current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 3a5y_A mol:protein length:345 Putative lysyl-tRNA synthetase, from PDB1018

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .
# E-value Template Links and tools%idFirst MGSSSSGLVPRGSHMSETASWQPSASIPNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLVPFETRFVGPGHSQGMNLWLMTSPEYHMKRLLVAGCGPVFQLCRSFRNEEMGRYHNPEFTMLEWYRPHYDMYRLMNEVDDLLQQVLDCPAAESLSYQQAFLRYLEIDPLSADKTQLREVAAKLDLSNVADTEEDRDTLLQLLFTFGVEPNIGKEKPTFVYHFPASQASLAQISTEDHRVAERFEVYYKGIELANGFHELTDAREQQQRFEQDNRKRAARGLPQHPIDQNLIEALKVGMPDCSGVALGVDRLVMLALGAETLAEVIAFSVDRALast
1 0.000e+00UniRef50_A0A2V5NF39 Lysine--tRNA ligase n=2 Tax=Bacteria TaxID=2 RepID=A0A2V5NF39_9BACT  ali  26  150.GLKDREQILRKRYLDTILDRV---SFDRFATIGKMVTAIRAFLNDRGFLEFQTPVIQPQYGGG-TAKPFKTHV----NALGCEMYLAISHELYLKRLIVAGYEKVYTIGRYFRNEGIDRSHHPEFSMVETMTAYENYEYNMNLIEDMFRHVAVNVFWRRVSMADAVKEKTGVDFRACTVEEANARLAELQINEPQPST---GEALAKAFE-KVEPDL--IQPTLLFGHPIEISPLAKPMREDPRFVERFEIFIAGIECGDNWSEQNDPVHLLETWRKAYRAEERDAGKFHTLDFDFIEALEYGLPPTTGIGPGIERMAMIFTGQENIDDVIFFPMMR. 490
2 0.000e+00UniRef50_F0V3G3 Lysine--tRNA ligase n=8 Tax=cellular organisms TaxID=131567 RepID=F0V3G3_MYCS3  ali  29  141.GITNPELMMRNRVGALLVNN---DLLEDLGWRSKIIFELRNYLNSLGYLEFETPIL-HKIAGGAVAKPFKT----FHNSLKEELFLRIATELHLKRLIVSGFTKVFEIGKSFRNEGIDSTHNPEFTSIEIYTTYLDMELTMDLTENIILHLNKSLTFERKAIWELLQEKLNVDFLNNPPSEEMLKLASKWNIHLEEHEKNWSSIYEKLFEDLISPELK--NPTFVYGFSSELSPLAKKDFSNERFARRFELYMDGVELANGFSEQNDPEEQLNQFKLQASRETSQGG----VDYDYISCLEYGLPPTGGVGIGLDRLIMFLLNRQSIKEIIAFPHLK. 480
3 0.000e+00UniRef50_UPI000376D691 bifunctional lysylphosphatidylglycerol synthetase/lysine--tRNA ligase LysX n=1 Tax=Dehalobacter sp. FTH1 TaxID=1035308 RepID=U  ali  28  745.....EEKALRSRTLDLIVH---PDHARVLRTRARVLAAVRELLDQRGYLEVETPVLQP-LHGGAAARPFLTR----SNAYGEDVYLRIAPELYLKRLVVAGMGKVYEIGRDFRNEGADGTHNPEFTALEAYEPGGDYRTMQTLTQDLVVRAAAAAHWPVVPVLRALSQAVGEPV-GLDTPIDRLLHLGARHGLAVPGRPEPGALIEALYGHLVEATTTT--PTFYVDFPKSTSPLVATHRDGGGLVERWDLVVDGLELATGYSELVDPIDQRERLTRQSLLAAGGDLEAMELDEDFLTALELGMPPTGGLGIGIDRLLMLLTGL-SIRSVLAFP.... 1082
4 0.000e+00UniRef50_A0Y8R9 Elongation factor P--(R)-beta-lysine ligase n=3 Tax=Gammaproteobacteria TaxID=1236 RepID=A0Y8R9_9GAMM  ali  44  4..................SDWQPTASITVLRERANVIACIRSFFSQHAVLEVETPLLARHSVTDPYME-----ILKGDNPLGKSFYLQTSPEYAMKRLLAAGSGPIFEITKAFRKGEQGSRHNPEFTLLEWYRPGFNHFQLMTEIESLVGGLLSCRPFLRMSYGEMFQQFLNINPHTISCDEL--SALARNTIDVQMQSAQKDDWLNILLTEIIEPQLGIDVPVFIYDYPASQSALAKTVINDEGVAQRFELYVHGIELANGYFELTDAGEQEKRFQGEQSMRLALGVEQIEVDIYLLAAMNEGLPSCAGVALGVDRLVMLALQIKNIADVMAFPSDRA 322
5 0.000e+00UniRef50_A0A257N4F2 Elongation factor P--(R)-beta-lysine ligase n=1 Tax=Methylococcaceae bacterium NSP1-1 TaxID=1917480 RepID=A0A257N4F2_9GAMM  ali  39  1............................MLRLRAQVFNDIRQFFSARAVLEVETPLLSYSSITDPQLDFFTTDYCLPP--LQHTLFLQTSPEFAMKRLLAAGSGSIYQICKAFRNGEAGRFHNPEFTLLEWYRVGFKLPQLMDEIAELLGVLFNGHPTQRFSYQEIFRSYTGLNPLEFSYQDYCAYAQNNHKPEAVSICYDHALWLDFIFSHNVQPQLGKNAVCMVYGYPACQSSLARINEYNSQITDRVEVFINGIELGNGYYELTDPKEQCRRFDEEIAIRQIRKRPASVKGKHLIAALEAGLPECSGIAIGLDRLLMLLANSASIDDVLNFPIQRA 314
6 0.000e+00UniRef50_E0TJ19 Lysine--tRNA ligase n=1 Tax=Zinderia insecticola (strain CARI) TaxID=871271 RepID=E0TJ19_ZINIC  ali  24  157.......KKYYKRYLDFIMN---SENMNIFIKRIMIINKIRSFFKKNNFLEVETPIL-HNIPGGAEAIPFIT----YHNKFYKKMFLRISPELYLKKLIIGGFERIYEINKSFRNEGISSTHNPEFTILEFYITYVNYKWIMKFVEKFIKNIIYKTNKNYIINYKNFKINFKKKFKKYSILQAIIKYKPKYKNYNKIKLFKYTILELQYILFEIKIIPKIIFPTFIINYPSLNSPLSLRKK-NKFFTERFELFIFNLEIANGFTELNDPEDQDIRFNKQILEKNKKNIK-YNYDYDYIKALEYGMPPTSGCGIGIDRLVMILNNISNIKDIILFPYIK. 495
7 0.000e+00UniRef50_A0A2D4S6J1 Elongation factor P--(R)-beta-lysine ligase n=2 Tax=Oceanospirillaceae TaxID=135620 RepID=A0A2D4S6J1_9GAMM  ali  43  1..................MTWQPGASIASLQQRAQFNSYLRHFFAQRFVMEVETPALSCAAVDDANLQPV------MASACDKPVYLHTSPEYPMKRLLAAGSGDIYQICKVFRDGEVGRRHNIEFTMLEYYRLGFDLKTLMDEVAQLVGDYLRIQRRIDLSYAQALKQYAQLDVFNLDDAQLR---TRVNEFVGHEISLSRDECLDIVMSHVVEPNLPADALVFIFNYPASQAALANTFEDGHHLAKRFELYVNGLELANGYHELTDIIEQQSRFDQQAKSHH----VTRPLDTHFLQALEHGLPDCSGVAIGLDRILMLKQGASSIQDVLSFDFSRA 310
8 0.000e+00UniRef50_A0A2E6PFV5 Elongation factor P--(R)-beta-lysine ligase n=14 Tax=unclassified Gammaproteobacteria TaxID=118884 RepID=A0A2E6PFV5_9GAMM  ali  43  1.................MVNWKPGTSTETLHLRAKLLVEIRQFFAERGVLEIDTPLLAPYTVTDVYIQSLETKLSNSPVAA--PYFLQTSPEFAMKRLLAAGVGSIYQVCKAFRQGETSKVHNPEFTILEWYRTDYSMIQLMDEVESLICQLLNFSPMPRLSYRQLFDQFLSINPHTVTGEELRKIAESHIELN--DDSLTDTDYLQLLMSACIEPKMP--EHCFVYDYPVPQAALAAVEKNKYGVAKRFELYCQRMELANGYYELTNLEEQLVRFESDLNARKNLQLPTYPMDEKYLAAMKNGLPECAGVALGIDRLIMIASRASTIEEVMTFTIDR. 317
9 0.000e+00UniRef50_Q2UKC4 Lysine--tRNA ligase n=7 Tax=Aspergillus TaxID=5052 RepID=Q2UKC4_ASPOR  ali  28  188............RHVQFLADQTTT---DIIKARSAIIQYLRQFFLDRSFMEVNTPI-VNSIAGGAIARPFYTSATEFP---DRQLSLRIAPELWLKRLVVGGFDRVFEIGPSFRNEGIDKTHNPEFTTCEFYHAYANLEDLLSMTESLLSGMAQHIPFRRIDFLTGIEEKIGRKLPDLTSPDAVAQVKQLFLSLEIPEAPTLPRLLDELCSIYVEPE--CVNPTFIINPPECLSPLSKSFVTGQRVAARGELFIEGKEVVNTYEEENSPSEQRRKFEDQVRYSKDAD-ESSEIDESYLEALEWGLPATGGWGCGIDRLCMLFTGAKRIADVLPFGTLRA 527
