e-70UniRef50_A0A0B3AHD8 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=archaeon GW2011_AR17 TaxID=1579375 RepID=A0A0B3AHD8_9ARCH  ali  14  209.GKWQGKKFRKYDVKINVPKIYGGRRQPYMEFLNKIKVQLVQLG--FKEMSGPLIETEFYNFDVLFQPQDHPARTWT-----DTYHLKYPTQGKLPVVNRVKNVHQDGGGSTGWGYKWDPKIAMQLMPRAHATAVSARQMV---KGIENPCKYFTISRVYRPDVLDATHLIEFNQLDGFVTDKSISFRTLLGMLKLFAIEIGAEEVKFFADYYPFTEPSVQISGWVELGGAGIFRPEITETLNIETPVMAWGLGIDRLAMFKLGIKDIRYLFSQDLWLREPRI.. 493
242 2.000e-70UniRef50_A0A2R6F7M7 Phenylalanine--tRNA ligase subunit alpha (Fragment) n=1 Tax=Halobacteriales archaeon QH_8_67_36 TaxID=1919164 RepID=A0A2R6F7M7_9E  ali  17  82.GEWADVEFTEYNVEADAEDVSHGTEHILRQTANRVKDTLVGMG--FREMEGPHVDAQFWINDCLFMPQDHPARTHW-----DQFALERPEEIDLPLVSRVRSAHKEGVGPDGEGYHWAEDVARGLDLRGHTTSLSMRYLSGHEGELEPPKRFFSVEKVYRNDTLDPTHLLEFFQIEGWVMAEDLSVRDLMGTFTEFYEQFGITDLEFKPHYNPYTEPHPETGEVVEVGNSGIFREEVLSPLGVDCDVMAWGLSLERLLMLMYGFEDIRDVHGTLCDLELLRT.. 369
243 2.000e-70UniRef50_A1RYS0 Phenylalanine--tRNA ligase alpha subunit n=9 Tax=Archaea TaxID=2157 RepID=A1RYS0_THEPD  ali  13  219.GGWREVVFKEFDLSVEVPQAGFGRKHPYLEFLDWVREILVSMG--FEEMKGPHVELELWNFDALFQAQDHPAR-----EIHDTYFVKGGATGDEELLRRIALTHENGWVTGSWGYKWDPARALRLILRTQTTAVSARTLYARGEGEYM---CFSLDRVFRPENLDAKHSMEFYQLEGIIVGRRVTFRNLLGFFQEMSRRLGLGEVKVKPAYFPFTEPSVEKLGWIEVFPGGMFRPEVLAPLGLRVNVAAWGIGIDRIAMTVLGVDDIRVLFSQDL......... 495
244 2.000e-70UniRef50_A0A1Q9NJX9 Phenylalanine--tRNA ligase alpha subunit n=2 Tax=Candidatus Heimdallarchaeota TaxID=1936272 RepID=A0A1Q9NJX9_9ARCH  ali  15  207.GKWKNVSFKPYSLTTKPRTIYPGRYNPYKQFLDHLRIKLIGLG--FQEMKGPLVEQEFWNFDALNAPQDHAAREDS-----DILLINSPTHGILSKDEYVSNVAKTHEDGWKTGYKWDPKKAARLLLRPQGTSISARTLAQ---IEKPPAKFFSIARCFRPDQIDATHDVEFDQTEGIICDPSLTFRDLLGMLKTFAVEVGATDVRFRPDYYPFTSPSVELSGYIEFGGAGVFRPEVTQPFGIDYPVLAWGLGVGRLFMTKYNIKDIRELFQNLSWLR...... 487
245 2.000e-70UniRef50_A2BTK0 Lysine--tRNA ligase n=18 Tax=Prochloraceae TaxID=1213 RepID=A2BTK0_PROMS  ali  16  87..EDLKEIVDIGDWIGVYGTIKKTNKGELSIKVEKWEMLSKSLPDKWHGLTDIEKRYRQRYLDLIVNPHVFKTRAKCISFIRKWLDNRNFLEIETPILQS-----EAGGAEARPFITHHNTLDIPLYLRIATELHLKRMV------VGGFEKVYELGRIFRNEGISTRHNPEFTSVEIYEAYSDYV--DMMNLTEELIKDI-VADACGSLIINYQNKEIDFSKPWSRISMKAI----VKKYTGIDFD...................................... 319
246 2.000e-70UniRef50_A0A1J4UN97 Uncharacterized protein n=2 Tax=unclassified Candidatus Micrarchaeota TaxID=1801634 RepID=A0A1J4UN97_9ARCH  ali  15  204.GSWKKAAFKEYDVSTVLAPVSIGLRQHYKRLLHQVKEELVGLG--FKEVHGPLVETEFWNMDALFMAQDHPAR-----EIHDAFQLEEPCKG---TVNDKALLARVKKAHEEGIIGWRYEWNSDLVCRSQNTGVSAR---NLAKGLETPARLFSIGKVFRPDVIDWKHFIEFTQCEGIVADENMNFRELLGYLKSFIEIFGADDARFYPTYFPFTEPSVEMRGWVEVGGAGVFRPEMLEALGVNIPVIAWGLGIDRLAMIRLGLDDMRDLNSSDL......... 479
247 6.000e-70UniRef50_A0A2G6KCL8 Lysine--tRNA ligase n=36 Tax=Bacteria TaxID=2 RepID=A0A2G6KCL8_9BACT  ali  17  99..FDLYKRLDIGDFIGVTGRVFRTKTDELTVLVSELTLLSKSLPEKWHGLKDVETRYRQRYVDLIVNQQTFMKRAQTISAIRTFFSDREFLEVETPMMQPI-----AGGATAKPFVTHHNALDMTLFLRIAPELYLKRLI------VGGFERVFEINRNFRNEGISTRHNPEFTMLEFYMAYADY--QDLMTLTEELFSSVA-QDVLETTKITYQGQSIDLTPPWDRLT----VRDGILKYADVSEADLDDIEALKRIAK......................... 345
248 7.000e-70UniRef50_A0A061P531 Lysine--tRNA ligase n=7 Tax=root TaxID=1 RepID=A0A061P531_9BACL  ali  15  63..YEKFQTCDIGDLVAVSGVPFKTNVGELSVKATTFTLMSKSLPDKHHGLKDVEQRYRQRYVDLIVNPEVFITRSKILQTMRRYLDDQGFLEVETPTMHSI-----AGGASARPFVTHHNALDMELYMRIAIELHLKRLI------VGGMEKVYEIGRVFRNEGVSTRHNPEFTMIELYEAYADYN--DIMNLTENLVAHIA-QEVHGTTKVQYGEDVINLTPNWRRVHMVDLIKEE................................................ 289
249 9.000e-70UniRef50_A0A1Q6W8Q2 Lysine--tRNA ligase n=11 Tax=Candidatus Rokubacteria TaxID=1752708 RepID=A0A1Q6W8Q2_9BACT  ali  17  103.....FTELDVGDFIGVTGEVFRTRTGELTVAVKSFTFLAKSLPEKWHGLKDVETRYRQRYVDLVVNPDARAIRSRVIQALRKFLDARGFLEVETPMMQPIP-----GGAIARPFKTHHNALDMDLYLRIAPELYLKRLL------VGGLDRVYEINRNFRNEGVSTQHNPEFTMLEFYQAYADYT--DLMELTEELFTHLA-ESALGRLTLTWGEHEIDLRRPWTRL......................................................... 317
250 1.000e-69UniRef50_O83938 Phenylalanine--tRNA ligase alpha subunit n=12 Tax=Spirochaetes TaxID=203691 RepID=SYFA_TREPA  ali  12  271.GAWKTQHLRRYNVHIPPARIIPGRSNAYADFLEHIKDRLVALG--FQEFDGPLVETDFWNADALFMPQFHPAR-----DIHDVYYLKHPTHAPTPFLSRVAATHERGADSGSWRYSFDRDFTRRLLLRSQGTALSAR----HLPTAHIPGKYFGIARCFRHDQVDATHLADFYQTEGIVLGTDVNVCTLLGMLKILATEIGAQEVRYVGGYFPFTEPSIELHGWFELGGAGLLRPEVTDPLGVHVPVMAWGLGVDRMALLALGISDVRELFSP--DIESVRLRV 553
251 2.000e-69UniRef50_A0A2G3B5Y3 Putative phenylalanine--tRNA ligase alpha subunit n=2 Tax=Capsicum TaxID=4071 RepID=A0A2G3B5Y3_CAPCH  ali  17  163.................EKSPYRSYSGKFTEVRRQVQTIFLNMG--FEEMTNNYVESSFWNFDALFQPQQHPARDS-----HDTFFLKVPS---TTKMLPEDYVERVKEIHESGGY-------------------------QSRGKPFAPKKYYSIDRVFRNEAVDRTHLAEFHQIEGLICDRGLTLGDLIGVLHDFFSRLGMSKLRFKPAYNPYTEPHEGFKKWVEVGNSGMFRPEMLLPMGLDVRVIAWGLSLERPTMILYGIDNIRDLFGSKVDLSLIKRN. 404
252 2.000e-69UniRef50_A0A059F3A1 Phenylalanine-tRNA ligase, alpha subunit n=1 Tax=Anncaliia algerae PRA339 TaxID=1288291 RepID=A0A059F3A1_9MICR  ali  18  176.......TLKKYNFDSKGLAINHGSLHPLLKFKAEIKKIFLEMG--FIEMTSRYVESAFWNFDSLYQPQDHPSRDEIKNEILKKIEEKDFEEIDQQYLERVKKTHEEGNESVGYKYKWSKEESSKVTLRTHTTAVSARYLYNMTEG----ERFFSIDRVFRNETVDSTHLPEFHQVEGLLIGDNLNLSDLIQTITLFFNKLGIKELKFKPAYNPYTEPHPLLKRWIEIGNSGVFRPEMIRTMGYDKTALGFGLSVERPAMIMYGCDNIRDLMGNRVNLEFVKEE. 508
253 2.000e-69UniRef50_A0A1G8XEC2 Phenylalanine--tRNA ligase alpha subunit n=9 Tax=Halobacteria TaxID=183963 RepID=A0A1G8XEC2_9EURY  ali  14  210.GEWETVEFTDYNVEADADDIEPGRKHALREMADRVKDVLVGMG--FQEMQGPTVDADFWIHDCLFMPQDHPARTHW-----DRFAIENPGKIDDVPDDRVKTAHSDGVGEDGEGYHWDEDFARQLALRGHTTSLTARHLAGEALDLEPPQRFFSVEKAYRNDELDATHLLEFFQIEGWVMAEELSVRDLMGTFTEFYEQFGITDLEFKPTYNPYTEPHPETGELIEIGNSGIFRPEMLEPLEVDCDVMAWGLALERLMMLATGAEDIRDVHGTLVDLEYLRTE. 498
254 2.000e-69UniRef50_A0A0S3QVR8 Lysine--tRNA ligase n=37 Tax=Bacteria TaxID=2 RepID=A0A0S3QVR8_THET7  ali  19  101...EVFKKLDVGDIIGVKGHLFRTKTGELTVNCSEVTLLSKPLPEKWHGLKDIETRYRQRYLDLIVNEDSRRIRSEVIRLIREYLVSKGFIEVETPMMQPIP-----GGAAARPFVTHHNALDIDLYLRIAPELYLKRLV------VGGFDRVFELGKCFRNEGISSMHNPEFTMVEFYMAYADY--KDLMELTEDMLSGI-VKKIHGTTKITYQGQEIDFTPPWKKIS----FCEALVEIGGVPERVI.................................... 334
255 4.000e-69UniRef50_A0A2J4UTD5 Lysine--tRNA ligase (Fragment) n=2 Tax=Bacteria TaxID=2 RepID=A0A2J4UTD5_9ENTR  ali  17  22...EQFKKWDLGDIIAARGKLFKTQTGELSIHCTELRLLTKALPDKFHGLQDQEARYRQRYLDLISNEESRKVRSQILATMRQFMVARGFMEVETPMMQVIP-----GGATARPFITHHNALDLDMYLRIAPELYLKRLV------VGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADY--KDLIELTESLFRTLA-QNVLGKTEVPYGDQVFDFGKPFEKLTMREAIKK................................................. 246
256 4.000e-69UniRef50_A0A2H6GZS4 Phenylalanine--tRNA ligase alpha subunit n=7 Tax=Archaea TaxID=2157 RepID=A0A2H6GZS4_9ARCH  ali  13  219...WKGKKFRRYDVSSGVPAIHGGKRHFVNQAIDYGRKIWTDMG--FTEMTGNMIDSSFWVFDALFTAQDHPGR-----EMQDTFFINKKSELDKKLVKSVKDAHEGKIKGSKGWYNWDEKEAQRGVIRSHTTNLSAKTLTNLKKE-NLPAKFFAIGKVLRNETLDWSHGFEFNQTEGIVIDKDANFRHLLGYLKQFFKKMGFEKIRFTPAYFPYTEPHPEKKVWLEIGAAGIFRPEVVIPLGEYIPVLAWGPGFDRAIMDYYKIKDLRELYKNDI......... 493
257 4.000e-69UniRef50_A0A1Q7KR81 Lysine--tRNA ligase (Fragment) n=2 Tax=Bacteria TaxID=2 RepID=A0A1Q7KR81_9BACT  ali  19  98.GFELYKLLDLGDHIGVAGYLFRTRTGELSVHVDQITFLSKDLPEKWHGLTDVELRYRQRYLDLIMNPEVREKRSKLVQSLRRSLEAHGFIEVETPMMQPI-----AGGAVARPFVTHHNTLDMNLFLRIAPELYLKR------LTVGGLDRVYEINRNFRNEGLGWRWNPEFTMLEFYQAYAD--FRDVMELTQQLIEQ-AAKDVTGGMSTKWGEHEIDWVGNWQRMTMREAIIHYWPRSAGAKPQISDFG................................. 341
258 4.000e-69UniRef50_Q9Y9I6 Phenylalanine--tRNA ligase alpha subunit n=6 Tax=Thermoprotei TaxID=183924 RepID=SYFA_AERPE  ali  17  209.GEWRRLRFKPYNVKAEPPRVLPARRHFLAEFIERLRDILRELG--FREVRGPLVELELFNFDVLFQAQDHPAR-----EIHDSLWIKSPRRGDLSG--YSDLVERVASVHERGWYRWSPEVASRYILRSQTTAVSARILATRPN---PPARFFTVGKVFRSDAVGPTRLPEFHQLDGIEGDEGYTFRDLLGRLDEIASMLGLK-LKFKPAYFPFTEPSVEGGRWLELFGAGMFRPEVLEAVGVDYPVGAWGFGIERLAMAFYGVSDIRKLYTRNVD........ 478
259 6.000e-69UniRef50_A0A0B5HKG9 Phenylalanyl-tRNA synthetase alpha chain n=4 Tax=Archaea TaxID=2157 RepID=A0A0B5HKG9_ARCG5  ali  15  201LGMPEFREARAYNIQDAVPRLYPGKKQPYIQFLNIIRRKLIQLG--FKEMYAPLITQEFYNFDVLFQPQNHPARSWT-----DTYQLKAPRKGRLPIVNSVKAAHEHGGNTESIGYTWSEDIAEKVMPAAHGTAHSARQLVQG---IEVPGKYFAIARCYRPDVMDASHLIEFNQLEGFIVGENLNFRSLLGMLKQFATEIGAEAVKFYPDYYPFTEPSVQKLGWVEFAGAGIFRPEMMHALGIEEPAIAWGMGIDRLAMFKLGIKDIRYLFSDDLD........ 479
260 8.000e-69UniRef50_A0A2I0Q5W7 Uncharacterized protein n=10 Tax=Archaea TaxID=2157 RepID=A0A2I0Q5W7_9EURY  ali  16  193...........FDINAPVAQISASRRHPYNEVATLVRKIFLEMG--FQEMEGPLVETTFWCMDSMFIPQDHPAR-----DVQDTYFVG--KKGMLPLVEKVKEIQETGGDTGSTGYQWKEELADDLILRTHSTATTFRTLYFKQLKNVEKCKYFYIARSFRNETTDATHLCEFAQAEGFIMADGLTLADLKGFIKEFYAKLGVTKIRFKPVYNPYTEPSEKLKKWSALINSGIFRPEALAPYGITKPIIAWGIGFNRLVALLTKTSDVRDTLGPICDLNWLSNR. 468
261 8.000e-69UniRef50_C7DGH8 Transcriptional regulator, TrmB n=1 Tax=Candidatus Micrarchaeum acidiphilum ARMAN-2 TaxID=425595 RepID=C7DGH8_MICA2  ali  16  207.GAWRNFAFKKYDMGAETPEVYPGRLHPVHEFINVIRNIW--MRMGFTEGSGHIIEPAFWNFDALFSPQDHPTR-----DMQDTFFLSNPERINLPEKELVEKVKEMHKKN--WGRRWSAETAAEAVLRTHTTSISAHYIKEYGNGYGYPAKLFYVGKVFRNESIDYKHLAELYQYDGIIIGDDLGLSELIGTLKLFYSQLGGFKIKIKPSYFPFVEPFDEHNDWIELCGGGVIRKEITEALGTDKSVLAWGGGLDRLMFSRLGMESLTDLYKNDVD........ 481
262 1.000e-68UniRef50_A3IQP2 Lysine--tRNA ligase n=63 Tax=cellular organisms TaxID=131567 RepID=A3IQP2_9CYAN  ali  14  118....LKKLTDTGDIIGVKGSIKRTEKGELSVKVKQYQILTKSLPDKWHGLTDTEKRYRQRYVDLIVNPQVRRHRAQITASIRRYLDNQGFIEIETPVLQS-----EAGGAEARPFITYHNTLEMDLYLRIATELHLKRLI------VGGFEKVFEMGRIFRNEGVSTKHNPEFTSIEIYQAYADYN--DMMELTEAIITT-AAQEVLGDSKITYQGEKIDISTPWRRVTMHEI----VKEKSGLDFE...................................... 348
263 2.000e-68UniRef50_A0A0S7XDT4 Lysine--tRNA ligase n=1 Tax=Latescibacteria bacterium DG_63 TaxID=1703781 RepID=A0A0S7XDT4_9BACT  ali  17  94..YELLAMVDVGDIIGVSGPVFKTKTGEITVKVEAFQLLSKSLPEKWHGLRDVETRYRQRYVDLIVNAEVRELRSRIIKTMRNFLDERGFIEVETPVLQPL-----YGGAFARPFVTRHEALDMDLYLRIADELYLKRLI------VGGLERVYEIGKDFRNEGIDRTHNPEFTQLELYQAYADYM--DMMELFEEMVCEV-VTELFGELKCVYGEHQLDFSRRWKRFGYF----EALKQHLGVD........................................ 324
264 2.000e-68UniRef50_A0A258AQV6 Lysine--tRNA ligase (Fragment) n=1 Tax=Aerococcus viridans TaxID=1377 RepID=A0A258AQV6_9LACT  ali  17  116...WKKA--DLGDIVGVEGTLMRTNTGELSVKATKFVHLTKALPDKYHGLTDVEQIYRHRYLDLIANRESFDKRSQIIREVRHYLDSNDYLEVETPVLHNI-----AGGASARPFITHHNALDMELYLRIALELHLKRLV------VGGMERVYEIGRVFRNEGIDTTHNPEFTMLEVYTAYSKMT--DVMDLVEGLFQSVA-EKVLGTTSITFDGQAIELGGKWRRVHMVD----AVKEASGVDF....................................... 344
265 3.000e-68UniRef50_A0A0A2WTX4 Lysine--tRNA ligase n=5 Tax=Bacteria TaxID=2 RepID=A0A0A2WTX4_THEFI  ali  23  92..YELLKKLDVGDLVGVRGTVFTTKTGEVTVKVLDWTPLAKSLPDKWHGLKDKEVRYRQRYLDLIVNPEVRRKRSEMVRYIRRFFEERGFLEVETPILQPT-----TGGAEARPFKTYHNALDHEFYLRISLELYLKRLL------VGGYEKVFEIGRNFRNEGIDHNHNPEFTMLEAYWAYADY--QDMAALVEELLSGLALH--LFGSHRVPYGRVLDFTPPFKRIS----FVESLKEKAGLPFDP----LDLERL........................... 331
266 4.000e-68UniRef50_A0A2R6BZ14 Uncharacterized protein n=8 Tax=Candidatus Marsarchaeota TaxID=1978152 RepID=A0A2R6BZ14_9ARCH  ali  16  222.................EPFYQRGKKHFYIEFLEIVKEILISMG--FEEMFGPYVEYEFWNFDALFVPQDHPAR-----EVQDKFNISNKDLILDPIAENVMKTHLNGWKTGSLG--WRNKWEMSLILRSHTTAVSIRKLAQGVHNE---FKYFTIDRNFRRDAIDATHLPEFHQCEGIIGGEGLNLKNLFGILEAFSKSLGVEKIRFKPGYFPFTEPSVEKLGWIEAAPGGIFRPEVTLPLGIKVPVLAWGIGITRFAMVYYNLSDIRELFSQNLD........ 484
267 4.000e-68UniRef50_A0A1W9NYJ3 Lysine--tRNA ligase n=20 Tax=root TaxID=1 RepID=A0A1W9NYJ3_9BACT  ali  18  99........FDLGDFLGIQGELFKTKTGELTVLVKDFKLLSKSLRPEWYGLEDKEIRYRQRYVDLILNPEVFLTRSRVVSEMRHILDTNGFIEVETPILQPV-----YGGAAAKPFITHHRALDIDLYLRISNELYLKRLI------VGGFEKVYEVSKDFRNEGIDRQHNPEFTQIEFYWAYADY--ERLMEFSEQAIAQV-LNKVIGSTEVTYQNKELNFTPPWPRISFYEIFK----KYTAID---------LEKANTEEKLLDKIRE-KKINLDLAGV.... 349
268 4.000e-68UniRef50_A0A1Q9NLC6 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Candidatus Heimdallarchaeota archaeon LC_3 TaxID=1841598 RepID=A0A1Q9NLC6_9ARCH  ali  14  231.GKWKDVILRPYKVEIPVPPYLPGKRHFYWQTIDYVRQVWLSLG--FQEMEGTIVQTSFWNFDTLFVPQDHTAREE-----QDTFFIKHPKKVDNEIFDEVAQTHLNGGNTGSNGWGFKKEISERLVLRTHTTCLSAKTI-KTLREKGYPAKYFAVGRCFRNEKIDWKHLAEFDQVEGIVVDPSVTFQDLLGYLNAFYKALGYKGTRFRPGYYPYTEPHPLKNEWIEMGGSGVFRPEVVIPLGEDIPVLAWGPGIGRMVSERYSLVDIRSQYENNLD........ 512
269 4.000e-68UniRef50_A0A1G1E1T6 Lysine--tRNA ligase n=90 Tax=root TaxID=1 RepID=A0A1G1E1T6_9BACT  ali  14  102.....FLKYDIGDIIGITGKVFRTRTNELTIHAKGITLLTKSLPEKWHGLKDVEIRYRQRYVDLIVNPEVREKRTLIVQKMRDFLNNKGFLEVETPMMQSIP-----GGATAKPFKTHHNALGMDLFLRIAPELYLKRLV------VGGLERVYEINRNFRNEGISTQHNPEFTMLEFYMAYADYN--DLISLTEEMFSFL-SKEVLGTSVIEYGSEKIDLTPPWKRYS----FKDSIIELGGVSPDILD................................... 334
270 4.000e-68UniRef50_E7NUI0 Phenylalanine--tRNA ligase alpha subunit n=65 Tax=Spirochaetes TaxID=203691 RepID=E7NUI0_TREPH  ali  14  277.GEWKGQAFRSYNIQLPPARVLSGRPSAYSDFLEGVKDKLCSLG--FEEFDGPLVETDFWNSDALFMPQFHAAR-----DIHDVYYIKNPKSIEEPFLSRVAEVHKTGGNTGSWGYQFDRDFTRRLLLRSQGTVLSAHQLAK----AKIPGKYFGIVRCFRYDKVDATHLSDFYQTEGIVLGKNVNLKTLLGILKMFAVEIGATEVKYVGGYFPFTEPSIEVHGWFELGGSGILRPEVTRAMGVDVPVLAWGIGIDRMALMALGLNDLRELFSS--DIEAVRLR. 558