10 0.000e+00UniRef50_UPI000489A254 EF-P lysine aminoacylase GenX n=1 Tax=Marinospirillum insulare TaxID=217169 RepID=UPI000489A254  ali  43  3..........................LAILKKRAELLSATRHFFNSRGVLEVNTPVLAPAGSTDPLLDSFVTQLEGGS-TPSQLLYLQTSPEFYMKRLLAEGSGAIYQLGPCFRNGELSQRHNPEFLMLEWYRPDWKLSELEAECCALFDELLGVASYQRRTYREAFIEFVGLDPFKTSLAELRRTCVAVSGIDA--EQLDRDGCLDLLLSHKLEPALKNLGRVILYEFPASQAALAQIHQDAYGVASRFELYINGLELANAYQELTSASEQATRFEADNAQRHALGKPQVTADAKLVAALEKGLPDCSGIAVGFDRLVMLACDAASLDEVQTFSAYR. 313
11 0.000e+00UniRef50_A0A1Y5DIP3 Elongation factor P--(R)-beta-lysine ligase n=4 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A1Y5DIP3_9GAMM  ali  45  3....................WQPSADLNTLKARADFSAYIRDFFRVRDVLEVETPLLSKAAVSDANLLPLAVTC------LDKTCYLQTSPEYPMKRLLAAGSGDIFQICKVFRDEELGKRHNPEFSMLEYYRLHFDLQTLKDEVAQLVGDYLNIQRRMDLSFRQAFIKYAQLDPFLTTDDELQI----KVQPFVGGLKLNRDECLDLLISHVVEPNLPKDTLVFIAQYPASQAALAQTYENDSGLAQRFELYVNGLELANGYQELTDVAEQKQRFAKEQTQCEQVRNE----DEHFLQALQHGLPECSGVALGLDRILMLKLGLKNISEVLSFDFERA 309
12 0.000e+00UniRef50_A0A2A5G4T4 Elongation factor P--(R)-beta-lysine ligase n=2 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A2A5G4T4_9GAMM  ali  41  11...................NWPPTASKKIILERALMLKSIRAFFDARDVIEVETPLLSQAATTDPHLNSLQSRF------RDQVCYLNTSPEYGMKRLLANEPVSIYQICKAFRDDELGLFHNPEFTLLEWYRLDYDCEQLMDELQCLIESLCQHISFQRVSYRQAFENTVGFNPHQITSAECYRYAQKHDVEIPQNENDEVDDWLDWLLTQRVLPAFQKEGFTFLFDYPVSQCALAKIGQDNCPVAKRFELFFGEIELANGFHELIDPVEQLQRFKLENNARKRKGLEGVNIDHYFIAALEAGMPECSGLALGLDRVLMVLAGVENIEQVLTFSW... 333
13 0.000e+00UniRef50_A0A2G2A100 Elongation factor P--(R)-beta-lysine ligase n=9 Tax=root TaxID=1 RepID=A0A2G2A100_9COXI  ali  51  5...........................DALRTRALIYRKLRAFFDERGVLEVETPLLCAHTVTDPYIESIKADGG----------YLQTSPEYAMKRLLCAGSGPIFQICKAFRKEEAGRHHNPEFTMLEWYRPGFDHHDLMNELDELMQCVLSTLPSTKQSYRDCFLEHTSIDPLTCELPQLHTFIEKNTLVHDV-SLLDADTALQIILSEYIEPKIGLQQPFFLYDFPASQAALSQIRDDTPPVAERFELYYKGLELANGFHELTDVDEQLQRFKHNQDTRRASGLTVPDIDDAFINALKTGLPPTSGVAVGLDRIIMLACGVNSINDVL....... 298
14 0.000e+00UniRef50_A0A0T7PHC6 Lysyl-tRNA synthetase n=7 Tax=Actinobacteria TaxID=201174 RepID=A0A0T7PHC6_MYCTX  ali  29  1...................................MLRAVRETLFAKGFVEVETPILQQ-LHGGATARPFVTHI----NTYSMDLFLRIAPELYLKRLCVGGVERVFELGRAFRNEGVDFSHNPEFTLLEAYQAHADYLEWIDGCRELIQNVDISGIWPVRTVHDAISEALGERIDADTGLTTLRKLCDAAG-VPYRTQWDAGAVVLELYEHLVECR--TEQPTFYIDFPTSVSPLTRPHRSKRGVAERWDLVAWGIELGTAYSELTDPVEQRRRLQEQSLLAAGGDPEAMELDEDFLQAMEYAMPPTGGLGMGIDRVVMLITG-RSIRETLPFPLAK. 323
15 0.000e+00UniRef50_A0A2A4T753 Lysine--tRNA ligase n=5 Tax=Parcubacteria group TaxID=1794811 RepID=A0A2A4T753_9BACT  ali  23  144.GFKDTEERLRKRYLDILMN---SEVREMVEQKSRFWSAVRSFLVKRDFLEVETPIL-EVTTGGADAEPFKTH----HNALDMDIYLRISGELWQKRLMVSGIPKTFEIGRIFRNEGMSAEHLQDYTQMEFYWAYADYEDGMELVTELYRHIAKEVEWKRYDYRDTIEDKTGVDISTATFEEIEKKLQDLNIDYARDGF-NKNRAIDTLWKYC---RKQITGPGFLIGLPAELAPLAKRDTTNENITQHFQPIIAGSELGRGYSELNDPLDQRARFEEQQAMRDAGDPEAQMADLEFVEALEHGMPPTCGYGMS-ERVFAFLSNKP-VRDTQIFPLVK. 484
16 0.000e+00UniRef50_A0A131NAM0 Elongation factor P--(R)-beta-lysine ligase n=40 Tax=Legionella TaxID=445 RepID=A0A131NAM0_LEGPN  ali  50  5...................SWLPSASIQLLRARAELIGKIRQFFTERQYLEVETPVMARHGVTDVYLSNIKAIF------RDETCYLQTSPEYHMKRLLAAGSGPIFQLARVFRDDELGRWHNPEFTLLEWYQLHIDHHVLMDEVDLLLQIILKSRPMIRKTYQQAFEEACGINPFSTSIEQFNKVLAQHGLDGVLPHEQDRDQYLFLLMSHVVEPFLAEESPVAVYHFPASQAALAQV---KEGLAERFEVYYQGVELANGFHELTDVEAQKKRFMLDQQHRKQKGLTAMEADAYLLKALEYGLPPCSGVALGVDRLLALALKQPSIEKILSFDFSRS 317
17 0.000e+00UniRef50_A0A2A5A101 Uncharacterized protein n=1 Tax=Gammaproteobacteria bacterium TaxID=1913989 RepID=A0A2A5A101_9GAMM  ali  44  5....................WPPSTTLEALQMRAALMKHLRKFFDARDVMEVETPLLCRHTNLDPYLESINVHYGHQLTASKGSLFLQTSPEFAMKRLLASGCGSIYQLSKAFRFAELGRHHNPEFGILEWYQVGLDYRQLMDLVTQLFAGQGKALAVQEFSYQAVFQTVLDLDPHRCSDDQLRVCANKIQAAGGLDADMGRDELLDYLFAFQIEPTFDKDKLTFVYDYPLSQSPLAKQKXSTPELAERFEVFVAGMELGNGYSELTDWRVQQQRFVELQKQRATLGKPYLDIDARLISALKQGMPECAGVALGMDRLTMAILGVDDIEQVVAFPFSRA 354
18 0.000e+00UniRef50_A0A0E3N5K1 Lysine--tRNA ligase n=33 Tax=Bacteria TaxID=2 RepID=A0A0E3N5K1_CORUL  ali  25  731..LSNPHLRAKFRHMDFALNQKAT---DIFMARSKAVSAVRSVLQEQGYMEAETPIL-QTIHGGANARPFRTHI----RAYDQNLTLRIAPELYLKRLVVGGIPRVFEIGRNFRNEGVDATHNPEFTSLEAYQSYGNWDTMRILTEDLIRSAAIAVYWPVVPVYDAVSEAVGTHISPDADISEYADITEKYDITAA----TVGDLVNELYDELIEPNTVF--PTFYAGFPVETSPLTMADPDQPRIAQRWDLVACGMELGTAYTELADPLEQHARLSDQSLRAAGGDAEAMELDENFLKALQFGMPPTGGLGIGIDRLVMFLTGQ-NIREVLSFPFVK. 1069
19 0.000e+00UniRef50_UPI000D0B17F2 bifunctional lysylphosphatidylglycerol synthetase/lysine--tRNA ligase LysX n=1 Tax=Brachybacterium sp. Marseille-P4339 TaxID=2  ali  28  880..FEDPESRLRRRATDLIVHPQTAE---LLRARSAVVQAVRQTLLDAGAMEVETPVLA-TVHGGANARPFRTRI----NAYDTDLTLRIAPELQLKKLLVGGLGPIFEIGRNFRNEGADATHNPEFTALETYWPYSDYTGMRHLTERLVRAAARAVHWEVITVCDAVSRAVGRSVDNTDIDELLEIIRDHDL--EVREDMGPGALIEELYGELVEPATMM--PTFYLDFPAETSPLTAPHRSCPGLVERWDLVAGGMEIGTAYSELADPLIQRERLTAQSLKAAAGDAEAMEVDESFLEALENAMPPAGGLGIGMDRLAMLITRTA-IRDVLAFPFVR. 1222