271 4.000e-68UniRef50_B2J384 Lysine--tRNA ligase n=44 Tax=cellular organisms TaxID=131567 RepID=SYK_NOSP7  ali  15  106....LKQLTDAGDILGVKGTIKRTEKGELSVYVKQYTILTKSLPDKWHGLTDVAKRYRQRYVDLIVNPEVRRRRAQITAGIRRYLEQRDFLEIETPVLQS-----EAGGADARPFITHHNTLEMELYLRIATELHLKRLI------VGGFEKVFELGRIFRNEGISTRHNPEFTTIEVYQAYADYN--DMMALTEGIITTVA-QEVLGTLQITYQGEPIDLTPPWRRVTMHDL----VKEFTGLDFN...................................... 336
272 6.000e-68UniRef50_A0A256XTD0 Phenylalanine--tRNA ligase subunit alpha n=1 Tax=Candidatus Woesearchaeota archaeon ex4484_78 TaxID=2012531 RepID=A0A256XTD0_9ARC  ali  13  223.GDWKKKNFRRYDVTINVPKFFGGKLQSYRYFLDWVRSKFVALG--FQEMNGPIVESDFWDMDALFMPQFHSAR-----DIHDAYYVKRPKFADIPLIKKVKAAHESGANTGSIGWRYSFDVEQRCLLRTQGTACSARMIGSGKLEIPG--KYFGITRSFRYDVIDATHLPDFYQTEGFVVEEGLSLRHLIGLLRMFAKEFAADEIRIVPGYFPFTEPSAEKLGWVELGGAGIFRPEVVKPLGKHVSIIAWGMGIDRIGMFKLGLTDIRQLFSHDLFLREERL.. 508
273 7.000e-68UniRef50_A0A0S7H9I7 SYFA (Fragment) n=3 Tax=Bilateria TaxID=33213 RepID=A0A0S7H9I7_9TELE  ali  20  21................................................................................................YLERVKKVHSEGG-YGSQGYKWKMEEAQKNILRTHTTAVSARMLYKLAQQEKFPVKYFSIDRVFRNETLDATHLAEFHQIEGVVADYGLTLGDLMGVLHQFFTKLGITKLRFKPAYNPYTEPHEGLKKWVEVGNSGVFRPEMLLPMGLDVSVIAWGLSLERPTMIKYGINNIRELVGHKVNLQMVY... 217
274 7.000e-68UniRef50_D6TJB3 Lysine--tRNA ligase n=1 Tax=Ktedonobacter racemifer DSM 44963 TaxID=485913 RepID=D6TJB3_9CHLR  ali  18  94LGEESYKLLDLGDFIEARGFLFVTRTGERTLHVKGWRVIGKGLPEKYHGLEDKELRQRKRYLDLIANGEVFETRSRVISAMRRFLEGQGYLEFETPILQPL-----YGGATARPFITHHNTLDRDLYLRIAIELYLKRLI------VGGFERVYEIGRNFRNEGIDRSHNPEFTMMECYQAYADYN--DMMKLVEEMIAYIA-QEVKGTTRVTYQGTEIDLTPPWPRIPLL----EAIHKYTGIDINALPDRESLAAEMHAKGYIVDPKLGRGRLID........ 362
275 9.000e-68UniRef50_I1IBQ4 Lysine--tRNA ligase n=33 Tax=Viridiplantae TaxID=33090 RepID=I1IBQ4_BRADI  ali  15  163....LKAVIDIGDILGASGSIKKTEKGEISVYVNFFEILTKSLPDKYHGLTDVDKRYRQRYVDMIANPEVFRTRAKVVSEIRKAMESFGFIEVETPVLQ-----GAAGGAEARPFITHHNSLQRDLYLRIATELHLKRML------VGGLEKVYEIGRIFRNEGISTRHNPEFTTIEMYEAYSDY--ESMMNLAEEIVTRCAM-ATLGKLKVDYQGTEISLERPWRRESM----HRLVEEATGIDFNSFGDVESAKNAARELLGIKT.................. 413
276 1.000e-67UniRef50_A0A1L9GVE9 Phenylalanine--tRNA ligase subunit alpha n=4 Tax=Archaea TaxID=2157 RepID=A0A1L9GVE9_MICA2  ali  16  215..AWTESGFRPYDVEAPVAEAYPARRHPMKEFMELVRRMWVSQG--FIETAGPMIESSFWNFDALFSPQDHPTR-----EMQDTFFLSNP-EILG--IAEKELLKRVARMHKKGWNSWNEDISFQPVLRTHTTSVSAHNIYGNSSMLEYPIKLFSIGKVFRNESIDYKHLAELHQLDGIVIGRGLGVADLKGTLEQFYKGLGFK-VKFKPSYFPFVEPDDEHGDWIELCGGGIIRKEITKALGTDMRVIAWGAGLDRLMFKYLGINSLSELYKNDI......... 486
277 1.000e-67UniRef50_A0A254WUX3 Lysine--tRNA ligase n=1 Tax=cyanobacterium TDX16 TaxID=1503470 RepID=A0A254WUX3_9CYAN  ali  18  101.GWELVGLLDLGDIIGVDGLLGRTKTNEITVWAESLRVLSKSLPEKFHGLTDVDVRYRERYVDLFSNPEVFKARSRIVEAVRRHLSKQGFLEVETPMLQSI-----YGGAAARPFTTHHNTLDMDLFLRISPELSLKRLL------VGGMERVFEINRNFRNEGISTQHNPEFTMMECYQAYGD--LSDMMNIVEGIVVE-SIEALGGGFRRQFRGQEIDFTPPWPRRTYSDLLR----EYAGVDLKDAA................................... 337
278 1.000e-67UniRef50_P57822 Lysine--tRNA ligase n=596 Tax=root TaxID=1 RepID=SYK_PASMU  ali  19  108VGQW-----DLGDIIGVKGTLFKTKTNELTVRCTEVQLLTKALPDKFHGLSDQETRYRQRYLDLIANEDSRRIRSKVIAGIREYFLSKGFMEVETPMLQIIP-----GGASARPFVTHHNALDVDMYLRIAPELYLKRLV------VGGFERVFELNRNFRNEGVSVRHNPEFTMLEYYQAYADY--HDLMDNTEELLRKLAMD--ILGTTIVPYGEEFDFGKPFERITMKGIVKEDVAKKLGIEVQ-KSWGLG............................... 366
279 1.000e-67UniRef50_C0AW72 Lysine--tRNA ligase n=5 Tax=Bacteria TaxID=2 RepID=C0AW72_9GAMM  ali  17  8...EQFKKWDLGDILGARGRVFKTKTGELSVHCTEVRLLTKALPDKFHGLADQEMRYRQRYLDLISNEESRKIRSQVMAGIRQFMVNKGFMEVETPMMQTIP-----GGASARPFITHHNALDIDMYLRIAPELYLKRLV------VGGFDRVFEINRNFRNEGVSPRHNPEFTMMELYMAYADY--RDLIELTEELFRTL-TENVLGSSLVKYGDQEFDFGKPFAKLTMKEAIRPEMDKAIGIKIE-KSWGLG............................... 266
280 1.000e-67UniRef50_Q7RSE2 Phenylalanyl-tRNA synthetase, putative (Fragment) n=3 Tax=Eukaryota TaxID=2759 RepID=Q7RSE2_PLAYO  ali  16  18....................................................NYIESSFWCFDALYIPQQHPSR-----DLQDTFFIKHPKYINKEYIENIKRVHTYGDGSFGWNYKWKLEESQKNVLRTHTTANSCRALFKXAKMYKETKKYFSIDRVFRNENLDSTHLAEFHQIEGLVIGKNIGLSQLIAMLSAFYKYIGIHKLKFKPTFNPYTEPHEEHKKWLEVGNSGIFRPEMLMPMGFDVSVMAWGLSLERPTMIKYGINNIRDLFG............ 253
281 2.000e-67UniRef50_A0A0R3SUU6 Uncharacterized protein n=1 Tax=Hymenolepis diminuta TaxID=6216 RepID=A0A0R3SUU6_HYMDI  ali  14  650.GSWKDLKFKKYNFKALGAFPEGGHLHPLLRVRAEFRRILMDMG--FSEMTNNYVESSFWNFDSLFQPQQHPAR-----DAHDTFFLSDPASTDLDYLERVKKTHEVGGFGSKGRYDWQLSEAAKNLLRTHTTAVSARMLYQLAQQKEKPQRYFSIDRVFRNETLDATHLAEFHQVEGVFADYGLNLGHLKAVIRAFFDHLGLHQLRFKPAYNPYTEPSME................................................................ 871
282 2.000e-67UniRef50_A0A2R4ZNJ0 Phenylalanyl-tRNA synthetase, alpha subunit n=2 Tax=unclassified Desulfurococcaceae TaxID=132567 RepID=A0A2R4ZNJ0_9CREN  ali  17  159....KGIYIKPYNVEAEPAKIYPAYRHFYVDFLEMLREIMLSLG--FDEISDDLVVPELWNFDVLFQAQDHPAR-----EIHDTLVVEG-EEADLGI--YSDLLERVSREHSRWGYKYDRSIASRLVMRSQTTAATIRYLHYHR---EPPVRAFIIGRVFRFDRIDAKHLPEFHQLDGIAMERDMSLRKLLGILTQITKALGFREVIFKPGYFPFTEPSVEGLGYVEIFGSGLFRPEVLRMAGVKHNVAAWGMGVDRLAMAYLAINDIRELYTPEIDLRWHRI.. 432
283 2.000e-67UniRef50_A0A1U7JB98 Lysine--tRNA ligase n=25 Tax=cellular organisms TaxID=131567 RepID=A0A1U7JB98_9CYAN  ali  17  118....LKQLTDVGDILGVRGTIKRTEKGELSVKVQEYALLTKALPDKWHGLTDVAKRYRQRYVDLIVNPDTFRKRALITSGIRRYLEDRGFLEIETPVLQS-----EAGGAEARPFVTYHNTLEMDLYLRIATELHLKRLV------VGGFERVFEIGRIFRNEGVSTRHNPEFTSVEFYQAYADY--HDLMNLTEDLIATLA-KDILGTLKITYQGVDIDLTPPWRRVTMHDL----VQEHTGLDFRQF.................................... 350
284 2.000e-67UniRef50_Q8U7H6 Lysine--tRNA ligase n=537 Tax=cellular organisms TaxID=131567 RepID=SYK_AGRFC  ali  18  109........IDIGDIIGVTGKVRRTKRGELTINAEEITMLTKSMPEKWHGVSDIELRYRKRHLDILANEDSFLQRSKILSGIRRFMEAEGFLEVETPMLQTV-----YGGATADPFKTFHNTLKMDMYLRIAPELFLKRTLVSGLSD-----KVFEINRNFRNEGVSTRHNPEFTMMECYWAYADY--EDIMGLVERLFETLAI-ALHGTTEVEFQGQTISFKGPFKRVPM----PDAVKEATGIDF....................................... 335
285 2.000e-67UniRef50_E6QIH2 Lysine tRNA synthetase, inducible n=4 Tax=root TaxID=1 RepID=E6QIH2_9ZZZZ  ali  20  107.GYTLYKLLDMGDHIGVTGYLFRTRTDELTIHVDTITFLAKAMPEKFHGLADVELRYRQRYVDLFANREVFVKRAKVLQAIRRFFDDRDYLEVETPMMQPI-----AGGAAARPFKTHHNALDVDLYLRIAPELYLKRLV------VGGLDRVYEINRNFRNEGVSTQHNPEFTMLEFYQAYANY--HHLMDLTEELIAQVAIE-VNGTTVVEFNGHTIDLA-KWQRLTMVEAIRQYWPESAGFPEKIDALG................................. 349
286 2.000e-67UniRef50_A0A2S8SXH3 Lysine--tRNA ligase n=3 Tax=Bacteria TaxID=2 RepID=A0A2S8SXH3_9BACT  ali  13  90IGEEKMAEFKLGDILGLSGVVMKSRSGEISIGLEDFTLLATSLPDKYHGLQDVELRYRQRYADLMSNEEVFRKRSQIVREMRSYLDAREFMEVETPMMQAI-----AGGAAAKPFVTHHNALDMELYLRIAPELYLKRLV------VGGLERVYEINRNFRNEGIDTRHNPEFTMMELYQAYADYN--DMMDLTETMVRQIA-QKVNGSTTVTYGEHEIDLGQPWRRATMRELVREAIGLDIKLIQPTFVLDFPIENSPLAKKSNEDSNLTYRFEFFIGGQE... 382
287 2.000e-67UniRef50_A0A1Q6DXK2 Pyrrolysyl-tRNA-synthetase PylS n=3 Tax=Euryarchaeota TaxID=28890 RepID=A0A1Q6DXK2_9EURY  ali  33  1..................MEFTETQKQRLRELGYKGEFPELDTXXXXXXXXXXXXXXXXXKLNDLF-ESKKPTWKNTVENIRQNLQDLGFIEVQTPLIISKNLLKKMKIDQKSDLMNQVYRINDNKVLRPMLAQNLYKELENFSKSNRDTIQLFEIGTCFRKEKGGKDHLNEFKMLNAVELGNFKDKERLKEVISTLFKDFD-EYVLEKEKSTVYGETYDVLVNGTELASCAIGPHQLDEKWDINRPWIGIGIGIERFTRLNNSDSTVKAYGRSFVYQDGIRLDI 272
288 3.000e-67UniRef50_Q2IPX5 Lysine--tRNA ligase n=11 Tax=Bacteria TaxID=2 RepID=SYK_ANADE  ali  20  104..FEVFKLLDIGDIVGAEGPATRTKTGELTLEARTFTILTKALPEKWHGLTDVEQRYRQRYVDLVVTPEAFVKRARIVSGIRRFLDARGYLEVETPTLHKPE---EAGGAAARPFETHHNALDLDLKLRIATELHLKRLV------VGGLDRVYEIGRIWRNEGIDRRHNPEFTSIEFYQAYA--THEDLMRLTEELMHQLAVE-VTGGPVVTFQGQAIDLTPPYPRVSMLEVGA----RALGLAPDDALAGRGLEALSRAAARENDSEDAWK............ 365
289 3.000e-67UniRef50_A0A086YJM7 Lysine--tRNA ligase (Fragment) n=7 Tax=root TaxID=1 RepID=A0A086YJM7_9FIRM  ali  19  102.....FNLLDIGDIIGAEGNLFKTRSGEVTVAVEKFTLLAKSLPEKWHGLRDIELRYRQRYLDLLVNPEVFVLRSKIIQTMRKFLEQRGFLEVETPMMHLIP-----GGANARPFTTHHNALDLDLYLRIAPELYLKRLII------GGLEKIYEINRNFRNEGISTKHNPEFTMLELYQAYADY--HDMLKITEELIYTV-TQEVLGASDVIYEDVTLNLAPPYKKISML----EAVKQYTGIDF....................................... 330
290 3.000e-67UniRef50_D5U0B9 Phenylalanyl-tRNA synthetase, alpha subunit n=9 Tax=Desulfurococcaceae TaxID=2272 RepID=D5U0B9_THEAM  ali  14  223........IKEFDLSIPVPRLPSVRKHPFMEFIDDLRDIMVSLG--FEEVKGPHVEAEFWNFDVLYQAQDHPAR-----EIHDTFFVKSDARISSQLMERARSVHEKG-----WGYKWSPERAMRLVLRSQTTAVSARAIFERG---EGEYRVFTIDRVFRPENLDAKHSMEFHQLDGIIVGKNVNFKHLLYFFKELAAALGIKEVWFKPGYFPFTEPSVEKLGWVEVFPGGVFRPEVMEILGAPVKAVAWGIGVDRLAMQVLGIDDIRMLFATDL......... 484
291 3.000e-67UniRef50_A0A2E4BWK2 Lysine--tRNA ligase (Fragment) n=1 Tax=Dehalococcoidia bacterium TaxID=2026734 RepID=A0A2E4BWK2_9CHLR  ali  17  111....LLKELDIGDFVGITGPLFKTRTGEVTIAATEFTFLSKSLPEKWHGLKDKEQRYRQRYLDLIANDEIMPRRSRIIQSIRAYMIKAGFIEVETPVLVPVAA-----GALAKPFVTRHHALGQNLYMRIATELYLKRLI------VGGFHKVFEIGRVFRNEGIDQNHNPEFTLLESYEAYANY--EDVMRLVETLLSTV-VQETTGGNTIEYGEYTLDFSVPWKRMS----FSNAILEYANIDI....................................... 340
292 3.000e-67UniRef50_P28354 Lysine--tRNA ligase n=5891 Tax=root TaxID=1 RepID=SYK1_SALTY  ali  17  111...EQFKKWDLGDILGAKGKLFKTKTGELSIHCTELRLLTKALPDKFHGLQDQEARYRQRYLDLISNDESRKTRSKILAGIRQFMVARGFMEVETPMMQVIP-----GGASARPFITHHNALDLDMYLRIAPELYLKRLV------VGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADY--KDLIELTESLFRTLA-QDVLGTTQVPYGDEVFDFGKPFEKLTMREAIKKAIAESIGIHVE-KSWGLG............................... 369
293 3.000e-67UniRef50_A0A1W9UC34 Lysine--tRNA ligase (Fragment) n=2 Tax=Proteobacteria TaxID=1224 RepID=A0A1W9UC34_9DELT  ali  15  102.....FGKLDVGDIIGISGKPFRTKTGELSLRAMTLQLLTKSLPEKWHGLTDVEIRYRQRYLDLIVNPEVFRKRSKIISLMREFMQKRDYLEVETPMMHQV-----AGGATAKPFVTYHNTLKMELYMRIAPELYLKRLI------VGGFERVFEINRNFRNEGISIQHNPEFTMMEFYQAYATYN--DLMDMTEEMIGEIA-EEVCGSKVVTYAGKDVDLTAPWQRLT........................................................ 317
294 4.000e-67UniRef50_A0A2M7BQ68 Lysine--tRNA ligase n=6 Tax=Candidatus Shapirobacteria TaxID=1752721 RepID=A0A2M7BQ68_9BACT  ali  17  85...DQTKLFDLGDIISATGIVFKTTAGETTIRVSDFQILAKNLPEKFHGLTDVEERYRQRYVDLIVNPESRKTRSKILSTMRKFLDEHGFMEVETPILQPV-----YGGASAKPFVTHYNELNQNMYLRISDELYLKRLI------VGGLEKVYEVSKDFRNEGVSRFHNPEFTQIEFYWAYVDYDE--LMRFTEQLVSTT-IKTIKKSLTVSFQGKKLDFTPPFPRLT----FRDAIFEKTKIDIDLI.................................... 318
295 4.000e-67UniRef50_A8ABV1 Phenylalanyl-tRNA synthetase, alpha subunit n=2 Tax=Ignicoccus TaxID=54258 RepID=A8ABV1_IGNH4  ali  13  192.GTWKDAEFKKFDLSVEFPARLPKRRHPLLEFHEYVKEVLVSMG--FEEVVGDYVTNAFWNFDVLLVPQFHPARSET-----DVFYASG-ARVPPP---PEGLLEEVAEVHREMWGYWRAEVALKVLLRTHTTVVSAQTMYSRG---GGEYRAFSLDRVFRSETLDPTHSMEFHQLEGIIVGKEVSFKHLLGFFKEFAKKLGLGEVKFKPAYFPFTEPSVEGLGWVEVFPGGMFRPEMLKPLGLDFSVAAWGIGIDRLAMLALGLSDIRDLYSNDL......... 459
296 5.000e-67UniRef50_A0A2K3PM36 Lysine--tRNA ligase n=5 Tax=Pentapetalae TaxID=1437201 RepID=A0A2K3PM36_TRIPR  ali  14  90....LKAHVDIGDILGARGTIKRTEKGELSVCVLSFAILTKSLPDKYHGLTDIDKRYRQRYVDMIANPEVFRKRAKVVSEIRRTMDSLGFVEVETPVLQ-----GAAGGAEARPFVTHHNSLGRDLYLRIATELHLKRML------VGGFEKVYEIGRIFRNEGISTRHNPEFTTIEMYEAYSDY--QSMMNLAEEIVTQCAL-AVHGKLTVDYQGVEICLERPWRRETMHNL----VKEISGINFNELGNDLEVAKQATLSTLGNDLE................ 342
297 5.000e-67UniRef50_A0A251SVZ5 Lysine--tRNA ligase n=42 Tax=Streptophyta TaxID=35493 RepID=A0A251SVZ5_HELAN  ali  16  187....LKSLVDIGDILGASGSIKRTEKGELSVCVNSFLILTKSLPDKFHGLTDVDKRYRQRYVDMIANPEVFRKRAKIVSVIRQTVESVGFIEVDTPVLQ-----GAAGGAEARPFITHHNSLGRDLYLRIATELHLKRML------VGGFEKVYEIGRIFRNEGISTRHNPEFTTIEIYEAYSDY--ESMMNMAEEIVTQCAL-AVNAKLTVDYQGVEINLERPWRRETMHNL----VKEATGIDF....................................... 416
298 7.000e-67UniRef50_A0A202DUZ3 Lysine--tRNA ligase n=1 Tax=bacterium J17 TaxID=1932695 RepID=A0A202DUZ3_9BACT  ali  18  98..FSAFKKFDIGDIVSVSGFTFLTKKGEPSLSAESIRLLVKCLPEKWHGLTDVEVRYRQRYLDLIVNPDVRNARAKIIAAVRHFFDQRGYIEVETPVLSNV-----SSGASARPFETHHNALDLNLKLRIALELPLKRLL------VGGLDRVYEIGRIFRNEGISTEHNPEFTMIEFYQSYA--TYETLMDLTEELITSIC-DEVIGSQKITYRDMKIDFSRPWKRLTMVEAIYE................................................. 323
299 8.000e-67UniRef50_A0A256Z871 Phenylalanine--tRNA ligase subunit alpha n=2 Tax=Thermoprotei TaxID=183924 RepID=A0A256Z871_9CREN  ali  15  218.GSWREALFKKFDLGVEIPTIHPKKKHPYIQFLNYVRYVISNMG--FKEFKGPYVESELWNFEVLFVPQYHPSRRGT-----DVYFIRNE---DLNIDIPEDIIARVKNIHERVLYSWDINKALRPILRTHTTPVSMRAIYELG---GGEYRLFSLDRVFRPDTPDPTHLMEFHQLEGIIVGKKVTFKHLLGFFKEFAKRLGLGDVIFKPAYFPFTEPSVEKLGWIEVFPGGMFRPEVLESVGLKYKVAAWGIGIDRIAMIFLGIDDIRDLYTNDLDV....... 489
300 9.000e-67UniRef50_A0A256YRD1 Phenylalanine--tRNA ligase subunit alpha n=1 Tax=Candidatus Aenigmarchaeota archaeon ex4484_224 TaxID=2012503 RepID=A0A256YRD1_9A  ali  15  135.GIWRVVKFKKFNVRAEGKKEYPGKIHPYIQLINLVRQKLLSLG--FKEVNGPLVELNFWNCDALFMPSDHPARS-----IHDIFLLKNFGEIDKKVWENVKKAHLNGFNTKSKGWGFWDELAKRYILRSHGTAVSARTLA-KLKEKDLPFKMFTIAKVFRPDVIDAKHFIEFDQVEGIVVAKNLNFKHLLGFLKEIAVEIGVKKVKFKPSYFPFTEPSVEGYIWLEFGGAGIFRKEVTYPLGIKYPVLAWGLGLGRLAMQILKINDIRYLFSDNLD........ 413