20 0.000e+00UniRef50_A0A1E3Q0Z1 Uncharacterized protein n=1 Tax=Lipomyces starkeyi NRRL Y-11557 TaxID=675824 RepID=A0A1E3Q0Z1_LIPST  ali  27  55..LSSEQTRSHNRTVNLLVH---SAARDILRARTFVLTYLRTFFSARDFLEVQTPILSD-VAGGAAARPFVTHATVLGAAPDSLLELRIAPELWLKRLIISGFDRVFEIGQVFRNEGIDATHNPEFTTCEFYQAFASLDDLITLTEELLSGLVFDAPFLRVDFISTLEECMGVTFPDFDSEDAKQFLKRLFERIPIPNPETVARMLDKLCDYYIGPILGSAKPVILMNFPEVLSPLAKSAKKDYRIARRFELYVAGKELVNAYEEENSPFVQRRKFELQLRDREV-DAEAHATDEGYLASMEWGLPPTGGWGIGIDRLVMLLTGAERISDVLTF..... 415
21 0.000e+00UniRef50_UPI0006899BBE lysine--tRNA ligase n=1 Tax=Bryobacter aggregatus TaxID=360054 RepID=UPI0006899BBE  ali  25  149FGIKDREIILRKRYLDTTVN---PENRTHFEQIALMLFEIRRFLNLKGFLEFNTPIIQPQYGGG-TAKPFLTRV----NALSTDMYLAISHELYLKRLITAGFDKVFIIGRHFRNEGIDRSHHPEFVMLETMTAYENYEYNMRLIEEMFRHIDFAHDWPRIRMTDAVRDATGIDFTAITDVEVAN--AKLAEIGIHDPQPSVGNALVRAFEEKVEKTL--IQPTFIYGHPIEISPLAKPMQEDPRYVERFEIFIAGMECGDNWTEQNDPVQLLSTWKKAFKPEDRDEGEFHPLDYDFVETLEHAMPPTTGIGPGLERMAMIFTGQEDIYDVIFFPMMK. 491
22 0.000e+00UniRef50_A0A163RTE5 Lysine--tRNA ligase n=4 Tax=Oerskovia TaxID=162491 RepID=A0A163RTE5_9CELL  ali  27  778.GLADAEAKVRLKHMELALDTRTA---QVLRGRSAAVKSLRDSLAAREFIEVETPILQR-VHGGANARPFTTHI----NAYDVDLYLRIAPELFLKRLAIGGVGKVFELGRNFRNEGADATHNPEFTSLEAYQAYGDYTSMRVLTRDLIIEAAIAVHWPVHTVHGAVSRAVGQEVPDTPLETLQAICEEKGVHWT--PTMTHGAIVTELYDAFVEGQ--TVEPTFYTDFPLETSPLTRTHRRDPRLAERWDLVAFGAELGTAYSELIDPVDQRERLTQQSLLAAAGDPEAMEVDEEFLSALEFAMPPTGGLGIGVDRVYMMLIGA-SIRETLAFPFVR. 1120
23 0.000e+00UniRef50_A0A2E0PWD8 Elongation factor P--(R)-beta-lysine ligase n=1 Tax=Legionellales bacterium TaxID=2026754 RepID=A0A2E0PWD8_9GAMM  ali  39  5..................ISWRPSASLKTIKKRASLLKQIREFMNIRKIMEVDTPILSHFSTSDPYIQSMTTSCTAESDA---TLYLQTSPEFSMKRLLAAGLGSIYQIAHVFRDEESGKRHSTEFMMLEWYRIGFDYYQLMEEMGELLKSI-GLATPVKMTYAESFKRTLKIDPHTVATIHLLKLCRKQGWEEAIEDRH---ALLDFLFSEVVIKNIEQHKPLFIYDYPECMSALATLKQSKPFVSERFELFISGMEIANGFNELIDADEQVSRFEKELITRRKNNLAETPLDEKFLAALRAGLPECSGVAVGVDRLLMVLSKKNDINEVNTF..... 313
24 0.000e+00UniRef50_A0A2D8N253 Uncharacterized protein n=1 Tax=Planctomycetes bacterium TaxID=2026780 RepID=A0A2D8N253_9BACT  ali  45  27........................AAAEILELRAALLARTREFFSGRGIIEVETPLLSRGVVVDRHLDPPVCRYSPGADGAGETLYLQTSPEAAMKRLLAAGMGAIYQVAHAFREGERGRLHNPEFTIIEWYRPGLDHHELMDEVGALMSLLLPEVSWEKLSYRQLFRDRLGLDPIECGVGELGGAAEKLGIEIEGEDWNDRDAWLDLLLSTRLQDDLGTERPVFIYDYPASQAALARLCPAEPRLAERFELFIGGVELCNGYHELLXAAEQRERFEEANEQRQGDGKQPLALDERLLEALEAGLPECSGVALGFDRIVMLACGADSIDEVLALPF... 343
25 0.000e+00UniRef50_L8G2P0 Lysine--tRNA ligase n=17 Tax=Leotiomycetes TaxID=147548 RepID=L8G2P0_PSED2  ali  25  222..LDDPETRIRNRHADILVNQK---VADTLKLRSHIVQYLRNFLISDDFLEVQTPIIAED-AGGAIARPFNTVATEFST---KTLSLRIAPEIWLKRLILGGMDRVFEIGPAFRNEGLDATHNPEFTTCEFYKSFADLVELIKMTEDLFSGLASHVNFQRIEFIPDLEQRIGRKLPDLEADNAAESVASLFSELSQPLPLSPTLPRMLDKLASIYLEPSCDSPTFIIHHPACMAPLAKSFRDNQLVSARVELFVQHKELANMYEEENSPFEQRRKFVQQVQWKDEENEAV--IDESYLEALEWGLPPTGGWGCGIDRLCMLMSGATRISDVLAFGSLK. 572
26 0.000e+00UniRef50_A0A143QCK8 Lysine--tRNA ligase n=1217 Tax=root TaxID=1 RepID=A0A143QCK8_9NOCA  ali  25  160.....EESRVRQRYVDLIV---RPEAXXXXXXXXXXXXXXXXXXXXXGFLEIETPML-QTLHGGAAARPFVTH----SNALDIDLYLRIAPELFLKRAVVGGIDRVFEINRNFRNEGVDSTHSPEFAMLETYEAYGTYDDSAVMTRELIQEVVQAVYWRSIEMYPSLSEAIGVSVPDTSVDELRALADRVGLEVPEGKGWGHGKLVEELWEHSCRDQLTV--PTFVRDFPVETSPLVRAHRSTPGVVEKWDLYVRGFELATGYSELVDPVVQRDRFADQARLASAGDDEAMVLDEDFLAAMEYGMPPTTGTGMGIDRLLMALTG-HGIRETILFPLVR. 500
27 0.000e+00UniRef50_A0A143J2N4 Elongation factor P--(R)-beta-lysine ligase n=240 Tax=Moraxellaceae TaxID=468 RepID=A0A143J2N4_ACIPI  ali  46  1................MSLSYQPTCSIDALKARAKLYTQIRQFFAERGVMEVETPIVSQAGVTDVHLAS--VQALRHINGKLQTQYLQTSPEFAMKRLLASGSGPIYQICKVFRDDEHGRKHNSEFTMLEWYRPGLDLKALMHETADLLQTCLQHRFGEVLSYKHAFQDRLDINPLQATLKQLKDTANRVGLNLDLGD--DRLAYMDLLFSHFVEPSLGFDAPVFLTDFPPEMASLAKVDEDGEEVAARFEVYIEGLELANAYDELLDADVLRSRFEADNAERAKQGLHVMPLDEHLLAALPH-MPECSGIALGVDRLLMVAMDQVKIEKVVTFPAEIA 324
28 0.000e+00UniRef50_A0A1V5ZEZ2 Elongation factor P--(R)-beta-lysine ligase n=1 Tax=Candidatus Latescibacteria bacterium ADurb.Bin168 TaxID=1852850 RepID=A0A1V5Z  ali  38  21..........................RRSLLLRCEALKAMREWFWARGFVEIDPPVLAPWVGMEPHLVPLETRMSDGKRTL--RVFHQTSPEYALKKLLAAGMPDCFALGHVFRDGEVSPLHNPEFTLLEWYRHGADYTALMDDTAGLTAEVDLTPPWERITVAEAMQRWAGVDIESATSDEDFRAAAREAGN-EWVTHESWEDLFFKLFLTHVEPNLGWPKPVILCEYPVRFGALARRKPENPLVAERFEAYIAGVELCNGYSELTDPVEQRERLETEQRQRAALGAEALPVDEDFLDALAGGFPACAGNALGVDRLVMLLAGETDIARVTWFPF... 344
29 0.000e+00UniRef50_A0A2N6AC64 Lysine--tRNA ligase n=2 Tax=unclassified Parcubacteria TaxID=1046984 RepID=A0A2N6AC64_9BACT  ali  24  144.GIQDEELRLRKRYLDLLLN---PEIRDMFYKKAKFWDVTRTFMKEKGFFEVETPYL-ETTTGGAEATPFATH----HNDFDLDVFLRISGELLQKRLMAAGFEKTFEIGKVFRNEGSSPDHLQEFTNMEFYWAYANYNDGMKLTQELYQRIAEEVFWPHVEYAKEIKKQTKIDITKATEDEMKKKLEKLKVKYEGDNKERLTDTLWKYCRRNI------AGPAFLINHPKLISPLAKARPEDLETTERFQVIIAGSEVGNGYSELNDPVDQRERFELQQKLIERGDDEAMMPDFEFVEMLEHGMPPTCGFGFG-ERLFAFMMDKP-IRECVLFPLMK. 482