301 1.000e-66UniRef50_A0A1X7JGN1 Lysine--tRNA ligase n=2 Tax=Dethiosulfovibrio salsuginis TaxID=561720 RepID=A0A1X7JGN1_9BACT  ali  16  109.....KKWIDAGDIVGIEGHPFRTKRGELTIAVTRCVLLCKALPEKWHGLTDMEVRYRKRYVDLIANPEVRRQRAKIISSVRKTLEDHGTLEVDTPILSYL-----AGGANARPFVTHHNALDLDMYLRIATELHLKRLV------VGMMGRVYEMGKNFRNEGMDAMHNPEFTAMEVYWPYCDYN--DMMDLTEEIIRKAAVDA-TGSTTVNWQGTELDLAKPFRRISMVDL----VKEHCGVDFDAIE................................... 341
302 1.000e-66UniRef50_A0A2H9QE33 Phenylalanine--tRNA ligase subunit alpha n=2 Tax=unclassified Diapherotrites TaxID=1046942 RepID=A0A2H9QE33_9ARCH  ali  12  227......KIIRNYNIQDPVEEVYPGKKQPYYKFVDEIKQKLVSLG--FKEMENPLIVQEFYNFDVLFQPQNHPARTWT-----DTYKLKKPTHGKLPIVETIKNAHENGGESMGWNYEWSEKIAEQLMPSAHGTAHSARQLV---KGIEVPGKYFTLARCFRPDVVDATHLIEFNQMEGFVVGKDFTLRKLLGLLKEFAVEIGAEKVKFLPDYYPFTEPSVQLNGWVEFGGAGIFRAEITENLGIKEKCLAWGLGMDRLAMFKLKLNDIRELFSQNLD........ 499
303 1.000e-66UniRef50_Q7N1C8 Lysine--tRNA ligase n=1229 Tax=root TaxID=1 RepID=SYK_PHOLL  ali  16  110...EQFKKWDLGDILGARGKLFKTKTGELSIHCTELRLLTKALPDKFHGLADQETRYRQRYLDLIANEESRKIRSQVLLALRSFMVSKGFMEVETPMMQVIP-----GGAAARPFITHHNALDIDMYLRIAPELYLKRLV------VGGFERVFEINRNFRNEGVSPRHNPEFTMMELYMAYADY--KDLIVLIEELFRTL-TQNILGNTLVKYGEQEFDFGKPFAQMTMKEAIRPEIAESLGIEVE-KGWGLG............................... 368
304 1.000e-66UniRef50_A0A1V5R1N1 Lysine--tRNA ligase n=1 Tax=Candidatus Dependentiae bacterium ADurb.Bin331 TaxID=1852840 RepID=A0A1V5R1N1_9BACT  ali  15  362..ESLKQTIDIGDLVWVTGKSFRTKMGEITLEVTQFVLLSKCLPEKFHGLTDVEVRYRQRYLDLISNTESREKRSAIIKSIRTFLDEHNFLEVETPMLHPI-----AGGAAARPFITHHNALGDDFYLRIAPELYLKRLV------VGGFERVYEINRNFRNEGISTRHNPEFTMLEFYWAYHDYHF--IMSFVEQLMR-FAVEKSCETLQVPFGETVIDFAKPFKRIS----VKNAVLEHLNIKQD...................................... 594
305 1.000e-66UniRef50_K9U0A2 Lysine--tRNA ligase n=10 Tax=cellular organisms TaxID=131567 RepID=K9U0A2_9CYAN  ali  15  106....LKQLTDAGDILGAKGTIKRTEKGELSVFVNQYAILTKSLPDKWHGLTDVAKRYRQRYVDLIVNPEVRRRRAQITAGIRRFLEQQGFIEIETPVLQ-----AEAGGADARPFITHHNTLEMDLYLRIATELHLKRLV------VGGFEKVFELGRIFRNEGVSTRHNPEFTSIEIYQAYADY--HDVMQLVENIITTV-TREVLGTLQITYQDEAIDLTPPWRRVTMHDL----VQEKTGLDF....................................... 335
306 2.000e-66UniRef50_A0A256YWM8 Uncharacterized protein n=1 Tax=Desulfurococcales archaeon ex4484_42 TaxID=2012520 RepID=A0A256YWM8_9CREN  ali  17  2...................................FREIMRDLG--FEEIDGDYVELEFWNFDALFQAQDHPAR-----DIHDTLQVLNPQLGSLKGIERVKEVHENGGGSRGWGYRWSLDIARRVILRTHTTALTIKYLAYHK---EPPIRVFTIGRVFRAESIDYKHLPEFYQLDGIIMEKGFTFRKLLGLLKEVAYRIGVKELKFKPGYFPFTEPSVEGIGWVEVFGAGLFRPEILHALGVKYPVGAWGLGLERFAMAVLGFNDIRDLFSYDV......... 244
307 2.000e-66UniRef50_I1JMN9 Lysine--tRNA ligase n=58 Tax=Viridiplantae TaxID=33090 RepID=I1JMN9_SOYBN  ali  15  164....LKAHVDIGDILGVRGTIKRTEKGELSVSVLSFAILTKSLPDKYHGLTDIDKRYRQRYVDMIANPEVFRRRAKVVSEIRRTMDSLGFVEVETPVLQ-----GAAGGAEARPFITYHNSLGRDLYLRIATELHLKRML------VGGFEKVYEIGRIFRNEGISTRHNPEFTTIEMYEAYSDY--QSMMNLAEEIVTRCAL-AVHGKLTIDYQGVEICLEKPWRRETMHNL----VKETAGIDFNELANDLEVKRVTLDTLGKN................... 414
308 2.000e-66UniRef50_A0A2G9YL91 Lysine--tRNA ligase n=2 Tax=unclassified Candidatus Omnitrophica TaxID=1047005 RepID=A0A2G9YL91_9BACT  ali  19  85VGEEKFNTLDIADIISVKGELFKTHAGELTVKAEDFVVLAKALPEKWHGLKDVELRYRQRYLDLIANEEVFLMRSRIIRTIRNFLDDKGFLEVETPMMHPIP-----GGAAGRPFKTHHNEYDSDLYLRIAPELYLKQLL------VGGLDKVYEINRSFRNEGVSTKHNPEFTMLEVYRAYANY--EDMMQLAEELIIYVA-KEVLGDLSFLYQGKTVELSPPWQRRS----FAELVKEKFGIEPDD-------EAPVMLK....................... 330
309 3.000e-66UniRef50_A0A2E0XMM0 Lysine--tRNA ligase n=2 Tax=Bacteria TaxID=2 RepID=A0A2E0XMM0_9BACT  ali  16  100.....YKKFDVGDLIGVEGPVFRTRTGEVTVMANRFQLLSKSLPEKFHGLQDIETRYRQRYADLIVNPQVFIHRTQIIQSIRTYLNQRGFLEVETPILQPI-----YGGANARPFITHHNTLGMDLYLRIANELYLKRLI------VGGIDRVYEFAKDFRNEGMDRDHNPEFTMIELYQAFADY--QDMMRLTENLVSHVAQT-VFGQTEIQYQETAICYDPPWPRMTMFEAIKKVV----GIDV....................................... 328
310 3.000e-66UniRef50_A0A0G1MXV4 Lysine--tRNA ligase n=66 Tax=unclassified Bacteria TaxID=2323 RepID=A0A0G1MXV4_9BACT  ali  21  88IGQEKYKLFDIGDFIAVKGEFFKTQKGERTLLVHDCQFLAKALPEKWHGLKDMEERFRRRYLDLLMNEEVFKKRSQIIRNLREFFDEEGFMEVETPILQPLP-----GGALAKPFKTHLNALDMDLYLRIAPELYLKRLI------VGGLEKIYEIGRCFRNEGMDKSHNPDFTILEFYWAYANY--EQLMDLTERMFGSLA-----GGETIKYQNEDIDLKLPFKRVTM----RDLLLEELKIDIDQA.................................... 324
311 4.000e-66UniRef50_E1QNX6 Phenylalanine--tRNA ligase alpha subunit n=10 Tax=Thermoprotei TaxID=183924 RepID=E1QNX6_VULDI  ali  12  228.GAWRNVVIKRFDLSIPTPQAPIVTKHFFSEFLKFVKEVFISLG--FEEVYGPHIELELWNFDALFQAQDHPAR-----EIHDTYFLKYPSTLDGELMNRIARTHEDGWITGSWGYKWDPGRAVRLVLRTQTTSVSVRTLYKRGD---GEYRAFTIDRVFRPEVLDPKHSMEFHQADGIVVGENLSFKHLLGILEALARGMGLRKVMFKPAYFPFTSPSHEKLGWIEFVGSGIFRPEVVMPLGIKRRVLAFGMGLDRIAMILMNIEDIRDLFSRDINV....... 506
312 6.000e-66UniRef50_A0A1F8QB36 Lysine--tRNA ligase n=3 Tax=Chloroflexi TaxID=200795 RepID=A0A1F8QB36_9CHLR  ali  16  110...ELLKNIDVGDFIGASGRLFRTKTQEPTVAVQEFTLLAKSLPEKWHGLSDTEIRYRQRYLDLIANSEVKDIRSRIVAAVRQFLDRRGFIEVETPVLQ-----ASAGGALAAPFVTHHNALDRDFTLRIALELHLKRLI------VGGFDKVYEIGRVFRNEGISTTHSPEYTLLESYEAYADYN--DVMEMVEEMIPRV-SQEVLGTPEIKYGENTVNLKSPWRRIA----LRDAVREYSGIDFVKYPTAAGL----MEKMRSMNIE................ 359
313 6.000e-66UniRef50_A0A0M2SSG3 Lysine--tRNA ligase n=30 Tax=Bacteria TaxID=2 RepID=A0A0M2SSG3_9BACI  ali  16  95VGEEQYAIFDLGDLVGVEGTLFKTKVGELSIKVTDFVFLTKALPDKFHGLKDIEQRYRQRYLDLIVSDESRQTRSRIIQAMRRYLDDQGYLEVETPMMHSI-----AGGASARPFITHHNALDMTLYMRIAIELHLKRLI------VGGLEKVYEIGRVFRNEGVSTRHNPEFTMIELYEAYADY--RDIMSLTENLIAHVA-QEVLGTTTVQYGEHEIDLKPEWKRLHMVD----AVKEYTGVDF....................................... 331
314 6.000e-66UniRef50_A0A1G9YNC0 Lysine--tRNA ligase n=37 Tax=Bacteria TaxID=2 RepID=A0A1G9YNC0_9BACI  ali  16  95VGEEAYELFDIGDIIGVTGTVFKTKVGELSVKASEFQMLTKSLPDKFHGLKDVEQRYRQRYLDLITNPESKETRSKIIQSMRRYLDSNGFLEVETPMMHGI-----AGGASARPFITHHNALDIPLYMRIAIELHLKRLI------VGGMEKVYEIGRVFRNEGVSTRHNPEFTMLELYEAYAD--FHDVMSLVENMVAHIA-KEVLGSTTVKYGDNDVNLEPEWTRLHMVD----AVKEYTGVDF....................................... 331
315 7.000e-66UniRef50_A0A257ANP0 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Candidatus Bathyarchaeota archaeon ex4484_205 TaxID=2012510 RepID=A0A257ANP0_9AR  ali  17  196.GKWKKTRFKPYNLAVTPPPLWIGKKNPYIEFVNMAREILIEMG--FEEYKGPWIEMEFYHFDALFQPQDHPARELF-----DTFHVSFPEVGKIPYLTKVKRTHENGWETGSWRYNWSERVASRRILRGQTTSVSIRYLTTHK---EPPIRMFTIDDCFRYDVMDATHSIQFKQAEGIVGERGITLKELFGILEEFAKRLGFKEIKFVPSYFPFTEPSCEALGWIECLGAGIFRPEVLKPLEIDFPVLAWGIGIDRLAMAILGINDIRKIRRPDL......... 471
316 7.000e-66UniRef50_UPI000BB9020D lysine--tRNA ligase n=3 Tax=cellular organisms TaxID=131567 RepID=UPI000BB9020D  ali  17  111...EQFKKWDLGDILGAKGKLFKTKTGELSIHCTELRLLTKALPDKFHGLQDQEARYRQRYLDLISNDESRKVRSQILSGIRQFMVNRGFMEVETPMMQVIP-----GGAAARPFITHHNALDLDMYLRIAPELYLKRLV------VGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADY--KDLIELTESLFRTLAQEXLARRNDVNPITDRFEFFIGGREIGNAQRFLDQVAKDAGDDEPTAGLGIGIDRMVMLFTNSHTIRDV.............. 403
317 8.000e-66UniRef50_A0A1V4M6P6 Lysine--tRNA ligase (Fragment) n=1 Tax=Firmicutes bacterium ML8_F2 TaxID=1775675 RepID=A0A1V4M6P6_9FIRM  ali  17  96..YDLLELIDIGDFIGVVGEVFKTRKGEVTVQASDYTFLVKALPEKWHGLKDVEIRYRQRYVDLIVNQEVKQTRSKIISTMRELLNSWGFLEMETPIMQTI-----AGGALARPFVTHHNALDIKLYLRIATELHLKRLL------VGGLDKVYEIGRIFRNEGISTIHNPEFTSVEIYQSYADY--KDMMNITENLIFQIA-EKVFGSGKIRFQGREIDLTPPWERQSMIEVVR----RYTGVDF....................................... 327
318 9.000e-66UniRef50_Q9LJE2 Lysine--tRNA ligase, chloroplastic/mitochondrial n=50 Tax=cellular organisms TaxID=131567 RepID=SYKM_ARATH  ali  14  177..FEQLKQFDIGDILGASGSMKRTEKGELSICVNSFSILTKSLPDKYHGLTDIDKRYRQRYVDMIANPEVFRRRAKIVSEIRKTVESFGYLEVETPVLQ-----GAAGGAEARPFVTFHNSLGRDLYLRIATELHLKRML------VGGFEKVYEIGRIFRNEGISTRHNPEFTTIEMYEAYSDYHS--MMDMAELIVTQCSM-AVNGKLTIDYQGTEICLERPWRRETMHNL----VKEITGINFSELGEDLG............................... 417
319 1.000e-65UniRef50_A0A0N8HZL6 Phenylalanine--tRNA ligase alpha subunit n=3 Tax=Archaea TaxID=2157 RepID=A0A0N8HZL6_9EURY  ali  15  2............................LRQAAERVKDVLVGMG--FQEMDGPHADADFWINDALFMPQDHPARTHWDRFALDV----DPIE-ELPLLQAVENAHREGVGPDGDGYHWSEEFAREVALRGHTTSLSMRYLSGAAEDLEPPQRYFSVEKAYRNDTIDSTHLLEFFQIEGWVMAEELSVRDLMGTFEEFYAQFGITDVQFKPHYNPYTEPHPETDELIEIGNSGIFREEVLSPLGVECDVMAWGLALERLAMLYTGAEDIRDLHGTLADLEFLRN.. 261
320 1.000e-65UniRef50_A0A2V9HYL4 Lysine--tRNA ligase (Fragment) n=2 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V9HYL4_9BACT  ali  18  101..FELYKLLDLGDLIGVEGYLFRTRTGELSVHAERLQFLAKALPEKWHGLTDVQIRYRQRYLDLMVNPQVFERRSKLVGALREFLESEGYLEVETPMMQPL-----AGGAMARPFVTHHNALDIDLFLRIAPELYLKRLI------VGGLDRVYEINRNFRNEGISTQHNPEFTMLEFYQAYADY--RDMMELTERILRHVA-QAVVGSLEFD-YGEHHISLAEFQRLTMAEAI................................................... 323
321 2.000e-65UniRef50_Q15046-2 Isoform Mitochondrial of Lysine--tRNA ligase n=93 Tax=Eukaryota TaxID=2759 RepID=Q15046-2  ali  17  171.....NNKLRRGDIIGVEGNPGKTKKGELSIIPQEITLLSPCLPHLHFGLKDKETRYRQRYLDLILNDQKFIVRSKIITYIRSFLDELGFLEIETPMMNIIP-----GGAVAKPFITYHNELDMNLYMRIAPE------LYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADY--HDLMEITEKMLSGM-VKSITGKITYHPDGYEVDFTPPFRRISMV----EELEKALGVKLP...................................... 407
322 2.000e-65UniRef50_A0A1Q7FCH2 Lysine--tRNA ligase n=9 Tax=Terrabacteria group TaxID=1783272 RepID=A0A1Q7FCH2_9CHLR  ali  13  95..FDLFADLDAGDLIGAKGPIFRTRRGEVTLEIHSFQLLTKSLPEKWHGLKDVEIRYRQRYVDLIANPEVRRARTKIIAGLRNLLDQAGFLEVETPVLQEVP-----GGGHARPFVTHHEALSRDLFLRIALELHLKRLL------VGGFERVYEIGRVFRNEGLSPRHNPEFTMLECYEAYADYN--DVMRLVEDMVVT-ATAAAGRSANTRYQGEEINLAPPFRRERMADLVRQAVGKELNLREPTFVTDYPIEISPLARRRDDDPRFVERFEL......... 375
323 2.000e-65UniRef50_A0A1H9VTF4 Lysine--tRNA ligase n=3 Tax=Bacteria TaxID=2 RepID=A0A1H9VTF4_9BACI  ali  16  97VGEEAYDLFDIGDIIGVTGTVFKTKVGELSVKADEFQILTKSLPDKYHGLKDVEQRYRQRYLDLIMNPEVRDLRSKILQSMRRYLDGQGFLEVETPMMHSI-----AGGASARPFETHHNALDMTLFMRIAIELHLKRLI------VGGMEKVYEIGRVFRNEGISTRHNPEFTMIELYEAYADY--KDIMTLTENVIAHVA-EDVLGTTVVEYDEYKLDLTPEWKKVHIADIIK----EYTGVDF....................................... 333
324 3.000e-65UniRef50_A0A1F7VE86 Lysine--tRNA ligase n=1 Tax=Candidatus Uhrbacteria bacterium RIFCSPLOWO2_02_FULL_49_11 TaxID=1802409 RepID=A0A1F7VE86_9BACT  ali  19  91.GYDRLETLDVADFIEAKGVFFRTKVGEPTLLAESVRIIAKALPEKWHGLQDPELRYRKRYLDFLVNMDAKKARIALTQAIREFFNAHGFLEVETPILQPIP-----GGASARPFVTHHNALDTDFYLRVAPELYLKRLI------VGGFEKVYEIARCFRNEGMDRAHNPEFTQIEFYWAYADY--RDLMQLSEELMSFL-LERIVGSATISLGGKEIDCKPPYPRLT----FQEALEKKAGI......................................... 322
325 3.000e-65UniRef50_C4QNZ6 Phenylalanyl-tRNA synthetase alpha chain,putative n=12 Tax=Eukaryota TaxID=2759 RepID=C4QNZ6_SCHMA  ali  14  3..................................................TNNYVECSFWNFDSLFQPQQHPAR-----DAHDTFFLSDPETVETCYIDKVRTVH-SQGAFGSRGYQWLMEEAEKNLLRTHTTAVSARMLHALSKKNPFPAKYYSIDRVFRNENLDATHLAEFHQVEGLVADFGLSLGHLKSVIRTFFSKLGLTQLRFKPAYNPYTEPHPGLKKWVEIGNSGLFRPEMLRPMGLPESVIAWGLSLER............................ 221
326 3.000e-65UniRef50_A0A0S7WDZ1 Lysine--tRNA ligase n=2 Tax=Bacteria TaxID=2 RepID=A0A0S7WDZ1_9BACT  ali  18  86LGEERFQLFDVGDFLGVQGEVFKTKTGEITVFARHFTVLSKALPEKWHGLKDIETRTRQRYLDLIANPKVFKTRSQIIHFIRDFLNQRGYVEVETPILQPI-----YGGAAAKPFSTHHEVLDKEVFLRIADELYLKRLII------GGFEKVYEISKDFRNEGMDRLHNPEFTMLEGYEAYSDYTQ--IMDLIEAMFEGLC-ERIKGSSLFEYGGQEIRFVRPWRRVQFVEILTHNL............................................... 318
327 3.000e-65UniRef50_D0LI95 Lysine--tRNA ligase n=1 Tax=Haliangium ochraceum (strain DSM 14365 / JCM 11303 / SMP-2) TaxID=502025 RepID=D0LI95_HALO1  ali  18  118.......RLDVGDQVGAEGVIFWTKRGELSLLCTHFHILSKSLPDKWKGLTNVETRYRQRYLDLAVNPEVRRKRSQILRGLRRFFDARAFLEVETPMMHPV-----IGGAAARPFVTHHNALDLTLYLRIAPELYLKRLL------VGGFDRVYEINRSFRNEGLSRAHNPEFTMLEFYQAYADY--RDLMDLTEELFTELA-QEVNGTLETTWDGKAIDLARPWQRLS----VRRAVTEVAGRSPEVFD................................... 348
328 4.000e-65UniRef50_A0A1G2XB08 Lysine--tRNA ligase n=2 Tax=PVC group TaxID=1783257 RepID=A0A1G2XB08_9BACT  ali  17  96..WDLIKLLDLGDVIGAEGTLGLTKTGELTIWTTKVIMLSKCVPEKFHGLADIELRYRQRYVDLWANPEVFKKRIAMVATIRNFLQAKGFFEVETPMMQSL-----AGGAAAKPFITHHNALDIDLYLRIAPELFLKRLL------VGGMEKVFEVNRNFRNEGLSPRHNPEFTMMEIYQAYADYNI--MMDLSEEMICLL-VEKHCEGTTLQYGEMRIDYSRPWRRASY----RDLVKEYAGCDIQDIA................................... 331
329 7.000e-65UniRef50_A0A2T9X105 Phenylalanine--tRNA ligase alpha subunit n=2 Tax=Sulfolobales TaxID=2281 RepID=A0A2T9X105_9CREN  ali  14  191.GAWKNAKIRPFNVEAFPRFFHLGKKHFFREFLERIRDVMRSLG--FSEVSGDYVEMELYNFDLLFQPQDHPAR-----EIHDSFTL-GLKARSAPLMERVRRMHE-----ESWKYRWNQETALRLMLRSQTTAVTARILATKP---EPPVRVFTIGKVFRPDTIDATHLIEFHQLDGLVIEEGYSFRDLLSDLKEIFYRMGVKEVKFKPAYFPFTEPRIEGLGWVEMCGAGMLRDEILRTVDVSTQAGAWGIGLDRLAMLFNHLNDIRLLYSYDV......... 457
330 7.000e-65UniRef50_UPI0004969BAD lysine--tRNA ligase isoform X1 n=2 Tax=Stegastes partitus TaxID=144197 RepID=UPI0004969BAD  ali  16 1441.....NNKLRRGDIIGVRGNPGKTKKGELSIVPSEMFLLSPCLPHLHFGLKDKETRYRQRYLDLILNDQKFITRSKIITYLRNFLDQMGFLEIETPMMNIIP-----GGAVARPFVTYHNELDMNLYMRIAPE------LYHKMLVVGGLDRVYEVGRQFRNEGIDLTHNPEFTTCEFYMAYADY--HDLMEITEKLLSGM-VKHITGKVTYHPDGYEIDFTPPFKRVSMT----HDLEKIMGVKFP...................................... 1677
331 8.000e-65UniRef50_A0A1W9LT65 Lysine--tRNA ligase n=14 Tax=Bacteria TaxID=2 RepID=A0A1W9LT65_9DELT  ali  18  101....LFGKLDIGDFVGVKGGMFKTKTGEWTLLVRDLKLVCKSLPEKFHGLKDPEKRYRQRYIDLIMNADVRDIRSRIIQSIRNFLMDRDFLEVETPMMQAIP-----GGAEATPFKTHHNALNMDMYLRIAPELYLKRLV------VGGFERVFEINRNFRNEGVSTQHNPEFTMLEFYQAYS--TYHDLMDMTEEMFRYV-SRQITGSETLVYQGNTIDLSGKWRRMTLAESLAEL----GGVDPAILG-----DKEKMLAFADDN.................. 346
332 8.000e-65UniRef50_A7IAT4 Lysine--tRNA ligase n=1 Tax=Methanoregula boonei (strain DSM 21154 / JCM 14090 / 6A8) TaxID=456442 RepID=A7IAT4_METB6  ali  19  103.....NQYIERGDFVGVTGHVFRTKLGEITIWVDKIQLLTKALPEKFHGLTDVEKRYRQRYVDLIANEEVRRNRSRILSSIRRYLSERDFLEFETPILQPV-----YGGANARPFTTFHNCLGQKLFLRIAPELYLKRLV------VGGFERIFEIARNFRNEDIDTHHNPEFTMVEIYWAYHD--VYDMMDLTEDFLATL-VQEVHNKTEITFEGTSISFAKPLRRLSMAD----AVKEYAGIDI----FALSVDEL........................... 339
333 9.000e-65UniRef50_A0A286TY28 Lysine--tRNA ligase n=2 Tax=Bacteria TaxID=2 RepID=A0A286TY28_9BACT  ali  16  85VGEEKFRLLDLGDIIGVEGGVFKTRTGEITVFADDFTVLSKALPEKWHGLKDVEIRYRQRYIDLSSNDDVFLKRSNIIKSIRNFLDKRNFVEVETPMMQSIP-----GGAVAKPFITHHNVLDMDLFLRIAPELYLKRLL------VGGMERVYEINRNFRNEGLSTRHNPEFTMMELYQAYSDYNG--MMELTESLVTGLAQDMYSKFE--IPYGESIDLSPPWKRCTFSDLLSKDLDDEEGLKAKGKELGIEVE............................. 339
334 9.000e-65UniRef50_A0A2E9N8F5 Lysine--tRNA ligase n=7 Tax=root TaxID=1 RepID=A0A2E9N8F5_9CHLR  ali  20  99.GFDLLKDLDIGDHLGVRGDLIRTRTGQVTIDAMELTVTAKPLPEKRHGLKDVETRYRQRYLDLIANQDVFVLRSKVVRGIRRFLDDRGFLEVDTPILVPVAA-----GAHAKPFVTHHNALDQQLYLRIATELYLKRLII------GGFDKVYEIGRVFRNEGIDQDHNPEFTLLESYEAYADYN--DVMEMVEQMVSTIAVD-VNGSTEVCIGGQVIDFAPPWQRVS----LREELQKHSGIDLE...................................... 333
335 1.000e-64UniRef50_A0A2H9LFE2 Phenylalanine--tRNA ligase subunit alpha n=1 Tax=Candidatus Diapherotrites archaeon CG08_land_8_20_14_0_20_30_16 TaxID=1974403 Re  ali  13  201..SYKKVNFKPYNVVSEVDPLFLGKYQPYLRFLDLVKQKLVGMG--FEEMPTDLITTEFYNFDVPFQPQNHPARTWS-----DTYSLKRPSLGDLPLVNKVKAAHESGGNTGSKGWKWQESIAQKLMPVAHGTAFSARLLSQG---VDSPKRYFAFSRVYRPDVIDATHLSEFNQLEGFVLGKDISFKHLLGLLSQFAKEFGAEEIMFTPCYYPFTEPSASLHGWVELGGSGIFRPEFTETLGIKERVIAWGIGIDRLAMFNLDITDIRDLFSTKLD........ 477
336 1.000e-64UniRef50_T1C074 Phenylalanyl-tRNA synthetase, alpha chain (Fragment) n=1 Tax=mine drainage metagenome TaxID=410659 RepID=T1C074_9ZZZZ  ali  16  2..............................................FTEMRGHYVEYTGWNMDALFIPQDHPAR-----DLQDTFYLESKFKPEFEHPEILDIVSRSHERGVRWGYKFNLKEAQRLVLRTHTTVSTIRSLYEN---HEPPVAIFSVEKVFRHESVDWRHLAELHQVEGAVYAKDANLSTLKGLMRHFYHELGFDDLEFIPSYYPYTEPSMLDEKEIELGGSGIFRPEVTIPVGLKYPVIAWGLGLERLAMILYGLKDIREIYNSDID........ 233
337 1.000e-64UniRef50_A0A1W9R7N6 Lysine--tRNA ligase n=4 Tax=Bacteria TaxID=2 RepID=A0A1W9R7N6_9BACT  ali  20  72.GYQVFTSLDVGDIIGVKGVLFKTRTGEPTLLVREVKLLAKSLPEKWHRLKDVEVRYRQRYLDLISNPQVFLGRSKVISFIRDFFAKEEYIEVETPMLHPL-----AGGASGKPFVTRHLSLDCDVYLRIAPELYLKRLL------VGGFDKIYEINRSFRNEGLSSRHSPEFTMLEAYCAYQNYEY--MMEVCEKLFSSL-LEYLYGRLEINYQGYSIDFTPPWLRVSLAEI----LEEELGIK........................................ 303
338 1.000e-64UniRef50_A0A2H0T7E9 Lysine--tRNA ligase n=6 Tax=Parcubacteria group TaxID=1794811 RepID=A0A2H0T7E9_9BACT  ali  18  101.......NLDMGDFIETRGTLFLTHKGEKTLNANNIRLLSKALPEKWHGLSDTEIRFRQRYLDMLANPSVRHTRSIIIKAIRSFLDDKGFLEVDTPILQPL-----AGGATAKPFKTHHNALDIDLYLRVAPELYLKRLL------VGGFEKVYEVSRCFRNEGIDHSHNPEFTQVEFYWAYSDY--EQLMKMTEKFLEYIALSATRQSLQFEFDGKKFSLKAPYKRIT----FREAILKTAKIDIDKVRDRDELAKLAK......................... 349
339 2.000e-64UniRef50_A0A2H0SHX1 Lysine--tRNA ligase n=18 Tax=Bacteria candidate phyla TaxID=1783234 RepID=A0A2H0SHX1_9BACT  ali  17  89..FDFLKLLDIGDFLAVQGKVFKTKAGEISVLTKDFQLLTKSLPDKWYGLKDLEERYRKRYLDILMNPEVFEARSKIVAAMREFLIRKGYIEVETPILQPI-----YGGGLARPFKTYHNALGIPLYMRVSTELYLKRLI------VAGFEKVFEIAKVFRNEGIDKNHNPEFTMLETMEAYVDYKYN--MRLVEEM-TEYAVKRTIGSTKVNYQGREIDFKAPWKRMTMI----EAVKKFTGIDF....................................... 320
340 2.000e-64UniRef50_A0A1Y0D3F6 Lysine--tRNA ligase n=44 Tax=root TaxID=1 RepID=A0A1Y0D3F6_9GAMM  ali  17  105........LDIGDIIGVTGILHKSGKGDLYVSMDNFQLLTKALPEKFHGLTDQETRYRQRYLDLITNEDSRQVRSQVMASIRQFMNGHGFMEVETPMMQVIP-----GGASARPFITHHNALDMDMYLRIAPELYLKRLV------VGGFEKVFEINRNFRNEGLSPRHNPEFTMMEFYWAYANY--QDLMDFTEEMLRTV-TTEVLGSSTVQYGEETFEFGQPFARLGMKDSFNPEVTKDLKIKTE-KNWGLG............................... 358
341 2.000e-64UniRef50_A0A1E3H8P5 Phenylalanine-tRNA ligase, alpha subunit, variant n=1 Tax=Cryptococcus amylolentus CBS 6039 TaxID=1295533 RepID=A0A1E3H8P5_9TREE  ali  14  209.GAWKSSDFKQYNFAATGVPTDGGALHPLLKVREEFQKIFFDMG--FTEMTNRFVESAFWNFDAMFVPQQHPAR-----EMQDTFYVKNPVKALKPDSEYYERVRKIHGGFGSIGYRFNQDESEKLLLRTHTTAVTTDMLYKLANQPGGPAKMFSIDRVFRNETADATHLAEFHQVEGLVADYDITLGHLIAFMQEFFGKTGNTKLRFKPAYNPYTE.................................................................... 424
342 2.000e-64UniRef50_C1F9C4 Lysine--tRNA ligase n=4 Tax=Acidobacteriaceae TaxID=204434 RepID=C1F9C4_ACIC5  ali  17  102..FDVYKLLDLGDHIGVTGYLFRTRTNELSVHVETLTFLAKAMPDKYHGLEDVELRYRQRYVDLFMNPEVREKRAKVLAATRKFFDSRGYVEVETPMMQPI-----AGGAAARPFITHHNALDIDLYLRIAPELYLKRLV------VGGLDRVYEINRNFRNEGISTQHNPEFTMLEFYQAYANY--HDLMKLTEEFITFVAQEVNGTTVTEFPIPKEIDLA-KWRRFTMREAIIEFWPDEFGAKPTEAEIAFSIDQVLM......................... 359
343 2.000e-64UniRef50_A0A2N7QBX6 Lysine--tRNA ligase n=1 Tax=Candidatus Aminicenantes bacterium TaxID=2052149 RepID=A0A2N7QBX6_9BACT  ali  18  114..YELFELFDIGDVILVEGRLFRTRTGELTVLAEKFSFLAKSLPEKWHGLQDVELRYRKRYLDLIMNPETFLIRSQLIAKIRKFFDDRGFIEVETPMMQVIP-----GGALARPFKTFHNALGIDLYLRIAPELYLKRLI------VGGMEKVYEINRNFRNEGVDSQHNPEFTMLEFYQAYINY--HQLMDLTEELFLYLA-REIHRKEELQYGDQSISFKRPWKRIK----FREAILEYGGLSP....................................... 345
344 3.000e-64UniRef50_A0A0J7KHJ7 Putative phenylalanyl-trna synthetase alpha chain n=1 Tax=Lasius niger TaxID=67767 RepID=A0A0J7KHJ7_LASNI  ali  17  193.GAWKNKKFKPYNFEALGAALQVGHLHPLLK-----------------------VRQEFR---------------KIFLEM-----------------------GKGGYGSQGYRYDWKLEEAQKNLLRTHTTAVTARMLYKLMQEGEKPVKYFSIDRVFRNETLDATHLAEFHQIEGVIANYRLSLGDLIGTLYEFFKKLGITQLRFKPAYNPYTEPHNGLEKWIEIGNSGMFRLLLPLNLPPDVNVLGWGLSLERPTMIKYGLNNIRDLVGPKVDMEMVYNN. 424
345 3.000e-64UniRef50_G2KPC0 Lysine--tRNA ligase n=2 Tax=Micavibrio aeruginosavorus TaxID=349221 RepID=G2KPC0_MICAA  ali  15  162........FDIGDIIGAEGTVRRTPRGELSVRAKKVTMLTKSLPEKYHGLTDVEQRYRQRYLDLIMNDESRQKRSKIISTIRKFMEEHGAIEVETPMMHPI-----LGGASAKPFVTHHNALDADFFLRIAPELYLKRLIVGGLADA-----VFEINRNFRNEGISYKHNPEFTMIESYHAYKDY--YDVMDLIEKLVQAVAM-AVHGTLEINFQGNVINLGSPWARKGMVEL----VQEETGVDF....................................... 388
346 3.000e-64UniRef50_P43825 Lysine--tRNA ligase n=5432 Tax=root TaxID=1 RepID=SYK_HAEIN  ali  21  109VGTW-----DLGDIVGIKGTLFKTKTDELTVKTTEVQLLTKALPDKFHGLTDQEVRYRQRYLDLISNEESRRIRSKVVAGIREYFISKGFMEVETPMLQVIP-----GGASARPFVTHHNALDVDMYLRIAPELYLKRLV------VGGFERVFELNRNFRNEGVSVRHNPEFTMLEYYQAYADY--HDLMDNTEELLRKLAID--ILGTTIVKYGDEFDFGKPFERITLKGIVKEDLAERLGIEVQ-KSWGLG............................... 367
347 3.000e-64UniRef50_S9WCV9 Lysine--tRNA ligase n=4 Tax=Amniota TaxID=32524 RepID=S9WCV9_CAMFR  ali  16  210.....NNKLRRGDIIGVQGNPGKTKKGELSIIPYEITLLSPCLPHLHFGLKDKETRYRQRYLDLILNDQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIP-----GGAVAKPFITYHNELDMNLYMRIAPE------LYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADY--HDLMEITEKMISGM-VKHITGSYKVTYHPDEIDFTPPFRKISMVEELEKALDMKL........................................... 445
348 3.000e-64UniRef50_A0A0G0MEF6 Lysine--tRNA ligase n=4 Tax=Parcubacteria group TaxID=1794811 RepID=A0A0G0MEF6_9BACT  ali  20  100.......NFDIGDFIEARGILFLTKKGEKTLETADYNMLTKSLPEKWHGLQNIEERYRKRYLDLIFNPEVKKKRSNIIKEIRYFLEYKGFLEVETPILQPI-----YGGASAKPFKTHLNVMDMDLYLRISPELYLKRLL------VGGFEKIYEIGRCFRNEGVDKAHNPDFSMLELYWAYADY--KDLMKFIEEMIPCL-VKKFFGGYKIKYEDKELDFKPPFPRVEFGEIFK----KYTGIDLDEI.................................... 329
349 4.000e-64UniRef50_UPI0003C10F1C phenylalanine--tRNA ligase alpha subunit-like n=1 Tax=Latimeria chalumnae TaxID=7897 RepID=UPI0003C10F1C  ali  17  32.GSWREKKFKAYNFDALGVMPESGHLHPLMKVRTQFRQIFLEMG--FTEMTNNFIESSFWNFDALFQPQQHPARDQ-----HDTFFVSGKSPLSLPVLYLRQFLQANSEDSDRYKYEWKIEEARKNILRTHTTAVSARMLYKLAQQEKFPVKYFSIDRVFRNETLDATHLAEFHQIEGVVADYGLTLGDLMGVLHQFFTKL.................................................................................... 229
350 4.000e-64UniRef50_UPI0007AD7FAC lysine--tRNA ligase isoform X4 n=3 Tax=Eukaryota TaxID=2759 RepID=UPI0007AD7FAC  ali  16  178.....NSKLRRGDIIGVEGNPGKTRKGELSIIPYEITLLSPCLPHLHFGLKDKETRYRQRYLDLILNDQKFITRAKIITYLRSFLDELGFLEVETPMMNVIP-----GGAVAKPFITYHNELDMNLYMRIAPE------LYHKMLVVGGLDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADY--HDLMEITEKLLSGM-VKHITGKITYHPDGQEIDFTPPFRRISMVY----DLEKVLGVKFP...................................... 414
351 4.000e-64UniRef50_A0A2M6R9F9 Lysine--tRNA ligase n=4 Tax=Bacteria candidate phyla TaxID=1783234 RepID=A0A2M6R9F9_9BACT  ali  17  95......KLFDNGDFIEVHGEVFVTKMGEQTIHVDDFALLTKSLPDVWSGLKDTELRFRKRFVDLNLNPDVKKKRAHIIKELRSFMDTHGFIEVETPILQPTP-----GGAAAKPFITHYNILDSDFYLRVAPELYLKRLI------VGGFEKIYEIGKSFRNEGVSHMHNPEFTIFEFYWAYQDYNG--LMDFTETMLGDI-ITKVNGSLKVMYQGKEIDFTPPYPRISFADLIKKDCDEFDDLKKEVEKAGIKLDNMKEITVWAKLVDELYK............ 360
352 5.000e-64UniRef50_Q5NI89 Lysine--tRNA ligase n=47 Tax=Bacteria TaxID=2 RepID=Q5NI89_FRATT  ali  18  181..YETFKNLDLGDIVGITGTMFKTNTGELSVEANHFEILTKALPDKFHGLADQEMRYRQRYVDLITNEEVFKVRSKVVNFIRNYFDRLDFMEVETPMMHVLQ-----GGGAAKPFKTHHNALDMPLYLRIAPELYLKRLV------VGGFERVYEINRNFRNEGVSSRHNPEFTMLEFYMAYADYN--DLMDLTEDMLSKL-VQEVIGSEILEYGEYKINFGGKYERISMVDSIVKYNDDITKED........................................ 416
353 5.000e-64UniRef50_T1AR89 Phenylalanyl-tRNA synthetase, alpha chain n=1 Tax=mine drainage metagenome TaxID=410659 RepID=T1AR89_9ZZZZ  ali  16  213..EWKTKEFKSYNVTDPTERAYPARIHPSHRFFSYIRSIFLSMG--FSEVVGPIIDNAFWNFDALFSPQDHPTR-----DMQDTFFLSNPKEIDLEVLSRVRRMHKKGWKSA-----WRESLAKQALLRTHNTSVSVKNIYGNLADSAYPIKLFSLGKVFRNESIDYKHLNELNQLDGIIIGDSLTLSNLIFTMKEFYSYLGID-VKFKPSYFPFVEPNEEHDDDIELFGSGIIRKEITKAMGTNKTVLAWGIGLDRLMFNYIETDSLSEIYRNQIWLRDVK... 492
354 6.000e-64UniRef50_Q13WZ5 Lysine--tRNA ligase n=115 Tax=Proteobacteria TaxID=1224 RepID=SYK_PARXL  ali  19  114..YDAFKKWDMGDIVAARGVLFRTNKGELSVRCTELRLLSKSLPDKFHGLSDQEMKYRQRYVDLIVTPETRKARTKAISSIRKFMADADFMEVETPMLHPIP-----GGAAAKPFTTHHNALDMQMFLRIAPELYLKRLV------VGGFERVFEINRNFRNEGVSVRHNPEFTMIEFYAAYTDY--KWLMDFTEQLIRQAAIDAL-GTATITYQGRELDLAKPFHRLT........................................................ 332
355 8.000e-64UniRef50_A0A0G1JTL6 Lysine--tRNA ligase n=4 Tax=Microgenomates group TaxID=1794810 RepID=A0A0G1JTL6_9BACT  ali  18  92......ELVDLGDFLSVQGTLGKTEAGEVSVFAANFQLITKPLPDKWNGLKDIEERYRQRYVDLLMNSEVFLIRTKIIKFLRHYFDSHSFIEVETPILQPI-----YGGAAAKPFITHHNTLDTDLYLRIAVELYLKRLII------GGFEKVYELGKDFRNEGMDRGHNPEFTMLEFYWAYTDY--EKLMQFTQNMLIEL-VQDVCQTIELDYQGIKLNFQAPWKRITY----REAILEHTGVDINQADTEEKL--RTMIKSK..................... 335
356 8.000e-64UniRef50_Q5XIM7 Lysine--tRNA ligase n=991 Tax=Eukaryota TaxID=2759 RepID=SYK_RAT  ali  17  202.....NNKLRRGDIIGVEGNPGKTKKGELSIVPREMTLLSPCLPHLHFGLKDKETRYRQRYLDLILNDQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIP-----GGAVAKPFITYHNELDMNLYMRIAPE------LYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADY--HDLMEITEKMLSGM-VRSITGKITYHPDGYEIDFTPPFRRISMV----EELEKVLGVKLP...................................... 438
357 9.000e-64UniRef50_U3JIR9 Lysine--tRNA ligase n=163 Tax=Eukaryota TaxID=2759 RepID=U3JIR9_FICAL  ali  16  169.....NSKLRRGDIIGVEGNPGKTRKGELSIIPYEITLLSPCLPHLHFGLKDKETRYRQRYLDLILNDQKFITRAKIITYLRSFLDELGFLEVETPMMNVIP-----GGAVAKPFITYHNELDMNLYMRIAPE------LYHKMLVVGGLDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADY--HDLMEITEKLLSGM-VKHITGKITYHPDGQEIDFTPPFRRISMVY----DLEKVLGVKFP...................................... 405
358 1.000e-63UniRef50_A0A2V8QB85 Uncharacterized protein (Fragment) n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8QB85_9BACT  ali  17  144.GWQLFGLLDHGDFIGVEGYLFVTKTGELSVHVEKLQFLAKAMPDKMHGINDPEIRQRQRYADDLTPREVFQLRSKVIREIRRFLDERGYIEVETPMLTPL-----ATGAAARPFKTHHNTLDIDLYARIAPELYLKRLV------VGGFEKVYELNRNFRNEGISTKHNPEFTMLEFYWAYADVNQ--MMDLCEELLRSV-VQVATGGSTVRYGENEIDFSKAFQRITMKDAIIKELQQTVGIQVD...................................... 395
359 1.000e-63UniRef50_A0A1V9WY89 Lysine--tRNA ligase (Fragment) n=4 Tax=Bilateria TaxID=33213 RepID=A0A1V9WY89_9ACAR  ali  16  448.....NAKLRRGDIIGICGHPGKTKKGELSIVPNHIELLSPCLPHLHFGLKNQETRYRQRYLDLILNDQKFIVRAKVVNFVRKFLDAMGFLEVETPMMNMIP-----GGAAAKPFVTHHNELNMDLYMR------VAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYN--DLMVLTEKMLSQMVLEYKIKYMQVDGTEFEIDFTPPFRRLRMI----PELEKALGMKLPA..................................... 683