30 0.000e+00UniRef50_A0A2A4MNS7 Elongation factor P--(R)-beta-lysine ligase n=2 Tax=Gammaproteobacteria bacterium TaxID=1913989 RepID=A0A2A4MNS7_9GAMM  ali  47  1................MTLSWQPSASVETLKRRAQLLADVRLFFAEHEVXEVETPILSSAAPTAPYLDSFXTDFIPLGSQDKHTFYLQTSPEFAMKRLLAAGSGSIYQIAKVFRNGESGRQHSPEFTMLEWYRPELSFEQLMXEVDAILQXTVKTKPAVXFTYXQXFQQYLXIDXFXXXDXXLKQLAHXHIEGIDDXWXMERDDWLELLMSQVIEAQLKXEXPVFIYDFPASQAQLAKVXXDXXGVAKRFELYAGGMELANGYDELLDAXELRQRFXYDNQQRELQNKXKMPIDENLLAALESGLPQCTGVALGLERLMMLMLNKQNINAVKTFKFEQS 326
31 0.000e+00UniRef50_UPI0006540930 EF-P lysine aminoacylase GenX n=1 Tax=Candidatus Achromatium palustre TaxID=1662188 RepID=UPI0006540930  ali  47  6....................WQPSASLKTLKARATLLATIRTFFANRKVLEVETPTCSICANIDHTIESLQTRFIGPGYPNGVELYLHTSPEYHMKRLLAADSGSIYQICHAYRDGERGCLHQPEFSMLEWYRLDFNHHQLMDEVASLINAVAQIVPQQRFSYAELFEHYLELDPHSSDLNTLRATAIALGIFTEDMPDCEVDMWLDLLLSLYIVPRLPPNQMTFVYDYPALQASMAQVCPDNPLVAERFELYLGNMELANGFHELRDPTEQTNRFKVSERLRITRNQPSIPADHNLIEALEAGLPDCSGVAIGLDRLLMWLIGARHIDEVLAFPL... 323
32 0.000e+00UniRef50_A0A1X6X9L9 Lysine--tRNA ligase n=1 Tax=Brachybacterium nesterenkovii TaxID=47847 RepID=A0A1X6X9L9_9MICO  ali  28  765..FEDPEARLRRRATDLIVH---PRALGLLRARSVVIRAVREHVQAAGFTEVETPML-QTVHGGASARPFRTRI----NAYSTDLTLRIAPELALKRLLVGGMGPVFEIGRNFRNEGADQTHNPEFTVIEAYEPYSDYHGMRRLTESMIKAAARALYWPVVPMCEALSQALGRDVDLSTDLDTLLALAREHEVHVRDDM-GPGAILEELYAELVEAR--TIQPTFYTDFPAETSPLTGPHRSKPGLVERWDLVICGMEIGTAYSELADPLEQRRRLTEQSLKAAAGDAEAMQIDEDFLLALENGMPPAGGLGIGLDRLVMLLTDT-TIREVLAFPFVR. 1130
33 0.000e+00UniRef50_A0A250XK66 Uncharacterized protein n=3 Tax=Eukaryota TaxID=2759 RepID=A0A250XK66_9CHLO  ali  25  19.............................................................VGGATAKPFVT----YHNDLNMQLYMRIAPELYLKMLVVGGIERVYEIGRQFRNEGIDMTHNPEFTTVEFYQAYADYKDLLDLTEHLISQMDFTPPWRRISMISGLEEILEVKFPDLDSAEARQLLADQIKKHNINCPPPLTPARMLDKLVGEFLEEQCTNPTFICDHPQLMSPLAKWHRSLPGMTERFELFINKREVCNAYTELNDPVRQRELFSDQAKSKEEGDDEAMFVDENFCTALEYGLPPTGGWGMGIDRMTMLLTDTANIKEVLLFPAMK. 316
34 0.000e+00UniRef50_A0A136J2T4 Lysine--tRNA ligase n=4 Tax=Fungi TaxID=4751 RepID=A0A136J2T4_9PEZI  ali  27  225..VQNDETRVLNRHVDLLVN---KESVNVLRVRSHVVRTMRDFLHERNFLEVQTPIMADY-AGGATARPFLTTANEFS---SKDLALRIAPELWLKRLVVGGMDRVFEIGPSFRNEGLDNTHNPEFTTCEFYWAYANLAQLTTVTEHFIRSLFEDFAFPQFAFIPTLERILDIKFPDLSNDTAFDELVALRIPPAVRQERSLSRLLDHLAGTYIEP-FSMTTPIFITHHPACMSPLAKSFTSDQAISARAELFIGGREIANMYEEENSPFEQRRKFEAQVAARQHSGLDAQEVDESYVQALEYGLPPTGGWGCGVDRLVMLLAGTQRIGDTLTFGSLR. 581
35 0.000e+00UniRef50_A0A1G6GDL3 Lysine--tRNA ligase n=1 Tax=Raineyella antarctica TaxID=1577474 RepID=A0A1G6GDL3_9ACTN  ali  28  747.GFDNPDARLRNRSLDFVVH---PDEADLLRARSRAIEAVRTTMREAGYQEVETPIL-QTVHGGASARPFRTTI----NAYSTDLVLRIAPELALKRLLVGGLGPIFELGRNFRNEGADATHNPEFTSLEAYEPFADYTDMRLLTERLVRAAAMAVHWAVVPVCEAVSEAVGRPVDLDTDMEVLLELAREHEVHVRDDW-GAGALIEELYGELVEP--VTVLPTFYTDFPAETSPLSGPHRTKPGLVERWDLVLGGMELGTAYSELTDPIEQRRRFVEQSWKAAAGDPEAMEVDEDFLRALEVGMPPAGGMGIGVDRLVMALV-ARPIRDVLTFPFVR. 1094
36 0.000e+00UniRef50_A0A1Z8VYJ9 Uncharacterized protein n=1 Tax=Rhodospirillaceae bacterium TMED63 TaxID=1986643 RepID=A0A1Z8VYJ9_9PROT  ali  38  19.....................RFEDRADFLVRRADMVKSVREFFDRNGYVEVETPSLQISPGMEPHLSPFQISSLDPQGGR-RQMYLHTSPEFAMKKLLAAGMQRIFQLARVFRDGERSAKHHPEFTMLEWYRVGADWRALADETAEFVRAVCGPVXWEFLSVAEAVERSTGIDLLATTPDSMNPDTDALRFGADGDDGDTWADIFFRIFLERIEPGLGVEVPTVLHSYPASMAALARLSPDDQRVSDRFEIFICGLELANGYGELTDADEQRARFAVMTEQRIAAGREPVPVDEDFLAALEAGIPDCAGIALGFDRLVMLATGAKDIDNVLWAP.... 348
37 0.000e+00UniRef50_A0A0K1JGY0 Lysine--tRNA ligase n=12 Tax=Actinobacteria TaxID=201174 RepID=A0A0K1JGY0_9MICO  ali  27  755..LAD-DARTRQRALDLIVT---PGSLDLLRQRSRGVRAMREAFETREFTEVETPVL-QAVHGGAAARPFRTHI----NAYDMDLYLRIAPELYLKRLCVGGMQRVFELGRNFRNEGVDATHNPEFTSLEAYAAYGDYNTMRELTREVLLEVATAVNWPVVPVHAAVSEATGTTLTSASPREEVAAVCRAQG-VSVAPAATAGMLVVDLYEALVEKQTTF--PTFYTDFPLETSPLTRQHREDPALAERWDLVAFGAEIGTAYSELIDPVDQRRRLAEQSMSAAAGDLEAMQLDESFLSALEFAMPPTGGLGLGVDRAIMMLLGA-NIRATLAFPFVR. 1094
38 0.000e+00UniRef50_A1RVC4 Lysine--tRNA ligase n=11 Tax=Thermoproteaceae TaxID=2267 RepID=A1RVC4_PYRIL  ali  27  150.........MRYRSVAMVLDLQL---RWRIAARAKFIQALREAMWKRGFIEIPTPVLQP-IYGGAAARPFTTKIW----AIDEEWYLRISPELYLKRYIIAGFPKVFEVGPQFRNEDIDALHNPEFWSLEAYQAYADYNDMMKLTEEVVYEAVFSPPWRRITLHDALREYGGVDPDRLTDDQIKEKLRELQVPVKV---YNRGIALVKLFEKLVEKKL--VEPTFVLDYPEESTPLCKPHREKRGLVERFEAFVGGHEVANAYTELNDPVRQYEYFVREEELFPK--EEAHPLDWDFVEELSFGMPPTGGVGIGIDRLAMVITNAESIKDVIPYPIVK. 480
39 0.000e+00UniRef50_A0A0G1R4C6 Lysine--tRNA ligase n=23 Tax=root TaxID=1 RepID=A0A0G1R4C6_9BACT  ali  27  138YGIEDAEIKFRKRYLELLID---DDLKEVFRKKRVFWDEMREFLKENGFFEVEMPVF-EAIPGGAEAEPFVTH----HNALDRDFYLRISLELPLKKMLVAGFDSVFEIGRIFRNEGIDKEHLQDYTQMECYRSYWDYRDMMKFVEAMYKRVIWSGKWPEVDYYKIFLKKTGLDLNSASKKDLAR--KALELGAKPEVSFGRGRLIDLVYKKAIRPGL--VAPCFLVNPPVDVEPLAKRSPTDQSRVERFQVLAFGTELGKGFSELNDPRDQRARFEEQMKLRAEGDAEAHRIDDDFLEALEYGMPPAAGFGVS-ERLFSALANKP-VRETVIFPLVR. 478