360 1.000e-63UniRef50_A0A1D8MRN6 Uncharacterized protein n=7 Tax=Nanohaloarchaea TaxID=1051663 RepID=A0A1D8MRN6_9ARCH  ali  14  177...........FNVEAQTSTPKTGKKHYYKNILQYARQTWMEMG--FEEMEGDYVVPSFLNFDALYTPQDHPAR-----ELHDTFFVENPEKADLSEVEHVKKTHEAGWSTGSRGYDWSKQEAERNVLRTHTTAISAMTLHEIDNDEELPKKFFIVGRNFRNETVDRTHLAEFYQTDGIVVGKDLNFANLKGYISKFFEKMGYEKFRLIPSYYPYTEMSVEVQVWDEMGGAGMFRPEVVKPMGFEAKVLAWGLGIPRIAFMAAGLSDIRELYRNDIKI....... 451
361 1.000e-63UniRef50_A0A1F7GBV0 Uncharacterized protein (Fragment) n=1 Tax=Candidatus Roizmanbacteria bacterium RIFCSPHIGHO2_01_FULL_39_12b TaxID=1802030 RepID=A  ali  18  93.......LLDIGDFVGVVGEVTKTVAGEVSIMPSDYVLLTKSLRPSWYGIRDVETRFRQRYLDLLLNDDVKKIRAKVVRAVRSFLDNQGFLEVETPILQHL-----YGGANAKPFKTYFNALDANMYLRIAPELYLKRLIA------GGYDRVYEIGKVFRNEGLDRTHNPEFTMLEWYESYADY--QRMMDVAEGMFKHVA-KEVAGGLKIKVDKHVIDLSGQWPRIKMVDIIKD----KLGLDV....................................... 319
362 1.000e-63UniRef50_F1NE72 Lysine--tRNA ligase n=60 Tax=Eukaryota TaxID=2759 RepID=F1NE72_CHICK  ali  17  170.....NNKLRRGDIIGVVGNPGKTKKGELSIIPYEITLLSPCLPHLHFGLKDKETRYRQRYLDLILNDQKFITRAKIVTYIRSFLDELGFLEIETPMMNIIP-----GGAMAKPFITYHNELDMKLYMRIAPE------LYHKMLVVGGLDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADY--CDLMEITEKLLSGM-VKHITGKITYHPDGQEIDFTPPFRRISMVD----ELEKTLGVKFP...................................... 406
363 2.000e-63UniRef50_A0A251W0D9 Lysine--tRNA ligase n=1 Tax=Litorilinea aerophila TaxID=1204385 RepID=A0A251W0D9_9CHLR  ali  16  95...WK-KLIDLGDFISVTGPLVVTKTGELSVEAQSIQFLSKAMPDKWHGVRDRETRYRRRYVDLLANPEVRRRRAAIVRALREYLDREGFLDVETPILQPI-----YGGAAARPFVTHHNQLHQDLYLRISFELYLKRLI------VGGFDRVYEIGRDFRNEGVSFKHNPKFTQLEFYEAYADYNG--VMKRTEEMLAYVA-QQVTGGTQITWQGKTIDLKPPWRRIS----LRQAILDATGIDYEAFPDAASLAQEMRRLGHEPDPKSSWGKLVD........ 355
364 2.000e-63UniRef50_A0A1G1P0E6 Lysine--tRNA ligase n=9 Tax=Bacteria TaxID=2 RepID=A0A1G1P0E6_9BACT  ali  19  88.GFPVVKALDIGDIIGVKGTLFVTKTGQQSVRVAEITFLSKSLPEKWHGLKDVEIRYRQRYVDLIANKEVREIRSKIIGFIRSYLDRLGFLEVETPMLQPM-----AGGARGRPFKSKHNAYDMDVFLRIAPELYLKRLL------VGGLEKVYEMNRNFRNEGVSTRHNPEFTMLEVYQAYGDY--EDMMKLTEGLVSSLA-REITGSYKVTYQGREIDFTPPWERRSFARI----VKEKFDIN-PQDDAGTMLEKVKAHKAHGVKVEQLTRSVV......... 349
365 2.000e-63UniRef50_A0A2E5EIC1 Lysine--tRNA ligase n=181 Tax=root TaxID=1 RepID=A0A2E5EIC1_9BACT  ali  18  99......KCLDLGDFIGVKGLMFTTKMGEISVKAQEVTVVSKAMPAKWEGLSDTETRYRQRYLDLIANDEVFLKRSAIIREIRNFLQQRGFVEVETPMMQNIP-----GGAAATPFVTHHNSLGCDFYMRIALELYLKRLL------VGGIDKVFEIGRNFRNEGLSRRHNPEFTMLEAYEAYGDY--ESMMELLQGMVCHIANEVIEHKNADGEVTKTIDLTPPWRRVRY----KDLVKEKAGDD........................................ 331
366 2.000e-63UniRef50_X1HVC0 Uncharacterized protein n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X1HVC0_9ZZZZ  ali  16  1.................................................MRGPIVELEYWNFDALFQAQDHPAR-----EWSDVYRVANPKQGKLPKGKHVKLVQKAHEGSKGWRYKWSPEKSARLVLRAHGTSVSARTLVN----LPVPSKYFSISRCFRPDTVDATHLSEFNQAEGIVADPSITFRDLLGILETFALDVATDKFLFKPDYYPFTEPRDPKLGNIEFGGAGIFRPEVVRPFDIEVPVIAWGLGIDRLFMVKYGITDIRELFSHKMWLRSAK... 237
367 3.000e-63UniRef50_Q97RS9 Lysine--tRNA ligase n=677 Tax=root TaxID=1 RepID=SYK_STRPN  ali  16  104..YEIFKKADLGDFLGVEGEVMRTDMGELSIKATHITHLSKALPEKFHGLTDVETIYRKRYLDLISNRESFERRSKIISEIRRYLDQKGFLEVETPVLHN-----EAGGAAARPFITHHNAQNIDMVLRIATELHLKRLI------VGGMERVYEIGRIFRNEGMDATHNPEFTSIEVYQAYAD--FQDIMDLTEGIIQH-AAKSVKGDGPVNYQGTEIKINEPFKRVHMVDAIR----EITGVDF....................................... 335
368 3.000e-63UniRef50_A0A1A8VK39 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Plasmodium ovale curtisi TaxID=864141 RepID=A0A1A8VK39_9APIC  ali  18  266.....KYDIKKYNFFSSGKKMNKGNIHLLTRQMRAFKDIFISLG--FEEMTQNYVESSFWCFDALYIPQQHPSR-----DLQDTFFIKEPEMIDSDYIANIEKVHTYGDGSFGWNYKWKLEESKKNVLRTHTTANSCRTLFKLAKEYNKPKKYFSIDRVFRNENLDSTHLAEFHQIEGLIIDKNLGLSQLISTLSAFYKYIGIHKLKFKPTFNPYTEPHEENKKWLEVGNSGVFRPEMLRSMGFDVSVIAWG................................. 526
369 3.000e-63UniRef50_A0A2M7XF98 Lysine--tRNA ligase n=7 Tax=Parcubacteria group TaxID=1794811 RepID=A0A2M7XF98_9BACT  ali  17  86IGTEKYDQFDVGDFYSVSGPSFRTKRGEPSIDAQEYQLLTKSLPEKWHGLTDTEKRYRHRYLDLISNPEIAKTRSRMVAAIRRFLESEGFMEVETPVLQAL-----AGGANAKPFVTHHNTLDHDFYLRIAPELFLKRLI------VGGFEKIYEFARCYRNEGISPQHNPEFTQIELYWAYAE--IEDLMDHLERMMSQV-VKETIGSSVIQLDNLELKFETPFPRTS----FHDVVEAKTGIDLDQISGEEAL-RELMIAKKID................... 342
370 3.000e-63UniRef50_A9WK04 Lysine--tRNA ligase n=189 Tax=cellular organisms TaxID=131567 RepID=SYK_CHLAA  ali  18  101........LDTFDIVQASGVLRCTKTGERSLFVRELAILAKAIPEKWAGLQDVEERHRQRYLDLIVNREIFRARARVISTMRRVLDERGFLEVETPVLQPL-----YGGAAARPFITYHNALGQNLYLRIATELYLKRLI------VGGFPGVYEIGKNFRNEGVDRSHNPEFTMMECYQAYADYHA--MMTLVEEMLSEICL-AVHGTTTITYQGRELDFRPPWPRIAMAT----AIADRTGIDITQIARGLRVERKA.......................... 350
371 3.000e-63UniRef50_A0A1G3BIE6 Lysine--tRNA ligase (Fragment) n=2 Tax=Bacteria TaxID=2 RepID=A0A1G3BIE6_9BACT  ali  17  90..FELSKLFDLGDIVGVEGVLFKTRTGEITIYADDFTILTKSLPEKWHGLKDIELRHRQRYVDLFTNTEVFLKRIKILKHIRRFLDDRCFVEVETPMMQSIP-----GGAVARPFITHHNALDIDLYLRIAPELYLKRLL------VGGMERVYEINRNFRNEGISTRHNPEFTMMELYQAYSDYNG--MMELTESLVTS-QVNELYGGYEIPFGERKIDMTPPWRRAT----FCELLKEHSGVSYEDEAKELGLE............................. 337
372 4.000e-63UniRef50_A0A2M6YBM0 Lysine--tRNA ligase (Fragment) n=1 Tax=Candidatus Berkelbacteria bacterium CG08_land_8_20_14_0_20_39_8 TaxID=1974511 RepID=A0A2M6  ali  16  4.......LFDVGDFIQVEGKLFITKAGEYTLKVLSFKLLTKSLPEKWHGLTDVETRYRQRYVDLIVNPELFYKRSKIIAALRNFLTKNGFLEVDTPTLQPI-----AGGAVAKPFITHYNVYDRDVFLRIAPELYLKRLV------VGGFEKVFEFAHCFRNEGVDATHNPEFTNLEFYWAYTDY--EKLMKFTEELLRNV-VSQVFGKTEIEISGKKVDFNKKFPRITFNDIFKNAVRK---IIEPTFIIDHPIGISPLAKR--KDEKTVERFQLILGGLEV.. 275
373 4.000e-63UniRef50_A0A1F5KPA9 Lysine--tRNA ligase n=2 Tax=Bacteria candidate phyla TaxID=1783234 RepID=A0A1F5KPA9_9BACT  ali  18  87..YEFLTNFDLGDFIETSGEIFKTQAGEISVRVSDYKLLTKSLPSAWYGLEDVEERYRQRYVDLTINPEVRKVRSKIVKLLRNFMEEKGFIEVETPTLQPL-----YGGATAKPFTTHHNALDIKLYLRISDELYLKRLI------VGGYEKVFEICKDFRNEGQDRQHNPEFTMMEFYWAYADY--EDLMKLTEEMVAKI-VKLIHDKYIFEFEGQKLDFKFPFKRIT----FNKLVKENCGIDLAEIKTEGELKKVIKEKE...................... 335
374 4.000e-63UniRef50_A0A1V1RI80 Lysine--tRNA ligase n=11 Tax=Terrabacteria group TaxID=1783272 RepID=A0A1V1RI80_9ACTN  ali  16  100LGAERFREIDVGDWVGASGEVVRTRRGELSVVPVELTILSKSLPEKFHGLTDVETRYRQRYVDLIANPEVREKRFVAIAAIRKYMESQGFLEVETPMLHPIP-----GGATARPFVTHHNALDMDLYLRIAPELYLKRLL------VGGFERVFEINRSFRNEGISVRHNPEFTMLEAYQAFTN--LEGMMRLAEGIVTA-AVEAACGSLVVDYQGTRIDFTPPWPRRTLIELTSEAAGEE............................................ 336
375 4.000e-63UniRef50_A0A2W5E7U0 Lysine--tRNA ligase n=1 Tax=Pseudomonas fluorescens TaxID=294 RepID=A0A2W5E7U0_PSEFL  ali  20  116.GAEVFGLFDIGDIIGVEGPLSRTNKGELTLQVQKFELLTKGLPDKYHGMADVEQRYRQRYLDLITSPEVRHTRSRAITAIRRFLDDNGFLEVETPVLQ-----HQAGGASARPFSTHHNALDIPLNLRIAPELFLKRML------VGGFERVYELSRNFRNEGISIKHNPEFTMLEFYCAY--GTREDAMSMMEDMLRHT-VQAVSGNHAVPYGEHVIDFAPAFQRYTM----RDALKTFAGFTDADLEHVDSLEAAAKAK....................... 368
376 4.000e-63UniRef50_Q9X231 Lysine--tRNA ligase n=70 Tax=Bacteria TaxID=2 RepID=SYK_THEMA  ali  19  91VGKEKMDLFKRGDFVGVRGFPFKSKTGELTIYVQEYTLLSKALPEKWHGIKDKEIIYRQRYLELIVNDEAFKKRFKAVRVIREFLNSRGFIEVETPILHYV-----TGGAEARPFVTHLNVFDIDMYLRIAPELYLKRLI------VGGFEKIYEIGKNFRNEGISYKHSPEFTSIEIYQAYADYN--DMMDLTEELIVEV-VKRTCGTLKISYQGKEIDFTPPWKRVRM----RDFLKEKLGVDI....................................... 328
377 4.000e-63UniRef50_A0A2M7RKE7 Lysine--tRNA ligase n=26 Tax=Bacteria TaxID=2 RepID=A0A2M7RKE7_9BACT  ali  20  101...ELSDNVDPADFIQTEGTLFTTHKGEKTVLAKNYVLAVKALPEKWHGLVDTEIRYRKRYLDLLANQEVFKKRAKIIKTIRDFLNQNGFLEVETPILQLIP-----GGAAARPFVTHHNALNEDFYLR------VAPELYLKKLVVGGLERVFEIARCFRNEGIDWSHNPEFTMLEFYAAYWDY--HDLMEFTEKLFAEI-MNKTAGGFSVEYKGNKIDFTPPYPRLK----FKTAILKEAGIDID...................................... 332
378 4.000e-63UniRef50_V8P0X6 Lysine--tRNA ligase n=1 Tax=Ophiophagus hannah TaxID=8665 RepID=V8P0X6_OPHHA  ali  16  464.....NNKLRRGDIIGVQGNPGKTKKGELSIIPYEIVLLSPCLPHLHFGLRDKETRFRQRYLDLILNDQKFIIRAKIITYLRNFLDELGFLEIETPMMNIIP-----GGAVAKPFITHHNELDMNLYLRIAPE------LYHKMLVVGGMDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADY--HDLMEITEQMISGM-VKHISGGYKVTYHPEEIDFTPPFRKINMVD----ELEKALGVRLPAAD................................... 703
379 5.000e-63UniRef50_Q6K1T2 Lysine--tRNA ligase n=30 Tax=Mesangiospermae TaxID=1437183 RepID=Q6K1T2_ORYSJ  ali  17  182..................GSIKKTEKGELSVYVKNFEILTKSLPDKYHGLTDVDKRYRQRYVDMIANPEVFRTRAKAVSEIRKTMESFGFIEVETPVLQ-----GAAGGAEARPFITHHNSLQRDLYLRIATELHLKRML------VGGLEKVYEIGRIFRNEGISTRHNPEFTTIEMYEAYSDY--ESMMNLAEEIVTRCAM-ATHGKLRVDYQGTEISLERPWRRETMHSL----VKEATGIDFN--SFGEDLESAKNAARGIKT.................. 416
380 5.000e-63UniRef50_A0A2E8Y2S0 Lysine--tRNA ligase n=9 Tax=Actinobacteria TaxID=201174 RepID=A0A2E8Y2S0_9ACTN  ali  15  120.GFANVKSLDLGDWVGVTGDVMTTRKGELSVRVTECQLLSKALPDKWHGLSDVDTRFRQRYADLIVNDDAREIRHAIISSFRQTLAGEGFIEVETPVLH-----VESGGAHARPFVTHHNTLDMQLYLRIALELHLKRLI------VGGMERVFEIGRIFRNEGISTRHNPEFTMMELYQAFADWT--DVMDITERLITN-AARDAIGSTTLSIRGEDVDLADPWPRIRMIDAASEAI............................................... 348
381 5.000e-63UniRef50_A0A1G8MGT1 Lysine--tRNA ligase n=2 Tax=Terrabacteria group TaxID=1783272 RepID=A0A1G8MGT1_9LACT  ali  17  114.........DLGDIVGIEGFLFKTGRGELSVWATQFVPLTKAMPDKYHGLTNVEQRYRQRYLDLISNEESFDKRSQIVSEIRHYMEDHGYIEVETPMLHSI-----AGGAAARPFTTHHNALDMDLFLRIAPELYLKRLV------VGGFEKVYEIGRTFRNEGVSTRHNPEFTMLEAYTAYFVYT--DVMDLVEGIFTHVA-QKVLGKTTIQYGEHELHLGEPWKRVHMVDIIK----EVTGVDF....................................... 338
382 6.000e-63UniRef50_A0A259CW94 Lysine--tRNA ligase (Fragment) n=3 Tax=Proteobacteria TaxID=1224 RepID=A0A259CW94_9PROT  ali  17  119..YERFKHWDLGDIMGASGRLFKTKTGELSIHVTEIKLLTKSLPEKFHGLQDQEIKYRQRYVDLITSEETFKARSKVVSAIRNFMIEHAFLEVETPMLHPIP-----GGASAKPFITHHNALDMQMFMRIAPELFLKRLV------VGGFERVFEINRNFRNEGLSVRHNPEFTMMEFYAAYTDY--QWLMDFTEQCIRAA-AIAARGTAVLSYDGKEVDLSKPFERLTIVGAI................................................... 342
383 6.000e-63UniRef50_A0A1R4H4G9 Lysine--tRNA ligase n=74 Tax=root TaxID=1 RepID=A0A1R4H4G9_9GAMM  ali  19  104...EQFKKWDIGDIIGAEGVLFITQTGELSIKIDNIRLLTKALPEKFHGIADQEIKYRQRYLDLIMSQESRNIRSKVVAYIRQFLIDRQFLEVETPMMQVIP-----GGATARPFTTHHNALDMNMFLRIAPELYLKRLV------VGGFERVFEINRNFRNEGLSTRHNPEFTMLEFYQAYAEY--HDLMNLTEAMLRGIA-EEVVGHSVITYQGEQYDFGQPFQRMTVVDHFNPDLT.............................................. 334
384 6.000e-63UniRef50_C9LTH5 Nucleic acid-binding domain protein n=4 Tax=Bacteria TaxID=2 RepID=C9LTH5_SELS3  ali  18  103LGEEKYKEFDIGDIIGVRGVVFRTRRGELTVRVDDFTLLSKSLPEKFHGLKDVEMRYRQRYVDLIMNPEVFIARTKIIQSIRRYLDERGFLEVETPVMSTI-----AGGAAARPFVTYHNALDMKLYLRIATELNLKRLI------VGGLERVYEIGRIFRNEGIDVRHNPEFTSIEIYQAYADYN--DLMDVTEGI........................................................................................ 295
385 7.000e-63UniRef50_A0A0G0X3W6 Lysine--tRNA ligase n=5 Tax=root TaxID=1 RepID=A0A0G0X3W6_9BACT  ali  19  86..YDFLANLDLGDFLQAEGEVFQTQAGEKTVRVKNYQLLAKSLRPLWYGLEDVEERYRQRYVDLIINPEVKKVRHKIVRFIRSFLEDKGFVEVETPILQPI-----YGGATAKPFITKHNALDTNLYVRISDELYLKRLI------VGGYEKVFEIGKDFRNEGIDRQHSPEFTQMEFYWAYADY--EDLMRLGEEMISKL-VKEIHGSYKFKYEGMELNFAAPFKRIG----FNELIKTHSGID---------LEKVSSEEELLKDIKG-KGIKLDLKGV.... 342
386 7.000e-63UniRef50_A0A2V7UJZ9 Lysine--tRNA ligase n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V7UJZ9_9BACT  ali  15  128LGERAYKLFDLGDYIGIAGRVMRTRKGELSVQAKELTFLAKALPEKWHGLAGVEARYRQRYLDLMANPEVRRARSAMIAEMRRFLDARGYVEVETPMMQPI-----AGGAMARPFTTHHNALGIDLYLRIAPELYLKRLV------VGGMEKVYEINRNFRNEGISALHNPEFTMLEFYTACFDCD--DVMALTEELVAAAAQRVSEGRP-VVYKGREVSFTRPFPRVGMKDAIAEA................................................ 360
387 8.000e-63UniRef50_A0A0G1A976 Lysine--tRNA ligase n=23 Tax=root TaxID=1 RepID=A0A0G1A976_9BACT  ali  20  106.......LIDVGDFVAVKGSCFITKRGEKTLLVKSWQLLSKSLLDKFHGLSDVEIRFRQRYLDLLSNPEVKEKRIQIVKSTRDFFDMEGFAEVETPILQPL-----YGGATAKPFITHHNALNTDLYLRIAPELYLKRLI------VGGFEKVFEIARCFRNEGIDYSHNPEFTQIEFYWAYA--TYEDLMKLMEKFFSYL-LPRLGMGLKFVYQGQEIDMTPPYPRKT----FRELLIEYAKMDIE...................................... 333
388 8.000e-63UniRef50_P41258 Lysine--tRNA ligase n=839 Tax=root TaxID=1 RepID=SYK_CAMJE  ali  16  102....LKKNLEVGDIVLVKGFPFVTKTGEFSLHASEVKLATKALPEKYHGLTDIEQRYRKRYVDMIMNVEVRKVRSKVVSLIRHFFENKGFLEVETPMMHPI-----AGGANAKPFVTFHNSLGVERFLRIAPELYLKRLI------VGGFEAVFEINRCFRNEGMDLTHNPEFTTIEFYWAYHNY--KDLMDLTEELF-ALLLDKLNLGKTIEFDGKMINFSKPFERITYKGLDRDLIEDKEKILTKLKADGF................................ 349
389 9.000e-63UniRef50_Q9RXE1 Lysine--tRNA ligase n=43 Tax=Deinococci TaxID=188787 RepID=SYK_DEIRA  ali  20  114.GFDATKKIDLGDIIGVKGHPFVTKTGQLTLHVTEWQPLVKSLPSKFHGLQDEELRARRRYVDLMVTEEKFQARSRMIRYIRNELDERGFMEVEGPTLQVT-----AGGAEARPFMTHHNALSYDFKLRISLELYLKRLL------VGGFERVYEIGRVYRNEGIDRTHNPEFTMLELYWAYADYS--DIAKLVEDLLSGLA-KEVHGSYQFEYQGKTLDFTPPFARVDYLGGLREHVP---GLDFDP----LDLDRL........................... 355
390 1.000e-62UniRef50_U3IZ48 Lysine--tRNA ligase n=228 Tax=Eukaryota TaxID=2759 RepID=U3IZ48_ANAPL  ali  17  169.....NNKLRRGDIIGVEGNPGKTKKGELSIIPYEITLLSPCLPHLHFGLKDKETRYRQRYLDLILNDQKFITRAKIVTYIRSFLDELGFLEIETPMMNIIP-----GGAMARPFITYHNELDMNLYMRIAPE------LYHKMVVVGGLDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADY--HDLMEITEKLLSGM-VKHITGKITYHPDGQEIDFTLPFRRISMVD----ELEKVLGVKFP...................................... 405
391 1.000e-62UniRef50_A0A2G9FQL5 Phenylalanine--tRNA ligase alpha subunit n=7 Tax=cellular organisms TaxID=131567 RepID=A0A2G9FQL5_9RHIZ  ali  20  1...............................................................................................................................MRTHTTAVSARMLYQLAQEVFKPVKYFSIDRVFRNETLDATHLAEFHQVEGVIADYDLTLGDLIGVLYQFFRKLGITKLNFKPAYNPYTEPHEGLEKWIEVGNSGVFRPEMLLPMGLKVNVIAWGLSLERPTMIKYGYNNIRDLVGPKVNLQMVNDN. 167
392 1.000e-62UniRef50_D1Y3B9 Lysine--tRNA ligase n=2 Tax=Pyramidobacter TaxID=638847 RepID=D1Y3B9_9BACT  ali  16  110.....KKWLDSGDIIGIVGHPFRTQRGELTVAVERFRLLTKALPEKWHGLTDLEIRYRKRYLDLIVNPEVFRKRAKIISTFRAVLEKHGTLEVETPVLSYL-----AGGANARPFITYHNALGANMYLRIATELYLKRLV------VGMMGRVYEISKDFRNEGMDLTHNPEFTMMEVYWPYADYV--DMMNLTEELIRESCI-AANGTPVIERNGVMLDFAKPFRRATMVEL----VKENCGVDFADITDEEARDAARKNKIEI.................... 357
393 1.000e-62UniRef50_D1C2S9 Lysine--tRNA ligase n=69 Tax=Bacteria TaxID=2 RepID=D1C2S9_SPHTD  ali  19  104.....KRFIDLGDFIEAEGNLFRTRTGEVTVEVKAFRLLAKAIPEKWHGLQDVETRYRQRYADLMANEETRRIRANAIRAIRRFLDERGFLEVETPVLQPL-----YGGAAARPFTTYYNALDQTFYLRIADELYLKRLL------VGGYERVYEIAKDFRNEGIDARHSPEFTMLEFYMAYADY--HDVMELVEEMFVYVA-EQALGTTKLTYAGHEIDLTPPWPRVP----LRQALIDATGIDY....................................... 332
394 2.000e-62UniRef50_Q15046 Lysine--tRNA ligase n=187 Tax=Bilateria TaxID=33213 RepID=SYK_HUMAN  ali  16  173.....NNKLRRGDIIGVQGNPGKTKKGELSIIPYEITLLSPCLPHLHFGLKDKETRYRQRYLDLILNDQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIP-----GGAVAKPFITYHNELDMNLYMRIAPE------LYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADY--HDLMEITEKMVSGM-VKHITGKVTYHPDGPEVDFTPPFRRINMV----EELEKALGMKLP...................................... 409
395 2.000e-62UniRef50_A0A1W9U7K8 Lysine--tRNA ligase n=21 Tax=root TaxID=1 RepID=A0A1W9U7K8_9DELT  ali  18  2.....FSFIDIGDHVGLKGQFFRTKTHELTLLASSVVLLTKSLPEKYHGLVDIETRYRQRYLDLIVNDTVRHLRSKIIRAIREFFDKQGFIEVETPMMQSIP-----GGATARPFKTYHQSLGIDLYLRVAPELYLKRLV------VGGLERIYELNRNFRNEGISTNHNPEFTMLEFYLAYA--TYEDLMDLTEKLFIHL-LTKLFNKLTVTYQGNLIDFATPWQRISLIDSLRD................................................. 224
396 2.000e-62UniRef50_A0A0F2JHG5 Lysine--tRNA ligase n=3 Tax=Bacteria TaxID=2 RepID=A0A0F2JHG5_9FIRM  ali  17  92..FELVAKFDVGDIIGVEGKVFRTKRGEISIHASKVLLLSKAMPEKFHGLTNVETRYRRRYLDLIMNPDVRQVRSKIIRYMREFLEEREFLEVETPTLHAIP-----GGAAARPFTTHHNALDIDLYLRIALELPLKRLI------VGGFEKVFEIGRTFRNEGISIKHNPEFTMMELYQAYANY--EDIMELTEEMISFI-VEKVHGTQEISYQGQTLHFKTPWRRLPMLD----GILEYSGVDFRVL.................................... 326
397 2.000e-62UniRef50_Q7V9Q0 Lysine--tRNA ligase n=207 Tax=cellular organisms TaxID=131567 RepID=SYK_PROMA  ali  14  109........VDAGDWLGVNGILRRTDRGELSIKVHSWKILCKSLPDKWHGLADIEKRYRQRYLDLVVNPDSRKRRALTVSAIRRWLDERSFLEIETPVLQSA-----AGGADARPFITHHNTFDIPLFLRIATELHLKRLV------VGGFERVYELGRIFRNEGISTRHNPEFTSVEIYQAFADYNQ--MMDLTEELISSVCIE-ICGSTKISYQDVSLDLTPPWRRVTMQEL----VLEATGIDFDNFDGDQEKASSEMINLGLE................... 354
398 2.000e-62UniRef50_H3NIZ2 Lysine--tRNA ligase n=9 Tax=Firmicutes TaxID=1239 RepID=H3NIZ2_9LACT  ali  17  112..WW--KACDLGDIVGVKGHVFKTNTGELSVKAQDFIPLTKALPDKFHGLTNVEQRYRQRYLDLIANQDSFVKRSQIIREIRHYLDDRDYLEVETPVLHNL-----AGGAAARPFITHHNALDMELYLRIALELHLKRLV------VGGMERVYEISRVFRNEGIDTTHNPEFTMLEVYTAYT--VFTDVMDLVEGLVREVA-SKVLGQTTLTYEDHTIDLGTAWQRRHMVDLIK----EATGVDF....................................... 341
399 2.000e-62UniRef50_A0A0E9DSV6 Lysine--tRNA ligase n=21 Tax=Bacteria TaxID=2 RepID=A0A0E9DSV6_CHLTH  ali  16  113........LDLGDIIQATGVIVRTRRGQLSVSVTKLVLLSKSLPEKFHGLSDREIRYRQRYVDLIMNPEVRRKRSHIISLIRRFMENQGYLEVETPMMHQI-----LGGANARPFTTHFNALDCDFYLRIATELPLKRLI------VGGMDRVFEIGRQFRNEGMDLTHNPEFTSMEAYCAYSN--LQGMKELTEQMFQLIAQDVEKGSEIITYQDKRVNMSGTWRSVALSDVASEVVGEKINMDTPV..................................... 348
400 2.000e-62UniRef50_A0A218NLR4 Lysine--tRNA ligase n=3 Tax=Archaea TaxID=2157 RepID=A0A218NLR4_9ARCH  ali  20  92......ENLDTGDFAGVEGKVTKSKRGEISIAAKEITVLSKSLPEKFHGLTDIELRYRKRYLDLISNTEVRKFRSKILKYMRDFFDSRGYVEFETPILQPT-----YGGANASPFKTYFNALNQDMFLRIADELYLKRLI------VGGFEKVYEVSKDFRNEDIDSTHNPEFTQIEAYEMFKDY--EDYMKMTEELLSGM-VKYLFGSYKIKYQGKELDFTPPFKRLYWVEV----LNEKTGVDV....................................... 319
401 2.000e-62UniRef50_A0A1A7ZVP2 Lysine--tRNA ligase n=48 Tax=Bilateria TaxID=33213 RepID=A0A1A7ZVP2_NOTFU  ali  17  195.....NNKLRRGDIIGVRGNPGKTKKGELSIIPIEMTLLSPCMPHLHFGLKDKETRFRQRYLDLILNDQKFLTRSKIITYLRSFLDQLGFLEIETPMMNIIP-----GGAVAKPFVTYHNELGMNLYMRIAPE------LYHKMLVVGGLDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADY--HDLMEITEKLLAGM-VKHITGGYKVTYHPDEIDFTPPFRRVSMT----HDLEKIMGVKFP...................................... 431
402 2.000e-62UniRef50_A0A0G1NK93 Lysine--tRNA ligase n=33 Tax=Bacteria TaxID=2 RepID=A0A0G1NK93_9BACT  ali  18  90..FDLLKLFDVGDFLAVSGTVIKTSAGEITIDVNKFELLSKSLPDDWHGLKDVEERYRKRYLDLLLNPDIRRRRTVVFKETRNYLDKLGFKEVETPVFHPL-----YGGANARPFTTHMQALDTDFYLRIAFELYLKRLVA------GGYDKVYEIGRDFRNEGIDHSHNPEFTMLEWYEAYADY--HRVMDVTEGLFKHLAAK-IFAKTQIQVGDKTVEIGHAWPRITMSDLLAQKLD.............................................. 318
403 2.000e-62UniRef50_A0A2N9LA33 Lysine--tRNA ligase n=3 Tax=Acidobacteriaceae TaxID=204434 RepID=A0A2N9LA33_9BACT  ali  18  108..FALYKLLDLGDHIGVTGYLFRTRTGELTVHVETLTFLSKAMPEKFHGLADVELRYRQRYVDLFTNREVFVKRARVLKALRQFFDERGYLEVETPMMQPI-----AGGAAARPFRTHHNALDMDLFLRIAPELYLKRLV------VGGLDRVYEINRNFRNEGVSTQHNPEFTMLEFYQAYANY--HDLMDLTEELIKFVAME-VNGTTLTTFNDVEIDL-GKWRRLTMREAIIQFWPENFG.......................................... 339
404 2.000e-62UniRef50_UPI0001593A77 Pyrrolysyl-tRNA synthetase n=10 Tax=Methanosarcina mazei TaxID=2209 RepID=UPI0001593A77  ali  99  17..........RGSHMASAPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL 291
405 3.000e-62UniRef50_A0A1G1JYR6 Lysine--tRNA ligase n=4 Tax=root TaxID=1 RepID=A0A1G1JYR6_9BACT  ali  16  93..YELLDNFDIGDFVGIKGETFKTRTGEPTIKVTEIKLLAKSLPEKWHGLKDVETRYRQRYLDLVMNDAVRRIRSKIVSEIRRNLDEGGFMEVETPMMQSIP-----GGAAGKPFKTHHEALGIDLYLRVAPELYLKRLL------VGGFEKVYEINRNFRNEGISIRHNPEFTMLEVYEAYSDC--EGMMKLTERLITNLA-QKLFGKIDLVYQGKDIDFS-KWERIS----FADLMFEQFGIKAD...................................... 324
406 3.000e-62UniRef50_A0A1G6JBI6 Lysine--tRNA ligase n=9 Tax=Olsenella TaxID=133925 RepID=A0A1G6JBI6_9ACTN  ali  15  105..WELLRQLDMGDIIQAEGPVVRTRRGELSLAPRSIVLLSKSMPEKFHGLTDREIRYRQRYLDMIMNREVFRKRSRIVSLIRSYMEADGYIEVETPIMHSI-----LGGANAKPFVTHFNALDRDFYLRIATELPLKRLI------VGGMERVFEIGRQFRNEGMDLTHNPEFTSMEAYCAYSDLDG--MKRLTEGLFQYIAREACGCEPGIMFQGQEIDMSGTWDSRPLSEIASEVVGEHVDMDTPV..................................... 346
407 3.000e-62UniRef50_A0A0G1D111 Lysine--tRNA ligase n=27 Tax=Bacteria TaxID=2 RepID=A0A0G1D111_9BACT  ali  19  100........FDIGDFIEVSGVLFTTKRGEKTVEVTDFRILAKSLPEKWHGLQDVEERFRKRYLDLIMNPEVRRIRSNILKELRKILWANGFLEVETPILQPIP-----GGALAKPFKTHLNALKLDLYLRVAPELYLKRLL------VGGFEKIYEIGRCFRNEGMDAFHNPDFTMLELYWAYQDRDMEFVEETMLELLKNLG----RANNQIEYQDNQIDFKIPWKRSTFREIVRE................................................. 320
408 3.000e-62UniRef50_A0A2M7UIG8 Lysine--tRNA ligase n=1 Tax=Candidatus Peregrinibacteria bacterium CG_4_10_14_0_2_um_filter_43_11 TaxID=1974776 RepID=A0A2M7UIG8_  ali  16  137..FDFVKLLDLGDFIGLTGDMFITKHGEPTVLISECQLLSKSLPDKWHGLKDREKCYRDRYLDMVMNPETRKRRSRFIQTLRDFYYEHGFVEIETPILENV-----SSGATAKPFTTHHNALDIDVYLRIAG-----GELWQKTAVVGGFERTFEIGRVFRNEGMDPSHLQEFTMVEHYAAYWNY--EDNMNFTEQMFEHL-LKTILGTTQITGKDEVVNFNTPWPRVE----FYSLIKKDSGIDV....................................... 374
409 3.000e-62UniRef50_A0A0P4YN67 Lysine--tRNA ligase n=13 Tax=Eukaryota TaxID=2759 RepID=A0A0P4YN67_9CRUS  ali  15  75.......KIKRGDIIGVKGYPTRTKTGELSIVPRKMELLSPCLHPHYYGLKDKETRFRQRYLDLIVNTDVRKIRSQIISYVRRFLDNMGFLEVETPMMNMI-----AGGAAAKPFVTHHNDLNMQLFMRIAPE------LYLKMLVVGGVDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYN--DLMDVTESMISGM-VKEIHGTYKIPYHPEEIDFTPPFRRLRMF----PDLEKATGTKLP...................................... 308
410 3.000e-62UniRef50_A0A2D6QDH4 Lysine--tRNA ligase n=7 Tax=cellular organisms TaxID=131567 RepID=A0A2D6QDH4_9ARCH  ali  18  107.......LLDIGDFAGIAGTMFRTRTGEATVQVESWRFLAKALPEKWHGVRDKEIRFRQRYLDLAMNEEVFRARSRMISAMRRVLDAKDFLEVETPVLQPL-----YGGANARPFRTEHNALGVTLYLRIADELYLKRCL------VGGLDRVYEFGKDFRNEGMDRTHQPEFTQLEAYQAYGNY--EDGMSLVEELVAA-GAEAACGSTVVEWGGRTLDFGRPWERVSYLTILSEA................................................ 328
411 4.000e-62UniRef50_A0A0P5GTF7 Lysine--tRNA ligase (Fragment) n=20 Tax=Daphnia magna TaxID=35525 RepID=A0A0P5GTF7_9CRUS  ali  15  156.......KIKRGDIIGVKGYPTRTKTGELSIVPRKMELLSPCLHPHYYGLKDKETRFRQRYLDLIVNTDVRKIRSQIISYVRRFLDNMGFLEVETPMMNMI-----AGGAAAKPFVTHHNDLNMQLFMRIAPE------LYLKMLVVGGVDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYN--DLMDVTESMISGM-VKEIHGTYKIPYHPEEIDFTPPFRRLRMF----PDLEKATGTKLP...................................... 389
412 4.000e-62UniRef50_A0A1F5Q9A3 Lysine--tRNA ligase n=8 Tax=cellular organisms TaxID=131567 RepID=A0A1F5Q9A3_9BACT  ali  18  96...ELFANFDMGDFFAATGSLIETKRGEKTLLLSEFKMLTKSLPDQFHGLKDTETRLRKRYLDLLANPEMFRKKSVFWNTVREYLVKRGFLEVETPVLEAVP-----GGAEAEPFITHHNALARDFYLRISLELPLKRLL------VGGYEKVFEIGRIFRNEGISTEHLQDYTQMEFYWAYADYN--DLMGMLGELYPQI-VKNLFGTTKVTNQSVEIDWGKKWKRYDYYDLF----QEHTGID........................................ 325
413 4.000e-62UniRef50_A0A2E0GK58 Lysine--tRNA ligase n=44 Tax=Bacteria TaxID=2 RepID=A0A2E0GK58_9ACTN  ali  17  72..FDSFTSLNIGDWIGVTGEIMKTKRGELSVKVEQWXILASAXPDKWHGITXPDLRYRQRYVDLWVTEEAREXRSNMLSLTRRWLEAKNFXEVETPVFHPIP-----GGALARPFSTHHNALDTELYLRIAPELYLKRLI------VGGFERVFEIARVFRNEGISSXHNPEFTMLELYQAYADWN--DIMELAESLIEHLAIE-LTGSALIXYDGKEIDLTTPWRRATLXDL----IEEHAGLDVSL..................................... 305
414 4.000e-62UniRef50_A0A1V6BW56 Lysine--tRNA ligase n=1 Tax=Spirochaetes bacterium ADurb.Bin133 TaxID=1852909 RepID=A0A1V6BW56_9SPIR  ali  16  93.....EKMIDVGDFISVYGEIYRTEKGELTLRVDKYELLSKSLPEKFHGITDLESRSRQRYLDLIMNPETRSKRTKLINVIRKFLNDNDFVEVETPMLQ-----VKPSGALAKPFKTHHNTLDIDMYLRIAPETYLKRLIA------GGFDRVYDMGRCFRNEGIDPSHLQEFTMVEYYAAYWNY--IDNMNFTEKLIKQILLE-VHGGLQLDYMGTKIDFDGEWPRTS----FRDLILRHADIDIDQY.................................... 324
415 5.000e-62UniRef50_A0A2N6IFB3 Lysine--tRNA ligase n=5 Tax=Oxalobacteraceae TaxID=75682 RepID=A0A2N6IFB3_9BURK  ali  19  359.........DLGDILGVTGTLFKTKTDELTIKVTQLRLITKSLPDKFHGLADQETKYRQRYVDLIMNEETRKARTAAISSIRRFMEKNEFMEVETPMLHTIP-----GGAAAKPFITHHNALDMQMFLRIAPELYLKRLV------VGGFDRVFEINRNFRNEGVSIRHNPEFTMMEFYAAYTDY--KWLMDFTEAVIRQAAIDA-HGTATLTYGGRELDLAKPFHRLTIVEAFIKEELKKFGVK-PFATAGLGALQLTLF........................ 618
416 5.000e-62UniRef50_A0A1F9G5S1 Lysine--tRNA ligase n=1 Tax=Deltaproteobacteria bacterium RBG_16_71_12 TaxID=1797848 RepID=A0A1F9G5S1_9DELT  ali  17  111..YEHIKVMDLGDIVGVAGTPMRTKTGELTLVADGFRVLTKSLPDKFHGLHDVEQRYRQRYVDLIVNPDVRRVFRAIVRGVQQFLDARGFLEVETPILQEL-----AGGAAARPFVTHHNTLAQDLYLRIAVELYLKRLV------VGGIERVYEIGRNFRNEGVSTRHNPEFTMMEVYQAYA--TYADMMDLTEDLVCEL-VDNVHGRGVLPFGEREVDFARPWRRVPIATL----VGEHLKVGEDLA.................................... 345
417 5.000e-62UniRef50_A0A1F8BY28 Lysine--tRNA ligase n=31 Tax=root TaxID=1 RepID=A0A1F8BY28_9BACT  ali  16  93......ENLDIGDSIESKGQVFKTEAGEVTVRVKTFKLLSKALRPLWYGFKDVEERYRKRYVDFIMNPESKRIRSKIVSEVRNLLEKRGFIEIETPTLQPI-----YGGANARPFTTYYNALKQDFYLKISDELYLKRLI------VGGFEKVFEIDHDFRNEGIDATHNPEFTMMECYWAYADYN--DMMKLTEEIYSKVALK-VLGTTKVVYEGHKINLKTPWKRVTM----KEAIKKYLRIDVD...................................... 321
418 5.000e-62UniRef50_B9CLB5 Lysine--tRNA ligase n=2 Tax=Atopobium TaxID=1380 RepID=B9CLB5_9ACTN  ali  15  116..WDLLGMLDLGDIIGATGAVMRTRRGQLSIAPTRLVLLSKSLPEKFHGLTDREVRYRQRYVDLIMNPEVRRKRSQIISIIRQHMEDDGYMEVETPVLQEI-----LGGANAKPFITHYNALNTENYLRIATELPLKRLI------VGGLERVFEIGRQFRNEGTDLTHNPEFTSMEAYAAYSD--LAGMRKLSQELFQDIARRAEAGHEVITFQGTEIDLSGEWRMASLSEIASEVTGENLSIDTPVEKLREVLDR............................ 366
419 6.000e-62UniRef50_A0A1Y5MUF1 Lysine--tRNA ligase (Fragment) n=1 Tax=Campylobacter concisus TaxID=199 RepID=A0A1Y5MUF1_9PROT  ali  19  104.....KKYVEIGDIVYVRGYAFITRTGEFSMHVSELSLASKSLPEKYHGLVDVETRYRQRYLDMIMNPEDFKRRSVIISTIRRFFEEKGFLEVETPMLHPI-----AGGANAKPFITFHNALGVERYLRIAPELYLKRLI------VGGFEAVYEMNRNFRNEGMDLTHNPEFTSIEFYWAYHNY--HDLMGITEDLFNVI-LDKLDMEKVVNFDGMEIDFSKPFKRISY----KKALVEIGGLDENII.................................... 335
420 6.000e-62UniRef50_V7AF28 Lysine--tRNA ligase n=5 Tax=Mesangiospermae TaxID=1437183 RepID=V7AF28_PHAVU  ali  17  161....LKAYVDTGDILGVKGTIKRTKKGELSVCVLSFAILTKSLPDKYHGLTDKDKRYRQRYLDMTANPEVKRKRGKVESEIRRTMDSLGFLEVKTPVLQ-----GAAGGAEARSFITYHNSLGRDLYLRIATELHLKRML------VGGFEKVYEMGPIFRNEGISTRHNPEFTTIEMYEAYSDY--QSMMSLAEEIVTRCAL-AVHGKLTVDYQGVEICLEKPWRRETMHNLVKE................................................. 384
421 6.000e-62UniRef50_A0A2E3WWK5 Lysine--tRNA ligase n=2 Tax=Bdellovibrionaceae bacterium TaxID=2026715 RepID=A0A2E3WWK5_9PROT  ali  17  114.....FKHVDIGDFIGFSGFVFKTRKGELSLHCKDFQIISKSLPEKYHGITDTELKYRQRYLDLVMDPKSRKVRSKIIREIRSFLDNRGFLEVETPILQPI-----YGGASASPFVTHHNALDMQLFMKISPELYLKRLI------VGGFEKVYDLNKNFRNEGIDRSHNPEFTMLEWYEAYTDYKYQ--MKQFEELCAHVC-KEVTGGLKVTYEGKEVDFTTPWKRITMIDAIKE................................................. 336