40 0.000e+00UniRef50_A0A0G1YKA2 Lysine--tRNA ligase n=3 Tax=Candidatus Peregrinibacteria TaxID=1619053 RepID=A0A0G1YKA2_9BACT  ali  26  139.GIADQETAWRQRYLDLMSNR---ETYDRFLFRSLFLRRLREFYWAHDFIEVETPVLTNA-ASGALATPFVTH----HKGYDLDVFLRIAAETFQKECLVGGVDRTFEVARCFRNEGLDPSHLQDFTMVEHYAAYWDYEQNMAFTEEMLSAVDFKPPWPRASIAELIQHDCGIDIRTATADDLRKEITRKKIHLEVDASLERGNLIDQLYKKVSRPKI--VQPTFLTNHPTDLSPLARLNDDDPAITDRFQLVVGGWEIVNAYSELIDPVDQARRFEEQAKARAKGDTEAHRKDDEFVKALEYGCPPCSGLGMGIDRIVALLT................ 475
41 0.000e+00UniRef50_A0A0G1MGW6 tRNA synthetase class II (D K and N) n=2 Tax=Candidatus Magasanikbacteria TaxID=1752731 RepID=A0A0G1MGW6_9BACT  ali  38  11.......................PHLRKNLITRASVLKELRVFFSRENFLEVDTPLLVQTPGLEPYLNPLEVKFLTNRQTL-VPAHLITSPEFALKKLLAAGFERVFQLNKCWRGGEYGGTHNPEFTMIEWYRANSDYQQLMSDCEQLVHSVHQAVCWKKLSVKDAWNQYTKLNLDEMLTTERMAETVRAMGLTVAPDDE-FDDLFFKIFLTYIEPQLQKDIPLILYDYPIQLAALARAKQEDPRYAERFELYIGGIEIGNGYSELVDANIQQQRFEIDQAKRRQLGKNVYTIDTDFIDALKSGIPPSAGYSIGVDRLVMLFTDAASIDDVIYFPA... 345
42 0.000e+00UniRef50_A0A2C9JRN6 Lysine--tRNA ligase n=11 Tax=Eukaryota TaxID=2759 RepID=A0A2C9JRN6_BIOGL  ali  24  237YGVKEKETRFRQRYLDLMINEP---VRDIFITRAKIINYLRKFFDNLGFLEVETPMMS-LIPGGAVARPFITH----HNDLNQDLYMRIAPELYLKMLVVGGIDRVYEIGKQFRNEGIDLTHNPEFTTLEFYMAYADYNDLMTMAESLIYEIDFTPPFKRVSMIPALEEAMNVTFPELHTEASRKFLDDLCVKHGVRCLLPRTAARLLDKMVGDFIEDKIINPTFIIDHPEIMSPLSKSRID----------------------------------------KAAGDVEAMFVDENFCVALEYGLPPTGGLGLGIDRLTMFLTDQNNIKEVVFFPAMR. 553
43 0.000e+00UniRef50_A0A1G2Z7Y4 Lysine--tRNA ligase n=1 Tax=Planctomycetes bacterium RBG_13_63_9 TaxID=1801965 RepID=A0A1G2Z7Y4_9BACT  ali  28  166.GLKDPELRQRMRYLDMI---HTEGVLERFLRRTKIVQSIRNTLAAEGFVEVEGPTL-HAIAGGAAARPFTTH----HNALDIDLFLRIALELHLKRLLVGGIERVYELGRVYRNEGISPRHNPEFTMLEVYQAYGNYQTMMELTEKLVTQLDFTPPFPRRTYNELFAEHTGVP---ADDAAAVKTFAEQVGLDTAGKHG--DVIKNEVFEARVESALS--GPVFVVDYPESICPLTKRKADNPAIAERFELFIQGMEVANAYTELNDPDLQEELFSRQLEGLAEEDSMA-TMDRDFIRALRHGMPPAGGLGIGIDR...................... 482
44 0.000e+00UniRef50_A0A0W1KIB7 Lysine--tRNA ligase n=22 Tax=Actinobacteria TaxID=201174 RepID=A0A0W1KIB7_9ACTO  ali  26  769.GVADPEARLRNRHMYLATD---AGAWTRLYTRSAAVKAVRDFLAVRDYIEVETPILQR-VHGGANARPFATHI----NAYDLNLTMRIAPELFLKRLCVAGVERVFELGRNFRNEGADSTHNPEFTSLEAYEAYGDYLTMRDLTRELIIAAATAVHWRSITVHDAVSEACGQRVTAETSAEELRELCKKF-DIEVGLHATPGAMVTELYDELVESQ--TEEPTFYLDFPVETSPLTAPHRSVPGLAERWDLVAFGMELGTAYTELTDPIDQRDRLTRQSLLAAAGDAEAMEVDEEFLSALEFGMRPTGGLGIGIDRLTMFLVD-GTIRDTLAFPFVK. 1111
45 0.000e+00UniRef50_A0A2G6GB43 Lysine--tRNA ligase n=1 Tax=Candidatus Campbellbacteria bacterium TaxID=2026716 RepID=A0A2G6GB43_9BACT  ali  22  154.GITDIEEKYRKRYLDVLSDQN---AFDKFKKRSEVIREIRNFMDNEGFLEIETPIL-QNQASGAMAETFNTH----HNDYNLDMVLRISLEAEHKIVMAGGYPAVYEIGKNFRNEGSDSTHIQEFTMIEWYKAYRGLDYNIKLTEKLLKHLAKKVIWKKVKFNDLIKKYAKIDVQKATRKELEKKAMELGGVKKEILKMSHGNLLDFIYKKSARKKL--INPTFVLNYPGSLKPLAIQNED--GTSEVAQLVIGGAEVTNQYAELVNPLVQRKLLEDQLKAKKSGDKEAMDFNSDFLEAMEYGMPPMTGFGMGIDRLMAIFTEQDNLRDTILFPIIK. 500
46 0.000e+00UniRef50_A0A2E9QNQ1 EF-P lysine aminoacylase GenX n=1 Tax=Deltaproteobacteria bacterium TaxID=2026735 RepID=A0A2E9QNQ1_9DELT  ali  36  13.....................RPGEVGDLLRVRSAFLRDVRDFFHQRDFLEVETPLLIPAPDPSPHLNSFRTRYTA-MNAQETELFLHTSPEFAMKRMVALGYPRLFQICKFFRNGEISPHHNPEFTGLEWYLMGADYHTVMSLTEDLVRSLWPEVPWERLTVFEAMNCYAGTSLPGCSHEELSAVCTQKGLSVAEDD--TWDDLFFKIFLTYVEPELGKTRPTFLMDYPIEMAALARPKPDEPRLAERVELYIGGLELCNGYSELTDPEMQRSRWEEEWAYRRERGEEVTRE-RGLLNALAWGMGECTGVAVGLDRLLMLKLDTTCIEDVLPFPM... 337
47 0.000e+00UniRef50_I0UWN4 Lysine--tRNA ligase n=79 Tax=Actinobacteria TaxID=201174 RepID=I0UWN4_9MICC  ali  27  753..FTDPEARLRRRSTDLLVN---PEQVQNLRMRSAIITSIRRTLDTEGFTEVETPILN-TVHGGASARPFKT----FINAYGADLTLRIAPELYLKRLVVGGMGAVYELGRDFRNEGADNTHNPEFTVLEAYRPYADYTDMRHLTERIIKNTAQAVYWPVVSVCEALSAAVGTTITLDTDFETLLALAREHEIHVRDDM-GAGAVIEELYGELVEAKTVF--PTFYTDFPVETSPLAGAHRSVLGLVERWDLVINGMEMGTAYSELADALVQRERLVAQSLKAAAGDPEAMQVDEDFLYALETGLPPTGGLGIGIDRLVMLMAQTQ-IRGVLSFPFVK. 1099
48 0.000e+00UniRef50_D5UM75 Lysine--tRNA ligase n=7 Tax=Actinobacteria TaxID=201174 RepID=D5UM75_TSUPD  ali  27  775......ETRARSRSLDLMTD---DGAVDLLYRRSRAVAAMRAAFTDRGFTEVETPML-QSVHGGAAARPFTTHI----NAYDMDLYLRIAPELYLKRLAVGGMGRIFEINRNFRNEGADATHNPEFTSLEAYEAYGDYTTMRTLTREVTREVDLTAEWPVITVHEAVSRAVGTSVTPDSEVEELEALCKQW-HVAAPRGASAGKLVMELYEGLVEKQTEF--PTFYCDFPIEVSPLARRHRRDPRLTEQWDLVGFGAELGTAYTELTDPIDQRERLTQQSMAAAAGDPEAMELDESFLDALSYAMPPTGGLGIGVDRIIMLLAGV-NIRATLAFPFIK. 1116
49 0.000e+00UniRef50_A0A0L6CP25 Lysine--tRNA ligase n=13 Tax=Actinobacteria TaxID=201174 RepID=A0A0L6CP25_9MICO  ali  28  766..LSD-DARARQRALDLIVT---PGSVEALRLRSAGVRALRDAFGRREYAEVETPVL-QAVHGGAAARPFRTHI----NAYDMDLYLRIAPELYLKRLCVGGMQRVFELGRNFRNVGVDATHNPEFTSLEAYQAYADYSTMRELTREVEGEVDLDVPWPVLTVHEAVSRATGVRLTSASTAEEVAVVCRSH-SVAAAPGTSAGRLVVELYEALVEKQTTF--PTFYTDFPLETSPLTRRHRSDPALAERWDLVAFGAEIGTAYSELTDPVDQRRRLTEQSMAASAGDLEAMQLDEAFLQALEYAMPPTGGLGLGVDRVIMMLLGTG-IRSTLAFPFVR. 1105
50 0.000e+00UniRef50_E0SQD3 Lysine--tRNA ligase n=5 Tax=Thermoprotei TaxID=183924 RepID=E0SQD3_IGNAA  ali  27  140.GIVDSEKRYRLRYLDIMLN---EKVRNAIISTYKIEKAFRDFLDSRGFIEIHTPKLQP-IYGGALARPFITKMY----ALDKTLYLSIAPETYLKRAVVANLFKVYEIAVCFRNEDIDAQHYPEFVQIEIYQAFADWNDMMELVENMIAYADFKPPWRRISLEDSIEIFSGIKIKNKEYDELIEIARSLDISIDDP---RRGKIIEKIFEKVVEPKLL--QPTYITLYPRDISPLARPYREDPRYSERFEIFLMGLEIGNGYSELNNPVVQYYFFKKEERARAKEDLEYHPMDKDYVRALEYGMPPTAGVGIGIYRLVMQLLGLSSIKDVIPFTIV.. 488