422 7.000e-62UniRef50_A0A0F9YNX0 Lysine--tRNA ligase n=14 Tax=root TaxID=1 RepID=A0A0F9YNX0_9BACT  ali  16  135........IDIGDIVWVSGKSFLTKTGEITLKVEKFKLLSKCLPEKFHGIADIEIKYRQRYLDLISSPETFKKRSKIVRTMRNFLDSNDFVEVETPMLHPI-----LGGAAAKPFVTHHNALDSDFYLRIAPELYLKRLVI------GGLERVYEINRNFRNEGVSTKHNPEFTMLEYYTAHEDYIF--AMAFLQELMKKV-VSETCDSMIVKFGEHEIDFSKPFEILSMQDSIKKEDLLPENIDKTIKLKGAKLDNI........................... 382
423 7.000e-62UniRef50_A0A1G1PE06 Lysine--tRNA ligase n=4 Tax=Bacteria TaxID=2 RepID=A0A1G1PE06_9BACT  ali  19  84LGKDRFEDLDIADIIGVKGELFQTHTAEPTVKVEEFVLLSKALPEKWHGLKDVELRYRQRYLDLMANEQVFLLRTKIIQAIRKFLDERGFLEVETPMMHNIP-----GGAAGRPFSTHHNEYDLDLYLRIAPELYLKRLLVANL------DKVYEINRSFRNEGVSTKHNPEFTMLEVYSAYADY--EDMMRLARDLLI-FAAREALGETNFIYQGKTVDLALDWQKYSFAKIVKEKFDIAPDDSAEVMGQALGLKRL........................... 343
424 7.000e-62UniRef50_A0A2E6ZQB0 Lysine--tRNA ligase n=44 Tax=root TaxID=1 RepID=A0A2E6ZQB0_9CHLR  ali  17  99..YEILDDLDIGDWIGAEGTLFRTRTGQITLQVATFSILCKSLPEKWHGLTDVETRFRQRYLDLISNEDAIKTRSLLVSTIRQFMTKKGFIEVETPMLVPIAA-----GGMAHPFTTHHNALNRDLYLRIATELHLKRLV------VGGIEKVFEIGRVFRNEGVDLQHNPEFTTLESYEAFSDYN--DVMSMVEQLVSTAAIT-LNGSETVRYGEEELDFSPPWPRID----LREKIIQVSGIDF....................................... 330
425 7.000e-62UniRef50_M2XGA0 Lysine--tRNA ligase n=1 Tax=Galdieria sulphuraria TaxID=130081 RepID=M2XGA0_GALSU  ali  14  128.....KSLVDIGDIVGVQGCIKRTDKGELSIVVEDWQMLAKSLPDKFHGLMDVEKRYRLRHLDMIVHPQILKQRAQIVSTIREFLERKQFMEVETPALHCI-----AGGADASPFVTYHEALDLQLTLRIATELFLKRCI------VGGFEKVYEIGRVFRNEGISTRHNPEFTSLELYEAYKDY--QDMMNLTEELIKTVA-NQVCGTTEIVYMEERIQLGAPFRRVTM----NELVKETLGLDI....................................... 356
426 8.000e-62UniRef50_A0A1J5J147 Lysine--tRNA ligase n=1 Tax=Candidatus Wirthbacteria bacterium CG2_30_54_11 TaxID=1817892 RepID=A0A1J5J147_9BACT  ali  17  92LGKEMYSLLDLSDFLEITGTLFVTKTGEKTILATSIRMLAKPLPDEWYGLKDKEVRFRKRYIDLQLNPEVKKIRAKVIQLIRDFLNEREFVEVETPVLQVL-----YGGTNAKPFNTHINAYDMPMYLRIATELYLKRLV------VGGFDRVYEIGKDFRNEGVDQGHNPEFTMIEWYQAYADYHV--MMDTAEAMYKYIA-KKLYGTESIPKDGETIDISGKWQRIPLCT----AVTEKIGVDVTTL.................................... 331
427 8.000e-62UniRef50_A0A1Q7P2U4 Lysine--tRNA ligase n=2 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A1Q7P2U4_9DELT  ali  19  109..YEVLKLTDLGDIAFARGRAMRTKTGELSIEATEYRLLTKALPEKWHGLTDHETRYRQRYVDLSANLQVREIRTKLIAGIRRFLDDLDFVEVETPVLHKPE---EAGGATARPFGTHHNTLDLDLKLRIALELHLKRLI------VGGLERVYEIGRVFRNEGIDRRHNPEFTMLEFYQAYA--TYEDLMTLTETMVSHLA-TEVTGADEVTFQGVKIKFAPPWPRISMLG..................................................... 332
428 8.000e-62UniRef50_B9KZF5 Lysine--tRNA ligase n=58 Tax=root TaxID=1 RepID=B9KZF5_THERP  ali  17  100..AWFKRYVDLNDFVEADGHLFRTRTGEVSLEVHALRLLSKALPDKWHGLTDVETRYRQRYVDLMANPDTRQIRARVIRAIRQYLDERGFLEVETPTLQPI-----YGGAAARPFTTYYHALDQTFYLRISDELYLKRLL------VGGYERVYEICKDFRNEGIDARHNPEFTMLEFYAAYADY--HDIMQMCEELI-VFAAREALGTLTFQWGDTVIDLTPPWARMS----LREALLRFTGIDF....................................... 331
429 9.000e-62UniRef50_A0A254QMQ2 Lysine--tRNA ligase n=1 Tax=Bdellovibrio sp. SKB1291214 TaxID=1732569 RepID=A0A254QMQ2_9PROT  ali  19  105.......LVDLGDIVGVEGYVFKSQKGEFSIYLKHFEILTKSLPEKFHGVQDIEIKYRHRHLDLMTDADSRKVRSKIISEIRRFLDSRGFMEVETPTLQPI-----YGGAAATPFTTHHKALDMKLYMRISPELYLKRLL------VGGFEKVYEISKNFRNEGIDRTHNPEFSLLEFYEAYTDYNYQ--MNQFEELVSQLALK-ITGSMKVSYQGKEIDFTPPWRRLTVHDGVR----EYAKIDPD...................................... 332
430 9.000e-62UniRef50_A0A1F2QHW7 Lysine--tRNA ligase n=3 Tax=Bacteria TaxID=2 RepID=A0A1F2QHW7_9BACT  ali  16  117.....FTDLDVGDIIGCEGHVFRTRRGELTLFAEDWTLLTKSLPEKWHGLQDRETRYRQRYVDLVANPEVASTRGKLVTAMRRYLENLGFVEVETPILQPLP-----GGALARPFVTHHNALDTDLYLRIAPELYLKRLL------VGGFDRIFEIGKNFRNEGISLIHNPEFTMMELYWAYVDYNA--IMDLVENMIPALA-EEVMGTTRIAMGEGIIELRPPWPRRT........................................................ 332
431 9.000e-62UniRef50_A0A2D6Q3S7 Lysine--tRNA ligase n=2 Tax=Bacteria candidate phyla TaxID=1783234 RepID=A0A2D6Q3S7_9BACT  ali  15  89..FDLLKLFDIGDFIDAKGHVVKTKAGEVTVDVADVTLLSKGLPSTWHSLEDVEERYRRRYLDMLMNPEVFEKRSQIINSVRKFLEEKDYIEVETPVLQTI-----YGGGRARPFKTHHNTLDIDIYLRISTELYLKRLIA------GGLEKVFEIAKVFRNEGMDRSHNPEFTMLETMEAYADYM--DNMDLIEEMFEYVVLK-VFGKTKITYQGLVLDFKRPWERIKLEDLFK----EHTGVKATTLAKKLGVE............................. 340
432 1.000e-61UniRef50_E1QX83 Lysine--tRNA ligase n=29 Tax=Bacteria TaxID=2 RepID=E1QX83_OLSUV  ali  16  111........LDLGDIIQARGTVLRTRRGQLSVSPTSVTLLSKSLPEKFHGLTDRELRYRQRYVDLIMNRDVRRMRSAIVSQIRRYMESDGYIEVETPMMHAI-----LGGANARPFVTHFNALDRNFYLRIATELPLKRLI------VGGMERVFEIGRQFRNEGMDLTHNPEFTSMEAYCAYSD--LQGMKDLTMGLFKAIAREAEEGHEAIVYQGQEIDLSGTWRSATVAEIASEVCGEELTIDTPL..................................... 346
433 1.000e-61UniRef50_A0A286UGI1 Lysine--tRNA ligase n=1 Tax=Phellinus noxius TaxID=418867 RepID=A0A286UGI1_9HOMO  ali  17  168...EIHESFRRGDIVGVKGTPSRTKKGELSISPSQMVLLAPQLPSSHFGLKDQETRYRKRYLDLILNDETRRIRSKIINYMRRFFDGLGFLEVETPITSML-----AGGATAKPFITHHNDLNLDLYLRIAPE------LYLKELVVGGLDRVYEIGRVFRNEGIDLTHNPEFTICEFYMAYAD--MYDLMDITESLIEGLGGTTLKYKPEGKDEVYNLEFKRPWKRYDMIET----LEEKLGVKFP...................................... 405
434 1.000e-61UniRef50_A0A0G1W360 Lysine--tRNA ligase n=8 Tax=Microgenomates group TaxID=1794810 RepID=A0A0G1W360_9BACT  ali  18  90..FDVLKLFDVGDFLAVSGEVIKTSAGEITIDVDKFELLSKSLPDDWHGLKDVEDRFRKRYLDLLVNPEVKEVRTKIISSIREFLDNKGFLEVETPTLQPI-----YGGGFAKPFVTHHNVLDCDFYLRISDEMYLKRLI------VGGFEKVYEITKVFRNEGVDYDHNPEFTMFEAMIAFEDYEYG--MDLIEEIFEHSA-KKVLGKTKINFQGKELDVKRPWNRYKYVEAI................................................... 313
435 1.000e-61UniRef50_M4V7P4 Lysine--tRNA ligase n=1 Tax=Bdellovibrio exovorus JSS TaxID=1184267 RepID=M4V7P4_9PROT  ali  19  96..SEKDKLIDLGDIVGLEGYVFKSQKGELSLYVKTFEVLTKPLPEKFHGIQDVEIKYRHRHLDLISDPESREKRGKIIKAIKRFLDDRGFMEVETPVLQPL-----YGGAAAHPFTTHHRALDMKLYMKISPELYLKRLI------VGGFEKVYEIGKNFRNEGIDRSHNPEFTMLEFYEAYTDYNYQ--MTQFEELVSTVC-KEITGSTTVNYQGKEVNFAPPWRRLTVLDGIK.................................................. 324
436 1.000e-61UniRef50_A0A2T7NGX0 Lysine--tRNA ligase n=2 Tax=Pomacea canaliculata TaxID=400727 RepID=A0A2T7NGX0_POMCA  ali  18  556......EKVKRGDMIGVRGKPAKTKKGELSIVPVEMTLLSPCLPHLYYGLKDKEKRYRQRYLDLIINDNVRHIRTRVINYLRHFFNGLGFLEVETPMMNMIP-----GGATAKPFITHHNELNMDLFMR------VAPELYLKMLIVGGFDRVFEIGKNFRNEGIDLTHNPEFTMLEFYMAYADYN--DLMQLAEELLSGL-VKHLTGGYKVVYHPEEIDFTPPFKRFSLV----RDLEKSLGIQFP...................................... 791
437 1.000e-61UniRef50_A0A0G1GIZ9 Lysine--tRNA ligase n=1 Tax=Candidatus Gottesmanbacteria bacterium GW2011_GWA2_43_14 TaxID=1618443 RepID=A0A0G1GIZ9_9BACT  ali  17  88..SELLSYIDLGDFIAVQGNVGRTKAGEISVIASNFQIITKPLPDKWHGLKDIEERYRKRYLDMLLNPEVRRKRSHIVRAIRNYLDNKGFMEVETPTLQPV-----YGGGFARPFKTHHNSLEADFYLRISDEMYLKRLI------VGGIEKVYEITKVFRNEGFDRDHNPEFTMFEAQIAYRDYKYG--MDLIEEIIEYTA-KKATGKTKFTYQGIEMDVKRPWQRFSMV----EAIGKFAGLDP....................................... 319
438 1.000e-61UniRef50_P94282 Phenylalanine--tRNA ligase alpha subunit n=61 Tax=Borreliaceae TaxID=1643685 RepID=SYFA_BORBU  ali  12  239....ENKKFRAYNIHIPSAKTFIGRANSYLDYISKIKDKLVGLG--FQEFDGPLVETEFFNNDALFMPQFHPSR-----DIKDVYYISDPSMQESPYFSNVKLAHETGYATGSWRYSFSEDLSKRLVLRTHGTVLSAKQLINAKN----PSRYFGVIRCFRYDQVDATHGVDFYQTEGIVIEDGVSIKTLLGLLEIFAKELGATEIKYVPAYFPFTEPSIEIHGWFELGGSGIFRPEVTKPLGIDLPVIAWGIGIDRMALMHLGLNDLRDLFTYDI......... 511
439 1.000e-61UniRef50_A0A2P4YCL1 Lysine--tRNA ligase n=2 Tax=Phytophthora palmivora var. palmivora TaxID=611791 RepID=A0A2P4YCL1_9STRA  ali  16  579........LRRGDLVGVKGHPGKSKKGELSIFPQQLVLLSPCMPKSHAGLTQQDTRYRQRYLDLIMNDDVFQTRAKIINFIRRFLDEKHFLEVETPMMNMI-----VGGATAKPFVTYHNDLHMNLFMR------VAPELYLKQLVIGGLDRVYEIGRQFRNEGIDLTHNPEFTSCEFYMAYADYN--DLMTLTEKLFSEM-VKEITGGYTITIQKEPIDFTPPFKRVSMVS----AVEEATGVKIPI..................................... 813
440 1.000e-61UniRef50_Q3Z8X9 Lysine--tRNA ligase n=38 Tax=root TaxID=1 RepID=SYK_DEHM1  ali  17  98...ELLKDLDLGDFIGAEGSLMRTRTGEPSLAATKISLLSKSLLEKWHGLQDVEKRYRQRYLDLISNAQTFLTRSQVISAIRSFMSSKGFLEVETPVLQP-----EAGGALARPFITHHQALDCDFYMRIALELHLKRLI------VGGFDRVYEIGRIFRNEGVSTRHNPEFTMMESYQAYADY--KDVMDFLEEMVSSV-VKEISGGYTVPFGDTTLDFTPPWPRLSM----RDAVKQYAGIDFFDFPTKEAL-AAEMIRRKLKDPAKDWGKLVD........ 359
441 1.000e-61UniRef50_Q8TSN5 Lysine--tRNA ligase 2 n=65 Tax=root TaxID=1 RepID=SYK2_METAC  ali  21  120.....KNLMDSGDIIGIQGELFRTKRGENSISVSEFSLLSKSLPEKFHGLKDVETRYRKRYLDLIVNAEKREIRSKLISEIRRFLADREFLEFETPILQTV-----YGGANARPFKTFHNCLGQNLFLRIAPELYLKRLV------VGGYEKVFEISKNFRNEDIDTTHNPEFTMIEVYEAYRDYN--DMMDLTEALISELVFR-LTGGYEVKMGENTINLRSPWKRISMEG----ALKEYAGLDV----FSHSLEELKQI........................ 359
442 2.000e-61UniRef50_UPI000A158FDA lysine--tRNA ligase n=1 Tax=Cronobacter sakazakii TaxID=28141 RepID=UPI000A158FDA  ali  16  70VGDEEYELFDLGDLVGIEGKVFKTNVGELSVKAIGFTLLTKSLPDKYHGLKDVEQRYRQRYLDLITSRETFVTRSKIIREMRRYLDDNGYLEVETPMMHAI-----AGGASARPFTTHHNALDMELYMRIAIELHLKRLI------VGGLEKVYEIGRVFRNEGVSTRHNPEFTMIELYEAYADYN--DIMKLTENMVAHIA-KQVLGTTTIQYGDYEINLEPEWTRLH........................................................ 293
443 2.000e-61UniRef50_A0A1B0G3H6 Lysine--tRNA ligase n=1 Tax=Glossina morsitans morsitans TaxID=37546 RepID=A0A1B0G3H6_GLOMM  ali  15  719.......KIRRGDIVGINGFPAKTKKGELSIVPQEIKLLSPCLPHLHFGLKDKETRYRQRYLDLILNRENFHTRAKVISYIRQFLDGMGFLEIETPMMNMIP-----GGATAKPFITHHNELNMDLFMRIAPE------LYHKMLIVGGFDRVYEIGRQFRNEGIDMTHNPEFTTCEFYMAYADY--HDIMEITEQMVSGM-VRAIHGTYKIKYHPEEIDFTPPFKRVSMITT----LEEKLKVQFP...................................... 953
444 2.000e-61UniRef50_A0A1F7TYM3 Lysine--tRNA ligase n=1 Tax=Candidatus Uhrbacteria bacterium RIFCSPHIGHO2_02_FULL_53_13 TaxID=1802389 RepID=A0A1F7TYM3_9BACT  ali  18  92..EEFMATVDVGDFVEGSGPVMRTKTGQESLAVTQVRIIAKALPEKWHGLSDVEMRFRQRELDLITNPAVRHTRAHIISAIRRFFDDHGFLEVDTPILQHVAA-----GASARPFVTHHNALDEDLYLRIAPELFLKRCVI------GGFERVYEIARCFRNEGIDHTHNPEFSQVEAYAAYMDY--ETLMGFMEELICAL-IDAIGLDRSAVPFGHTLDFSNAIPRKTY----RDLIVEKSGIDVDTLE................................... 328
445 2.000e-61UniRef50_A0A2E4KDN7 Lysine--tRNA ligase n=32 Tax=Bacteria TaxID=2 RepID=A0A2E4KDN7_9ACTN  ali  14  72..FESFAALNIGDWIGVKGEVMKTKRGELSVKVDKWEVLARPFPDKWHGISDPDTRYRQRYVDMWVTEEAKKARSNLISMTRKWLESKDFMEVETPVFHPIP-----GGALAKPFITHHNALDMELYLRIAPELYLKRLV------VGGXEKVFEIARVFRNEGLSTRXNPEFTMLEXXXAYADWD--DIMELAENLIEFLAVE-LTGSSTVSYDGKEIDLSTPWRRASMIDLIRE................................................. 297
446 2.000e-61UniRef50_A0A2H6EY25 Lysine--tRNA ligase n=19 Tax=Bacteria TaxID=2 RepID=A0A2H6EY25_9BACT  ali  14  100.....FKLLDIGDWIGVTGDVFKTHTGEISIVVKELTLLSKTLRPLYDQFADKELRYRQRYVDLIVNPEVRDRRSKIISTMRRYLEEKGYLEVETPILQPV-----YGGAFARPFVTHHNTLDMTLYLRISNELYLKRLI------VGGFDGVFEFAKDFRNEGMDRFHNPEFTQMELYVVYEDYYF--MMNLVEEMISTIA-EKITGSKTIVYQGNEIDLTPPWKRIRMFDAIEEEIGKKLDIDVEAL.................................... 361
447 2.000e-61UniRef50_A0A1F9GLG5 Lysine--tRNA ligase n=3 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A1F9GLG5_9DELT  ali  17  94LGDEQFKLFDVGDFIWVQGSLFRTKTEELTLKATALKIATKPLPEKWHGLQDIETRYRQRYVDLIVNPEVKKARSKVLQALRDFFGKRDFLEVETPMMQPIP-----GGAAAKPFITHHNKLDMDLYLRVAPELYLKRLV------VGGLERVFEVGRNFRNEGISTQHNPEFTMLEFYQAYANY--EDLMKLTEELLEELA-TKTNGSTKIKYEDAEINFKSPYPRLTM----KEAVKKYTKQDPN----KLSTEKLVNIFEEE.................... 345
448 3.000e-61UniRef50_A0A2H0X8Y4 Lysine--tRNA ligase n=2 Tax=candidate division WWE3 TaxID=422282 RepID=A0A2H0X8Y4_9BACT  ali  18  91..WEVVLLIDRGDIIGIAGNLFNTDAGELTILCDSFSILSKSLRPEWYGLKDMEVRYRQRYLDLILNPEVREIRSKLVKAMRDFLGAEGYIEVETPTLQPL-----YGGANAKPFTTHLNALDCDLFLRVADELYLKRLVI------GGYERVFEICKDFRNEGMDLSHNPEFTMIEYYEAYADY--QRMMDLTEEMFRKICMS-VHGKLEMTIGEKTIDLSKKWQRIELV----KAIEDHLGINV....................................... 322
449 3.000e-61UniRef50_A0A182FQR6 Lysine--tRNA ligase n=1 Tax=Anopheles albimanus TaxID=7167 RepID=A0A182FQR6_ANOAL  ali  15  657LFMEETAKIRRGDIIGVTGVPGKTKKGELSVMPKRIKLLAPCLPHLHYGLKDKETRFRQRYLDLMLNRDIFIVRSKIISYVRRFFDQLGFLEVETPMMNMI-----AGGATAKPFITHHNDLNMDLFLRIAPE------LYLKMLTVGGLDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYN--DIIEITQKLLSGMGSYKIKYHPEGEGQEYEIDFTPPFKRISMISS----LEEILKVKFP...................................... 898
450 3.000e-61UniRef50_A0A2H0NBY7 Lysine--tRNA ligase n=2 Tax=Parcubacteria group TaxID=1794811 RepID=A0A2H0NBY7_9BACT  ali  19  95IGAEEYQLFDLGDFVEFIGQAFITKTKEPTLLVNQVIILSKSLPDPHYGLKDPDLRFRKRYLDLLVNPEIFDLRSQIIKSARQYFDQHGFTEVDTPVLQAV-----AGGAAARPFVTHHHALGIDLFLRVAPELYLKRLII------GGYEKVYEIARCFRNEGIDHQHNPEFTQLEAYWAYQDYEF--LMGFMEKFFEFLVKKVNNNGLKIKNGDDILNFKPPYPRLD----FKEVLDQALKIDLD...................................... 334
451 3.000e-61UniRef50_A0A2G9P996 Lysine--tRNA ligase n=1 Tax=archaeon CG10_big_fil_rev_8_21_14_0_10_43_11 TaxID=1975556 RepID=A0A2G9P996_9ARCH  ali  16  78LGEEAHKQFKKGDIIQVTGTLFYTHKNELTLQVKKFKLLAKSLYDKWHGLKDPELRYRQRYRDMILNDNTTKLRSAIVSQMRKTLEKKGFVEVETPILQPL-----YGGANAEPFKTHYHALKRDFYLRISPELYLKR------LTVGGMERVFEIGRNFRNEGIDTSHSPEFSMLEAYQAYADY--EDMIKLNEDLFTDI-LKNVLKKTTFTIKEQKVSFKPPFARITMID----AIKKYAGIDVNTM.................................... 318