51 0.000e+00UniRef50_A0A220VEQ6 Elongation factor P--(R)-beta-lysine ligase n=1 Tax=Paraphotobacterium marinum TaxID=1755811 RepID=A0A220VEQ6_9GAMM  ali  46  2......................PSASIKNLKLRAQFIQRVRSFFSNENILEVDTPILSPYGTTDINIDSFITTYFD-----KKKYYLCTSPEFHMKRLLCDGIGSIYQISKAFRNEDVSKVHNPEFTMLEWYQVGIDHFELIKVIERFLKFVMGIPKCDIISYDECFQKYLQFSPLDLTVNEIRQQCKRLELSEELEQENNKDVLLQLIFSLLIEPNLGENYPIFVHSFPATQASLAKINEFDSRISDRFELYYKGLELANGFHELSDHVEQNNRFNNDNFKRLHQNKEVVPIDVNLIESLKFGLPKCSGVAIGIDRLLMLELKENNIDKVISFSFDKC 314
52 0.000e+00UniRef50_A0A2E7MM26 EF-P lysine aminoacylase GenX n=1 Tax=Gemmatimonadetes bacterium TaxID=2026742 RepID=A0A2E7MM26_9BACT  ali  38  119...................NRVGGALRQNMLLRDAVLKAIRNFFADRGFLEVETPTLVRAPGQEVQLEVFETKA-----EVGERFYLATSPEHHMKRLLGSGFDKIFQICKSYRKEESSKIHNPEFTMLEWYRAYANYEEIIEDLENLVSHLGQKPPWRRLTLHQAFNLYADLDLDACKSRDEFYQRASSLGFGSVNREDSWEEIFFKVLLEKVEPALG-VGPVFLKDYPSRLAALAKLKENNTAVAERVEAYVAGLELANGFTELNDPREQRLRFMEERRQRRELGLPIHPLDEEFLSMLQQGMPPAGGIAVGLDRLLMLFADAASIDEVIAFPL... 446
53 0.000e+00UniRef50_A0A291GTD4 Lysine--tRNA ligase n=19 Tax=Actinobacteria TaxID=201174 RepID=A0A291GTD4_9MICO  ali  26  802.GLSDPEARVRERAVDLVV---RPDARTTAYQRATVVRSVRDTLHELGFTEVETPVL-QAVHGGASARPFETHI----NAYDMDLFLRIATELHLKRLVVGGMEQVFEIGRQFRNEGADASHNPEFTSLEVYEAYSDQHGMRRLTQRIIQDAARAVHWPVVPLATAVSRALGEEVEVGTPATDL-HAHARRIGLELDPRLGGGAVLEELYGALCEG--STTTPVFYTGFPRENAPLARPDRDDPRLAEKWDLVIQGSEQGTAYSELNDPVDQRRRLVAQSLLAAAGDPEAMAVDEDFLRVLELGMPPTGGMGMGIDRLVMNLTGL-SIRDTILFPLTK. 1148
54 0.000e+00UniRef50_A0A1H1VB52 Lysine--tRNA ligase n=2 Tax=Actinopolymorpha TaxID=117156 RepID=A0A1H1VB52_9ACTN  ali  29  785.GRTDPEARVRERAVDLAT---RPGSRVLFAHRRAVVAAVRDTLRTGGYEEVETPMLQP-VHGGANARPFSTHI----NAYDLPLYLRIAPELYLKRLLVGGLEQIFELNRNFRNEGADATHNPEFTMLEAYQAYGDYHSMRVLACDLVRSACRAVHWPVVSVHAAVSAALGEEVPGTDAETLRRYAARADVH--VDAAAGAGAAVLAVYEALVEPN--TVGPTFYTDFPTEVSPLTRPHRDDPRLAERWDLVVFGVELGTAYSELADPVEQRRRLTAQSLLAAGGDPEAMQLDEDFLRTLEYGMPPAGGLGLGIDRLVMTLTG-RSIRETLLFPLVR. 1134
55 0.000e+00UniRef50_A0D6A7 Uncharacterized protein (Fragment) n=23 Tax=cellular organisms TaxID=131567 RepID=A0D6A7_PARTE  ali  24  2..............................................KGFIEVETPSLN-VIQGGATAKPFKT----FHNSLHRDLFMRVAPELYLKMLIVGGLDRVYEIGKNFRNEGIDQTHNPEFTAMEFYWAYCDYNDLMTVTEEVFLELDFTPPWPRVSMMAELEKKLGEKLPELESEEANAFFNAQAKKHKVECSNPRTTARLIDKLVGHFLEVNFKNPTFLIDHPQLMSPLSKVHRQYPGLTERFELFVNYHELCNAYTELNDPFVQKALFQKQVEDAAKGDDEAMGYDEGFIKSLEHALPPTAGWGLGIDRFVMLLTDTQNIQEVLLFPAMK. 331
56 0.000e+00UniRef50_A0A0S8HWE3 Uncharacterized protein n=2 Tax=unclassified Deltaproteobacteria (miscellaneous) TaxID=122706 RepID=A0A0S8HWE3_9DELT  ali  39  3.......................PRHRKNLILRGKIIQAIRRFFVEEGFVEIETPYLVPSPGMEPHLVALETNVQTPDGE-KRKTYLHTSPEYCMKKLLARGWDKIFQVCRVFRDEEVSRIHQVEFTMLEWYRVHADYRKIMEDCEALLVFLSREILKGSELIYQGRKIDLAPPAERLSVARLLEEAKAGGIRFDPEAYYSFEEIFFKVFLEAVEPRLGSPKPTILYDYPASMGALARLKPENPSWAERFELYVAGLELANAFSELTDPAEQRKRFESEQRLRAVLQKPLYPIDEELLAAL-SRMPPAAGIALGVDRLVMLFCDAPAIQDVLAFPL... 331
57 0.000e+00UniRef50_UPI000DC2DE5A lysine--tRNA ligase n=1 Tax=Mycoplasma wenyonii TaxID=65123 RepID=UPI000DC2DE5A  ali  27  149.GIQSPELAVRNRVGNLLLN---EELFHNLSLRSQIISELRRYLGELGYLEFETPIL-HKIPGGASARPFKTH----HNTLKEDLYLRIAPELYLKRLIVSGWTKVYEIGKSFRNEGIDNFHNPEFSSIEIYSTYFGLEETIDLTEKLIINLFEKQKFERKPMWELVKEKTGLDFYNNSLPIAVKKAVELGLELTEEEKQSLARVYEKFFEELISGEL--ERPTFVYGFSSECSPLAKEDSANNFFAQRFELYIGGKEIANGFSEQNDPFRQEEQFKKQIS---SETEFELKLDQDYLSALEYGLPPTGGVGIGLDRLIMFLLDSKSIKEVISFPYLK. 484
58 0.000e+00UniRef50_A0A1F5EJP5 Lysine--tRNA ligase n=5 Tax=Parcubacteria group TaxID=1794811 RepID=A0A1F5EJP5_9BACT  ali  23  140.GLQDIEQKYRKRYLDVLMD---KDAQNRFIIRAKVISEIRKILDGEGFLEVETPIL-QNQASGAIAETFKTH----HNDYDIDMVLRISLEAELKMIMVGGYTAVYEIGKNFRNEGSDPSHIQEFTMIEWYRAYKDLEYNIKLTEEMIKNIAKNVKWERVRFNDLVEKNTGWNPQGASREEIEKNALKLGFDGKEISKISDGNLIDFVFKKSSRGKI--INPTFVTHYPGSLKPLAIQNED--GTAEVAQLVINGAEVTNQYAELVDPIVQRDLLEKQMKMKEQGDAEAMEFNSEFIDAMEHGMPPMTGFGMGIDRLVAILTEQSNLRDTVFFPIMR. 486
59 0.000e+00UniRef50_A0A2E7NAN4 Lysine--tRNA ligase n=14 Tax=Parcubacteria group TaxID=1794811 RepID=A0A2E7NAN4_9BACT  ali  21  140.GLQNHEARFRQRYLDILLN---PELRELFKLKAKFWDTTRSFMNEKDFVEVETPTL-EITTGGAEARPFQTH----HNDFDIDVYLRISGELWQKRLMAAGFEKTFEIGKAYRNEGSSADHTQEFSNMEFYWAYADYKDGMGLTKELYQRIAQDVFWPVIDYVDEIEDKTGIDVLEANEGDIQAKLEGLGVKYDGN---TKERMMDSLWKH---IRKDVSGPAFLINHPKLVSPLAKDNLDKPGTVERFQIIIAGSEIGNGYSELNNPIEQKKRFDEQKELIAKGDEEAMMPDDEFVEMLEHGMPPTCGFGFG-ERLFAFMVDKP-IREVQMFPLMK. 478
60 0.000e+00UniRef50_A0A218XR45 Uncharacterized protein n=7 Tax=Pentapetalae TaxID=1437201 RepID=A0A218XR45_PUNGR  ali  24  186...................................................VETPMMN-VIAGGAAARPFVTH----HNELNMRLFMRIAPELYLKELVVGGLDRVYEIGKTFRNEGIDLTHNPEFTTCEFYMAFADYDDLMSLTEEMPIEINFTPPFRRIDMVEELEKIAGLNIRDFSSDEANKYLVETCAKFDVKCPPPQTTARLLDKLVGHFLEETCVNPTFIINHPEIMSPLAKWHRLKPSLTERFELVVNKHEVCDAYTELNDPVVQRQRFADQLKDRQSGDDEAMALDETFCTALEYGLPPTGGWGMGVDRLTMLLTDSQNIKEVLLFPAMK. 494
61 0.000e+00UniRef50_UPI00049131C6 bifunctional lysylphosphatidylglycerol synthetase/lysine--tRNA ligase LysX n=1 Tax=Pseudonocardia acaciae TaxID=551276 RepID=U  ali  29  742....DSDARRRRRHLDLIVN---ADARRMLRLRCAAVAALRDELRGRGFAEVETPILQP-VHGGAAARPFRT----WMNALGADMYLRIAPELYLKRLLVGGSGPIFELNRTFRNEGLSARHNPEFTMLEAYQPYADYHTAADLLRDLVVRLDLAEPWRHTTVYGAVSDQLGQEITPATPRDRVAGLAEAHG-VDPDPGWGQGRLVQELFERLVEEHL--VAPTFVHDYPAETSPLARRHRDDPLLSEKWDLIAFGMELGTGYTELNDPVDQRDRLTEQSLLAAGGDPEAMALDEDFLAAMEYGMPPACGLGMGVDRLIMVLTG-RTIGDTILFGPARA 1081
62 0.000e+00UniRef50_A0A2H6GR26 Lysine--tRNA ligase n=1 Tax=bacterium BMS3Abin15 TaxID=2005723 RepID=A0A2H6GR26_9BACT  ali  22  163YGFEDIEKRYRQRYLDTVINHN---VFQIFLVRSRLVQGIREWLSKHNFVEINTRVLQP-QEGGAMAKPFKTH----HNALNHDFVLRISPELDLKMAIIGGFERVFEFAISFRNEGIDPSHLQEFQMLEWYCAYENFEHGMQWTEKILKYSVPNCKYHRIKFSKLLSEY-GIDMF-APKDKLVALAMQNGIKKEEAEKRSQGNLIDDIYKKLILPNI--IQPTFITHYPSDLLPLARPNDSQPELADSYQLVIASREIAKGYSELTDPIIQRKALEEQARAREMGDDEAMAVNEEYLAAMEHGMPPITGCGIGIDRLVALINGQKNMRDCVFFPLLK. 510
63 0.000e+00UniRef50_X4R9Z0 Lysine--tRNA ligase n=8 Tax=Trueperella pyogenes TaxID=1661 RepID=X4R9Z0_9ACTO  ali  27  746.GVADPEARLRSRHMYVATD---SDAWRRLYVRSAAVKAVRDYLAERDYIEVETPILQR-VHGGANARPFATHI----NAYDLDLTMRIAPELFLKRLCVAGVERVFELGRNFRNEGADSTHNPEFTSLEAYEAYGDYLSMRELTRELIIAAATAVHWRSITVHDAVSAACGQPITETSTEELRELCKKFGI--EVSAHATHGAMVTELYDELVESQ--TVEPTFYMDFPIETSPLTAPHRTNPALAERWDLVAFGMELGTAYTELTDPIDQRDRLTRQSLLAAAGDAEAMEVDEEFLSALEFGMRPTGGLGIGVDRLTMFLIN-GTIRDTLAFPFVK. 1088
64 0.000e+00UniRef50_A0A164YMV5 Uncharacterized protein n=1 Tax=Daucus carota subsp. sativus TaxID=79200 RepID=A0A164YMV5_DAUCA  ali  24  177YVLKDQEIRYRHRCLDLMLNI---EVRHIFKTRTKVISYVRRFLDNLNCQEVETPMMSM-IAGGAVARPFET----YHNDLDEILFMRIAPELSLKQLVVGGFERVYEIGKQFRNEGIDLTHNPEFTTCECYIAYEDYNDFMEMTENMLS-------GKRIEMIEDLEKMAGINIPDLSSDEANKYLAEACAKFEIKCPPPLTTARLLDKL------------------------------------------------CNAYTELNDPEVQRQLFADQLKARKSGDDEAMDLDETFCTALEYGLPPTAGWGMGTDRLVMLLTDSQNIKEVILFPAMK. 452
65 0.000e+00UniRef50_A0A2T9ZG49 Lysine--tRNA ligase n=2 Tax=Smittium TaxID=4888 RepID=A0A2T9ZG49_9FUNG  ali  25  222.GLEVHETRYRNRHVDFLTN---PEARRSIVARAQVLSVIRNFFDSRGFLEVETPILWPSL-GGANAKPFTTKAVALGDA---KMFLRIAPELFLKRLVIGGFDRVYEIGKVFRNEGIDRNHNPEFTSCEFYQAYTNVEEMMDNTELLIREIDFSLPFKRINVVEFLSEKLDCSFDFLAFDELLKIFEKHNISHSNIP-KTPTKLFDNLISIYIEPLTSM--PTFLTDHPFVMSPLAKSKNSLS--AARFELFINKQEIVNAYEELNNPDEQRFRFYGQLSDIKKGDPEAVLPDLDYCNALEFALPPTAGWGMGIDRLVSLLTNLPHLKESISFPIVK. 606
66 0.000e+00UniRef50_A0A1Y5EGH3 Elongation factor P--(R)-beta-lysine ligase n=2 Tax=Piscirickettsiaceae TaxID=135616 RepID=A0A1Y5EGH3_9GAMM  ali  40  7..................TSWPPTCSAALLHRRAELYQTIRDFFAQRAVLEVDTPILSNAASCDLNLDSFSTQLTN--DALNQRLYLQTSPEFSMKRLIASGSGCIYQIAKSFRQAESGRFHNPEFTLLEWYRMGFSLADLMQEMLELLSCFNQNLASITLTYASLFKQQTGINPHETSLTQLLAYAAEQGNPEAAQICDSLANGLDYVFSQYIQPRLKPELLYFVTDYPACMAMLAKLSEDQPITAKRFEVYFNNLELANGYEELSDAQLQQQRFQEELAEREKQGANKVPMDKNLVAALQHGLPDCAGVALGLDRLLMVISGVYSIDEVLSFPIERA 328
67 0.000e+00UniRef50_UPI000B76E1D0 lysine--tRNA ligase-like n=1 Tax=Chenopodium quinoa TaxID=63459 RepID=UPI000B76E1D0  ali  19  217YLLDDEETRYSMRFLDLMLN---DEAREVFKTRSKVITYMRTFLDNLNFLEVETPIMNMIPGGAASARSFVTH----HNELNMKLCMRTAPDVYLKQLVVGGLDRVYEIGKQFSNEAIDQRRNPEFTTCKFYMAYSDYNDLMWLTEKMFIEIDFTPPFRRINVIDELEKFTQLSIPQDLSEEANKFLMDVCSKYDVKCLPPLTSARLLHKLVGHFLEETCLNPTFIMDYPEMIHPLAKCHRSKPGLTEYFKLFVNKNVLCNGCTEANDPMVQHRRFTDQLKDPQSDGG-AVVLDET-CTALEYGLPPSASWELGIDYLAMLVTDSRSIQEVLFFPAMK. 570
68 0.000e+00UniRef50_A0A2G6F8L3 Lysine--tRNA ligase n=1 Tax=bacterium DOLZORAL124_38_8 TaxID=2044884 RepID=A0A2G6F8L3_9BACT  ali  24  155.GVSDTEMCYRERNLDLVSN---KETFERFKLRSKLIQEVRHFFEEKDFYEVETAILQP-QAGGAMAKVFETH----HNALDHNFVLRISLELDLKRAIGGGFERIFEIGKNFRNEGSDPSHLQEFTMCEWYAAYQDLETNKQWTEELFHRFCQKVFRKEIFFPDLLKEYANIDMFAASDE--VVVAKAKEVGVEKIEGVGRANLLDDIYKKTARGKL--IQPTFVFDYPEDLKPLARPNGD--GTASCFQLVVNGWEIVNSYGELIDPQVQRKLLEAQAAAREAGDDEAMPIDEVFLKAMEHGFPPMTGSGFGIDRLMAIFTGQPNLRDVVLFPTMR. 499
69 0.000e+00UniRef50_H6C247 Lysyl-tRNA synthetase, class II n=7 Tax=Herpotrichiellaceae TaxID=43219 RepID=H6C247_EXODN  ali  26  50......ETNYQPRHVEMLTD---PEVVETLKARSALVRAMRQFFEARSFVEVDTPILS-ALAGGATAKPFETTATEFP---DRKLSLRIAPELWLKRLIVGGMERIFEIGPSFRNEGLDKTHNPEFTTCEFYAVRHDLPQLMELTKQLLSNIAQQQPYQEIDFILTLNEILGLDLPNLSAREAQSQLIEIFKNIPLPSNPTVPRLMDKLCSVYIEPRSDNNRPIWIVNIPECLSPLAKTAPNEQPVAARAELFIRGREVVNCYEEENSPFEQRRKFQDQQRYARQFDEEAMKVDEDYLEALEWGLPPTGGWGCGIDRLVMLFTGNERIGDVLSFGNLRA 440
70 0.000e+00UniRef50_A0A0G0ZZE4 Lysine--tRNA ligase n=6 Tax=Parcubacteria group TaxID=1794811 RepID=A0A0G0ZZE4_9BACT  ali  25  144YGLKDAETRYRHRYLDFLLN---PELKEVFNRKMLFWNSMRNFLIERGFVEVYTPIL-ENTTGGADARPFVTH----HNALGVDVYLRISGELWQKRLMVAGYPKTFEIGRQFRNEGIDADHLQDYLQMEYYWAYADYIQGMQLTTDLIQEVDLGQDWQKIDFYAEIKRQTGLDLRTAATAEIQAKLRELNLDFEDTAEPSR--LWDQLWKYC---RRQIVGPAYLINIPVLISPLAKRSESDPDVTQRFQLILAGSELCNGYSELNDSLDQRERFLEQAKLRAAGDEEAQMNDEEFIEALEYGMPPVCGLGIS-ERLFSYLEG-KSIRECVMFPLLR. 484