452 3.000e-61UniRef50_A0A2E5TR15 Lysine--tRNA ligase n=2 Tax=bacterium TaxID=1869227 RepID=A0A2E5TR15_9BACT  ali  16  115.......NYDVGDIIGIVGTPFKTKRGELTVNITSIELLTKSLPEKHHGLQNIELRYRHRYIDLISNPELFKIRSQAISFIRSYLEKKEFMEVETPVLHNI-----YGGANAKPFNTYHNELEQHLYLRIALELHLKRLI------VGGFEKVFEIGRVFRNEGISYKHNPEYTLLELYEAYTDY--QDMMTLTEELLSSLVFK-IHNSYKITYKETEIDFSPPFRRLKLVD----EIQKQCKVDCNDI.................................... 344
453 3.000e-61UniRef50_W7W9Z0 Lysine--tRNA ligase n=2 Tax=Betaproteobacteria TaxID=28216 RepID=W7W9Z0_9BURK  ali  21  117.....FKHWDLGDILGAEGTLFKTRTGELSLKVGTIRLLTKSLPDKFHGMADQELKYRQREVDLIMDEERFRARSKAVSSIRQFMVEHGFLEVETPMLHPIP-----GGANAKPFVTHHNALDQQMFLRIAPELYLKRLV------VGGFERVFEINRNFRNEGVSVRHNPEFTMMEFYAAY--WTHHDLMDFTEQILRH-AARKAVGTAQLAYGGQAVDLESPFARLSVRD..................................................... 335
454 3.000e-61UniRef50_A0A1J1J949 Lysine--tRNA ligase n=3 Tax=Clunio marinus TaxID=568069 RepID=A0A1J1J949_9DIPT  ali  16  152..SEDTDRIRRGDIIGINGYPGKTKKGELSIIPKSIKLLSPCLPHLHFGLKDKETRFRMRYLDLILNRDIFYVRSKIISYIRQFFDKQGFLEVETPMMNMIP-----GGATAKPFVTHHNELNMDLYMRIAPE------LYLKMLIVGGLDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYS--DLIEITEKLLSGM-VKSIHGKIKYHPDGVEIDFTPPFKRVSMLKT----LESILKVKFPVA.................................... 393
455 4.000e-61UniRef50_A0A0B3ANW1 Phenylalanyl-tRNA synthetase alpha chain n=1 Tax=Archaeon GW2011_AR13 TaxID=1579372 RepID=A0A0B3ANW1_ARCG0  ali  17  220...WKGKKFRRYDVSSSVPIINGGKRHFVNQAVDYARNIWTDMG--FQEMRGDMIQSGFWNFDALFTAQDH---------------------------------------------KWDENDAKKMSLRTHTTCLSSKTLSQLDKN-KLPMKFFSIGKCFRNETLDWSHGFEFNQSEGIVVDRNANFRHLLGYLKQFFKKMGYEKLRFNPAYFPYTEPHPEKKVWLELGGAGIFRPEVVIPLGEYIPVLAWGPGFDRVLMDYYKVKDLRELYKNN.......... 451
456 4.000e-61UniRef50_A0A1Q2MC41 Lysine--tRNA ligase n=72 Tax=root TaxID=1 RepID=A0A1Q2MC41_9BACT  ali  19  93..WSLAKLLELGDIIAGEGELSRTRTGELTIWVETLTFLSKSIPEKFHGLADVDMRYRQRYVDLWANPEVFRLRSQMITSIRNLLSDKGFLEVETPMMQSI-----AGGAAAKPFITHHNTLDMDLFMRIAPELFLKRLL------VGGMEKIFEINRSYRNEGIDTKHNPEFTMMELYQAYADYS--DMMDITEEIVCSLIEEHCGGNYKLKFGDLEVDYTRPWRRAKYADL----LKEYSGCDITDI.................................... 328
457 4.000e-61UniRef50_A0A0W0EZG8 Uncharacterized protein n=1 Tax=Moniliophthora roreri TaxID=221103 RepID=A0A0W0EZG8_9AGAR  ali  19  1..........................................MEMGFAEMTSTFVESAFWCFDALFVPQQHPAR-----DLQDTFYIS---EVSTPSLDPEPYYKRVSTVHEHGGYGWSHEESKKLLLRTHTTASSAHMLYKLAARCRGPAKLFSIDRVFRNETMDATHLAEFHQVEGVVADRDLTLADLIGFMRVFFSKMGIEQVRFKPAYNPYTEPHPMLHKWVEVGNSGMFRPEMLEPMGFPKNVRGWGIGLERPTMIRY...................... 266
458 6.000e-61UniRef50_A0A1W9RC25 Lysine--tRNA ligase n=1 Tax=Candidatus Omnitrophica bacterium 4484_70.1 TaxID=1970782 RepID=A0A1W9RC25_9BACT  ali  18  82..YELFKDLDIGDIIGVKGYLFKTKTGEPTVFVEDLRLLSKCLPEKWHGLKDIEVKYRQRYLDLIASPQVFLKRIEIIEFIRDFFKKLGYKEVETPLLHLIP-----GGARGTPFATYYQAIDTQVYLRIAPELYLKRLL------VAGFDKIFEINKSFRNEGISARHSPEFTMLEAYCAYQDYEY--MIKICEDLVSSL-VERIHKSLRIEYQGKKIDFTPPWPRISFVEIFEKELGVFPSDSPEVVRKKLS------EKLNIS-LKELSRSQI......... 340
459 6.000e-61UniRef50_Q6YPY6 Lysine--tRNA ligase n=23 Tax=Mollicutes TaxID=31969 RepID=SYK_ONYPE  ali  19  107.........DLGDIIGIKGFLFKTKTQELTIKALEFIHLTKALPDKFHGLQNREEMRKNRYVDLIVNEQVFLTRSLIMKYIRNFFDNQGFLEVETPILQPT-----LGGASAKPFITHHNALNCDFYLRIATELPLKKLI------VGGMNKVYEIGRLFRNEGIDATHNPEFSTIEAYLAYAD--MQDIMDLTKQCLQELA-QKLFGKLQFTYQNQEIDFSH-FAKVSMVASIK----EKTGIDFT...................................... 331
460 7.000e-61UniRef50_Q1LTU4 Lysine--tRNA ligase n=348 Tax=root TaxID=1 RepID=SYK_BAUCH  ali  20  112...EHFKKWDLGDILGVHGRLFKTKTGELTINCNEIILLTKALRPKFHGIVDKQIRYRQRYLDLITNKNSFKTRSQIITEIRQFLNKEDFIEVETPILQSLP-----GGATARPFITYHNALDMNLYLRIAPELYLKQLII------GGFEKIFEINRNFRNEGLSAHHNPEFTMMELYIAYADY--HDVMLLTQNLLNT--ITNHVLGTNIIQYGNKLDFSKNFVKMTMKEILSKHLDDKMGIHIDQK-WGLG............................... 370
461 7.000e-61UniRef50_A0A2M7B246 Lysine--tRNA ligase n=1 Tax=Elusimicrobia bacterium CG06_land_8_20_14_3_00_38_11 TaxID=2014307 RepID=A0A2M7B246_9BACT  ali  16  91.....FELFDIGDFIGVEGTVFKTHTGETTIRVAKFQLLSKSLPEKWHGLKDVETRYRQRYLDLISNSEVFKKRAKIISSIRNYLDGNGFVEVETPMMQSIP-----GGAAAKPFITHHNALDMDLYLRVAPELYLKRLV------VGGLDRVYEMGRTFRNEGISIRHNPEFTILEVYQGYADYN--DMMVLCKNIIRAAGVSKITETNSSDPLGSEIDLFGDWKRLSFPDVFSEEKLKKLGQQFEV..................................... 360
462 7.000e-61UniRef50_A0A2C9JRN6 Lysine--tRNA ligase n=11 Tax=Eukaryota TaxID=2759 RepID=A0A2C9JRN6_BIOGL  ali  15  192.....EKKIKRGDIVGVSGRPAKTKKGELSIVPVSVTLLSPCLPHLYYGVKEKETRFRQRYLDLMINEDIFITRAKIINYLRKFFDNLGFLEVETPMMSLIP-----GGAVARPFITHHNDLNQDLYMRIAPE------LYLKMLVVGGIDRVYEIGKQFRNEGIDLTHNPEFTTLEFYMAYADYN--DLMTMAESLISGM-VKQLKGSYKITYQGYEIDFTPPFKRVSMI----PALEEAMNVTFPPAA................................... 431
463 8.000e-61UniRef50_A0A2E8NFV0 Lysine--tRNA ligase (Fragment) n=1 Tax=Gammaproteobacteria bacterium TaxID=1913989 RepID=A0A2E8NFV0_9GAMM  ali  19  93LGEQKYALLDVGDIVGVEGTVMRTNKGELTISASDFVLLNKPLPEKYHGLVDQEVKYRQRYLDLIMSSETRRARSDLIQKIRTFFVDLGYLEVETPMMHPIP-----GGATARPFSTFHNALDRELYLR------VAPELYLKKLVVGGFERVFELNRNFRNEGLSTRHNPEFTMLECYQAYSDY--RDLIEMTDQLLSEL-VHSVSGSSKIVYQGREYDFSKGAQQITMSESI................................................... 322
464 9.000e-61UniRef50_L0HJV4 Lysine--tRNA ligase n=1 Tax=Aciduliprofundum sp. (strain MAR08-339) TaxID=673860 RepID=L0HJV4_ACIS0  ali  18  85LGEELKRYVDRGDFLWIRGEVMRTKRGELSILAKEIRIAAKALPHEWFGIGDVEKRYRQRYLDLMFNRQTFRKRSEIVKEIRRFLWDRGFLEMETPILQPV-----YGGANAKPFKTHVNAIDRDYYLRISDELYLKRLI------VGGYNRVFEIGKDFRNEDIDTTHNPEFTMIEIYQAYVDYN--DMMDLTEGMIKHVARHMSVDKINFG--GHEIDLTKPFRRERMLDMDIKALLEKYKIKMPQYNRGLALGKL........................... 350
465 1.000e-60UniRef50_A0A2N9LYD1 Lysine--tRNA ligase n=19 Tax=Bacteria TaxID=2 RepID=A0A2N9LYD1_9BACT  ali  18  99..FELYKLLDLGDHIGASGYLFRTRTGELSVHVEEITFLSKDLPEKWHGLTDVELRYRQRYVDLVMNPEVREKRSKLIQSMRRFLDAQGFVEVETPMMQPV-----AGGAVAKPFVTHHNTLDMDLYLRIAPELYLKR------LTVGGFDRVYEINRSFRNEGLGWRWNPEFTMLEFYQAYTNY--QGVMDLTQELITQ-AAKDVTGGTKTKWTVKDSEGDLLDLQVAGSALARGELGRR............................................ 329
466 1.000e-60UniRef50_A0A0G1E829 Lysine--tRNA ligase n=4 Tax=Parcubacteria group TaxID=1794811 RepID=A0A0G1E829_9BACT  ali  19  105.....TQTIDVGDFIQVSGGLFRTQRGEKTLLVKSYRLLSKSLLEKWHGLADVETRFRKRYLDLLSNPEVFKKRSRVIRFIRDYFQNDGFMEVDTPILQAV-----ASGAIARPFKTHHNALNADMYLR------VAPELYLKELVIGGYEKVFEIARCFRNEGIDYAHNPEFTQIEFYWAYQDY--AGLMAYMEKFMARL-VEEICGSTKVEYDGQTVDFAGPYARVD----FRQALLEEIKIDLD...................................... 334
467 1.000e-60UniRef50_A0A1F5NPE0 Lysine--tRNA ligase n=1 Tax=Candidatus Doudnabacteria bacterium RIFCSPHIGHO2_01_FULL_46_14 TaxID=1817824 RepID=A0A1F5NPE0_9BACT :  ali  17  94LGKEKFASFDIGDIFEAHGMLLETKAGEKTILLSDFRILTKSLPDQYHGLKDVETRLRKRYLDLLANPEMFRKKSVFWKTVRDFMIEKGFLEVEMPVLESVP-----GGAEAEPFVTHHNALDRDFYLRISLELPLKRLL------VGGYEKVFEIGRIFRNEGISTEHLQDYTQMEFYWAYADY--HDMMEMLVELYQRI-IKNLLGTTRVKSQGVEIDWGKPWKKYDYYELFKKNV............................................... 326
468 1.000e-60UniRef50_A0A1F5YFZ7 Lysine--tRNA ligase n=2 Tax=Candidatus Gottesmanbacteria TaxID=1752720 RepID=A0A1F5YFZ7_9BACT  ali  17  93.......LIDIGDFIAVQGKVDKTASGEISVFAYNFQIIAKSLPDKWYGLKDIEERYRKRYLDMILNADVSKRRSKTVQAFRDFFNNKNYLEVETPTLQPV-----YGGGFARPFITHHNALDADFYLRISDEMYLKRLI------VGGFEKVYEITKVFRNEGVDHEHNPEFTMFEAQIAYEDYHYG--MDIVEELLEYV-TQNVLGKLKVIYQDKVLNFARPWKRYRLV----EAVKKYTPLDP....................................... 319
469 1.000e-60UniRef50_B9XAA4 Lysine--tRNA ligase n=43 Tax=PVC group TaxID=1783257 RepID=B9XAA4_PEDPL  ali  20  90..FDIFKLLDMGDFLGVKGVLFTTKTGEISVKLASFTIIGKALPEKWHGLVDTEIRYRQRYLDLMSNDEVKKLRSAVVREIRNFFHSRGYVEVETPMMQNIP-----GGAAAAPFVTHHNALGCNFYLRIAIE------LYHKRLLVGGIDKMFEIGKNFRNEGLSRKHNPEFTMLEAYQAYGDY--ETMMELVQSMIVHLGTLVIEHKDAEGKVTKTIDLTPNWRRAKYKDLVRE................................................. 321
470 1.000e-60UniRef50_UPI000BE854EC lysine--tRNA ligase n=1 Tax=Helicobacter pylori TaxID=210 RepID=UPI000BE854EC  ali  19  101....LKKHLEVGDIVLVKGFPFATKTGELSVHALEFHILSKPLPEKFHGLSDIELRYRQRYLDLIVNPDVFKKRSLIVSSVRKFFEMEGFLEVETPMMHPIP-----GGANARPFITYHNALEVERYLRIAPELYLKRLI------VGGFEAVFEINRNFRNEGMDHSHNPEFTMIEFYWAY--HTYEDLIELSKRLFDYL-LSPLARRNDSNPNADRFELFIAGKEIANGERFKNQVAEKEKGDEPTAGQGIGIDRLVMLLTGAKSIKDV.............. 389
471 1.000e-60UniRef50_A0A134CCD2 Lysine--tRNA ligase n=98 Tax=root TaxID=1 RepID=A0A134CCD2_9FIRM  ali  18  95..WALFKLMDLGDIIGIEGTVFVTHTGEVTVRVLHVAMLTKALPEKFHGLTDKEQRYRQRYLDLIVNPEVRKKRAKMLQAIRNWYTDHGFLEVETPVLQPL-----YGGANAKPFTTHFNALNLTMYMRIAPELYLKRLL------VGGYERIFEITRNFRNEGMDTRHNPEFTAIETYQAYGD--IEDVIRQTEEIVEACAIASY-GTTKFTYEDTEIDVKGPWPRMTMA----EAVKKYTGEDFDACE................................... 330
472 2.000e-60UniRef50_R1G3L7 Lysine--tRNA ligase n=1 Tax=Candidatus Nanobsidianus stetteri TaxID=1294122 RepID=R1G3L7_9ARCH  ali  19  98..EDAYEFIQRGDIIGVYGKVGRTKAGELSVFAEDWIILTKSLPDQWYGFTDVEERYRKRYLDLLMNDEVRRIRFKTISYVRKYFENLGYIEVQTPVLQPI-----YGGANAKPFITYVNDLKENWYLRIATELYLKRYL------VGGFNKVFEIGPDFRNESIDVTHNPEFTMLEAYEAYANRDK--MMEIVENLIYGIA-KDIIGKDYIEYNGKKISLKPPWRRLTMYD----ALKEYANIDVTKLS-----DEEIMEIMKQNNIQ................ 347
473 2.000e-60UniRef50_A0A2D6ELE8 Lysine--tRNA ligase n=3 Tax=Proteobacteria TaxID=1224 RepID=A0A2D6ELE8_9PROT  ali  16  102.....KKYVDMGDIIGVEGRMTRTQKGELTLAADRFEIINKSLPDKFKGLSDTETRYRQRYVDLIMNDETFKKRSQIVSAIREYMTEAGFMEVETPMLH-----HKASGAAARPFETYHNALSMEMKLRIAPELHLKRLV------VGGFDRVFEINRNFRNEGVSVRHNPEFTMMEFYAAYWDY--HDLMDFSAKLIEHCAIKA-MGTTELTYGEHKVSLKAPFTKLSMKE..................................................... 320
474 2.000e-60UniRef50_A0A1Y1R9B4 Multifunctional fusion protein n=1 Tax=Campylobacteraceae bacterium 4484_4 TaxID=1970775 RepID=A0A1Y1R9B4_9PROT  ali  19  103....LKKLLEVGDIVVVRGFPFVTKTGELSLHATSLEIATKALPEKFHGLQDKELRYRHRYLDMIMNPEVFRIRSKIVSLVRHFFESRSFLEVETPMMHPI-----AGGAAARPFITHHNALDVERYLRIAPELYLKRLI------VGGFESVFEINRNFRNEGMDQTHNPEFTMIEFYWAWHNY--EDLMKLTEELFDYL-FDELALPRKLVYGEYEIDFSTPFEKIKWAD..................................................... 322
475 2.000e-60UniRef50_A0A1F9VQ68 Lysine--tRNA ligase n=13 Tax=unclassified Elusimicrobia TaxID=1797919 RepID=A0A1F9VQ68_9BACT  ali  18  98LGAEPYQLVKAGDFVGVEGKIFKTKTGEITIQAESVTLLCKSLPEKWHGLKDVETRYRSRHLDLLANPETFRKRTVIIRAVRAVMDEAGFLEVETPVMLP-----KAGGAAAKPFVTHHNALDQDLVLRIATELYLKRLI------VGGYERVYEIGRIFRNEGVDTRHNPEFSMMEAYQAYADYTMRELEKIFDRCSSALGVEQV------EYRGRTLGLKPPFR-----ALRLPEVQEKCGEDIHQILAGQSFNRP........................... 345
476 2.000e-60UniRef50_H5VFA9 Lysine--tRNA ligase n=3 Tax=Epsilonproteobacteria TaxID=29547 RepID=H5VFA9_HELBI  ali  19  79.GFETFKKVEVGDILNVVGYPFVTKTGELSLHASTYKILTKALPEKFHGLSDIELRYRQRYVDLIANPEVFKTRSQIVAMIRYFFEQKGFLEVETPMMHPI-----AGGANARPFITYHNALEVERYLRIAPELYLKRLV------VGGFEAVFEINRNFRNEGMDHSHNPEFTMLEFYWAYK--TYEDLIALTQELFHEL-LKALQLPTQIPYQDMVIDFN-----AFSVMSFRQALLEIGGV......................................... 309
477 2.000e-60UniRef50_A0A2H0ULF3 Lysine--tRNA ligase n=12 Tax=Patescibacteria group TaxID=1783273 RepID=A0A2H0ULF3_9BACT  ali  16  96.......TLDIGDFVEATGQAFVTQKGEKSIEASKLRIITKSLRPEHYGVKDIETRLRQRYLDLLMNPQMFRQKSIFWQKTRDFLTNEGFLEVETPVLEST-----TGGAEARPFATHHNALDIEMYLRISLELPQKRLL------VGGFEKTFEIGRVFRNEGMDADHLQDYTQMEFYAAYHNYN--DLMRISEKLIKEV-IQATVGTLKTTYQGNEIDWSGEWKTIDYCDEFKKE----TGIDI....................................... 322
478 2.000e-60UniRef50_A0A218NLZ5 Phenylalanyl-tRNA synthetase subunit alpha n=2 Tax=Candidatus Micrarchaeota archaeon Mia14 TaxID=1920749 RepID=A0A218NLZ5_9ARCH :  ali  15  204...WEGKGFEPYSVDAEVAPSYPALRHPMNEFINYIRYKMVSLG--FKETSGSIIQPAFWVFDSLFSPQDHPTR-----DMQDTFFLSSPEKID---IDDEELINKVKNMHLSNWKKWDINNAKQAVLRTHTTAVSAHSMYNYRNDFTTPVKLFTIDKAFRNESVDYKHLAEMYQFDGVVIGKDLSMANLIWILKEFFQSLGLE-IRVQPSYFPFTEPSNEHNDWIEMGGAGVIRNDITEALGLKATVLAWGLGLDRMMLSRAKLNSLSDIYKNNI......... 475
479 2.000e-60UniRef50_D8LM77 Lysine--tRNA ligase n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LM77_ECTSI  ali  17  156..FWKNGLLRRGDLIGVTGYPGKSKKGELSVFPTTMVLLSPCLPNSREGLKNQETRYRQRYLDLMTNDETRRVRSKVVNYIRSFLDERGFLEVETPMMNMV-----AGGATAKPFVTHHNDLNLDLFMR------VAPELYLKMLVIGGLDRVYEIGRQFRNEGIDLTHNPEFTTCEFYQAYADY--EDLMSMTEQMISGM-VKKICGSFKIKYQLNPVDFTPPFRRVSMMD----GLEEVLKVKLPALD................................... 398
480 2.000e-60UniRef50_A0A0S8GI51 Lysine--tRNA ligase n=11 Tax=root TaxID=1 RepID=A0A0S8GI51_9BACT  ali  13  99......KLLDLGDILGAEGTLGRTKTGEITIWVRKLSLLAKALPPKWHGLQDVEARYRQRYVDLFSNPKVMKIRAAIIDTMRAYLREKGFIEVETPMMQPL-----AGGAAARPFVTHHNTLDMDLYLRIAPELYLKRLL------VGGMEKVFEINKNFRNEGISTQHNPEFTMCELYQAYADYNV--MMDLMEELVCLL-VRQRSRDMKLEFEDLIIDYAPPWPRRTYGELFAEHVGCEMDDTEALRKKARQIEIPEANMDDTIVISELFEHLV......... 360
481 2.000e-60UniRef50_UPI000BB7444C lysine--tRNA ligase n=1 Tax=Paucisalibacillus globulus TaxID=351095 RepID=UPI000BB7444C  ali  17  83IGEEQYSLFDIGDFIGVEGRIYSTNTNEKTLRIESYVFLGKALPEKWHGLSNVELRYRQRYLDLMMTQETQKRRINMVRAIRRFLEDKGFLEVETPVLQHT-----SSGAIAKPFRTYHNSLDTEMNLRIAPETYLKRLI------VGGFTNVFEFAKCFRNEGVSPQHLQEFTMVEGYAAYWNY--EDTMRLMQEMVLTI-LEQVFQTTSITIQGHTIDFSQEWEIIS----FRDLILKDTGIDIDQYPSVLDLYRETMIELEHPEIETLGRGN.......... 352