71 0.000e+00UniRef50_A0A0G0KVA6 Lysine--tRNA ligase n=25 Tax=root TaxID=1 RepID=A0A0G0KVA6_9BACT  ali  24  140FGIKDEEELLRRRYLDLMIN---EDTRELFRKKNTFWQTTRNFLTNEGFLEVQSPVLEHTP-GGADAEPFITH----HNALDQDFFMRISLELPLKRLLVGGYEKVFEIGRVFRNEGVDRTHLQEFDHMEFYWAYSDLQKGMEMTERMYKEIAWNIDFPHVDYFEAFQKETGIDL-SADVTXXXXXXXXXXXXXXXXXXXXXGKMIDTIYKKTVRQKL--IQPCMLVGHPIEVSPLAKKDPSNPNKVLRFQVVAGTAELCNAFAELNDPIDQRERFEAQMKLREAGDAEAQMIDEDFLEALEYGMPNAFGLGFS-ERLFSFFMN-KSVRECVIFPPMK. 481
72 0.000e+00UniRef50_A0A081K5F9 Elongation factor P--(R)-beta-lysine ligase n=8 Tax=Bacteria TaxID=2 RepID=A0A081K5F9_9GAMM  ali  43  4.............................LRERALLLRKVRAYLDVQGIMEVETPMLSRSATVDVYIDSFATEFSPIGHGTSQLCYLHTSPEFAMKRLLSAGSGDIYSLGRVFRNGEAGGRHNPEFTMLEWYRIGMDDRRLMDDIAGLLSSVCNFKEVRRCSYGELFKEYLGLNPYTANDEELSQVVSDR--VDAKLQGLERSDCLDLLFSKFVEPNLGSPNAVFVYDYPATMSALAKLNRDGHQVASRFELFVNGVELANGYHELLDAEEQKKRFEEEQQMRQERGYDIYPYDKNMVNALAHGMPDCAGVAMGIDRLLMLMLGTGNIADVLAFDFGRA 318
73 0.000e+00UniRef50_UPI0009ED65D9 bifunctional lysylphosphatidylglycerol synthetase/lysine--tRNA ligase LysX n=1 Tax=Plantibacter sp. H53 TaxID=1827323 RepID=UP  ali  28 1089.GLNDPETRIRQRHLDLAVN---AEAAAMVRARSHAIQALRSGLLEDGYLEVETPIL-QTVHGGANARPFRTRI----NAYRTDLTLRIAPELALKRLIVAGFPQVFEIGRNFRNEGADATHNPEFTAVEAYRAYADYTVMRHLAQRLITRMDLTQDWPVITVSDAVSAAVGTTVTIDTDRATLERITREHGIEPRSADDT-GHLLERLYEELVEP--ATTVPTFYIDFPASTSPLTRGHRRTPGLAERWDLVAFGMELGTAYTELADPFEQRARLTAQSLLAAGGDPEAMEVDESFLTALELGMPPTGGLGLGVDRIVMLLTGA-TIRESIAFPFVR. 1431
74 0.000e+00UniRef50_S3X8E6 Lysine-tRNA ligase n=1 Tax=Propionibacterium sp. oral taxon 192 str. F0372 TaxID=1203605 RepID=S3X8E6_9ACTN  ali  25  736.GFNDPRARARSRSLDLLVH---PEQMDLLAARSRAITSVRRTLVDAGFCEVETPMLN-TVHGGANARPFRTHI----NAYDTDLVLRIAPELALKRLVVAGMGAIFEIGKNFRNEGADASHNPEFTVVEAYQPYADYTTMRLLTQRIIQEAATAVHWAVVSVCDAVSEAVGTRIDPTTDLDELIGIAQEHGIHIGPDW-GAGKLIEELYGELAEAT--TVAPTFYVDFPAETSPLTAPHRTQPGLVERWDLVAGGMELGTAYSELTDPIIQRQRLVEQSWHAAMGDAEAMEVDEDFLTALELGMPPTGGLGIGLDRLVMALTGS-SIRQVLTFPFIR. 1083
75 0.000e+00UniRef50_A0A1N4YMI3 Lysine--tRNA ligase n=23 Tax=Actinobacteria TaxID=201174 RepID=A0A1N4YMI3_9MYCO  ali  27  770..FKDPEARLRRRSTDLIVNPQQ---REFLKMRTSIITSIRATLDGEAFTEVETPILN-SIHGGASARPFKT----FINAYGAELYLRIAPELYLKRLVVGDMGAVYELGRDFRNEGADATHNPEFTVLEAYKPFSDYNGMREITESLIKNAARSVFWPVKTVCGALSEAVGREISLDTDFEVLLKLARENEIYVRDDM-GAGAIIEELYGELVEANTIF--PTFYKDFPVETSPLAGPHRSEEGLAERWDLVINGMELGTAYSEMADALEQRRRLTEQSLKAAAGDPEAMEIDEDFLYALETGLPPTGGLGIGVDRLVMLMTGTQ-IRGVLSFPFVK. 1116
76 0.000e+00UniRef50_A0A2E5HMW0 EF-P lysine aminoacylase GenX n=1 Tax=Myxococcales bacterium TaxID=2026763 RepID=A0A2E5HMW0_9DELT  ali  41  91.......................PAQRRHVRARARMNAQLRAWFSDQDFIEVETPNLVTSPGTDVYLEAFSTRFSGMGQVRPRELYLHTSPEFAMKELLTEGHERIVQLCKVYRDGEWTRTHNPEFTMAEWYRAFADYKAVMADVEAVVRLVLMDAPFEVLTVQEAFMRCCGLDVLEANTAEALRGEAEARGLGPLAAGGGWDDLFHELLVTWVEPQLGAPTPTFLVDYPAPLAVLSRRRDDDPRVAERFELYIAGVELCNGFTELNDPVEQRARFAEERARRAEMGLPAYPMPERFLAALERGMPPSGGVALGLDRLLMLALGAESLSDVL....... 413
77 0.000e+00UniRef50_K6X0V0 Lysine--tRNA ligase n=4 Tax=Actinobacteria TaxID=201174 RepID=K6X0V0_9MICO  ali  30  774..FTDSDARLRRRSTDLIVHPQGA---KLLRLRSAVVTSLRRTLDDSGFLEVETPIL-HSVHGGASARPFTT----FINAYGVDLFMRIAPELYLKRLVVAGLGPVYEIGRNFRNEGADATHNPEFTALEAYAPFGDYTTMRLLTQQLVQDAATSVHWPVVTVLDAVSAVVGRTVRLDDDFEELLTLAREHG-VETEPHMGPGAVIEELYGELVEP--ATIYPTFYVDFPVETSPLAGGHRSDPTLAERWDLVLGGMELGTAYSELNDPLEQRRRLTEQSLKAAAGDVEAMQVDEDFLRALEVGMPPCGGLGIGVDRLVMALTGT-TIRQVLTFPFVR. 1136
78 0.000e+00UniRef50_A0A0G0BKH8 Lysine--tRNA ligase n=3 Tax=Bacteria candidate phyla TaxID=1783234 RepID=A0A0G0BKH8_9BACT  ali  24  137.GICDEEILYRQRYLDLVCN---DETLERFKLRSNLIKAIRQFYWKENFYEVETPTFLQN-ATGAAATPYKTH----NNAWDLDLVLRISHELPLKMAIVGGFEKIFELGKAFRNEGIDPSHLPEHTHLEHYCAYWNFEDNMIFTEKMFDEVDFTTPWPRVDFVELLKKESGIDIMKFDSEELKKELNVKGIKIEAVDKMLYPTIVDHLYKKVCRPKIT--GPIFLYNYPKSLQPLARVSDKNLNMVDQFQLIVNGWEIVKAYSELVDPIDQAERFKEQKKAEAFGDTEAMQGDDEYIISMEHGMPPISGFGMGIDRLVTLLTEQENLRDVVLFPMMRS 487
79 0.000e+00UniRef50_A0A2A4YU25 EF-P lysine aminoacylase GenX n=2 Tax=unclassified Alphaproteobacteria TaxID=82117 RepID=A0A2A4YU25_9PROT  ali  36  1.................MSWWLPAEKRPYLEGRARVIKALRWFFNDRDFTEVDTPVLQVCPVMDTHIHAFRTDLKNLDLSHRKTMYLQTSPEFDMKKLLVAGMSNIYQICPVFRNAEGSVLHSPEFTILEWYRAGADYRTLMDDSVDILRNVDPYKELQRISVCDAFIKFTKIDLALYLDDISGFSDAIAALDIRVRAEDSWDDLFHAVMGEKIEPYLGVGVPTILYDYPISMAALSRKNPEDPRFAERFELYVCGVELANAYSELTDVTEQRARYKAEMALKQTLYGETYPPDEEFFDALEYGLPESAGIALGIDRLVMLSLGADNINDVLWAPI... 338
80 0.000e+00UniRef50_A0A0G0HT81 Lysine-tRNA ligase (Fragment) n=1 Tax=Candidatus Woesebacteria bacterium GW2011_GWA1_37_8 TaxID=1618546 RepID=A0A0G0HT81_9BACT :_  ali  29  2..................................KLTREIRKYLDGLGYMEVETPVLQP-LYGGANAKPFTTHL----NALDVDMYLRIADELYLKRLIVGGYEKVYEISKDFRNEGMDLTHNPEFTMIEWYEAYADYHRMMDVTEGMFKHLAKELYWPRVEMTTAIKKYLDIDVLNTSEDELVKFAKGKKISFVGGE--TKGQLIYIIFEHLVTDHL--VNPTWIIDYPKDVSPLSKDHSEKEGWVERFEGYIGGKEICDGWSELTDPQEQXXXXXXXXXXXXXXXXXXXXXDEDFLEAMEYGMPPLGGIGIGIDRLTMFFTNTWMIKEVILFPTLK. 313
81 0.000e+00UniRef50_A0A0G1HZ34 Lysine--tRNA ligase n=60 Tax=root TaxID=1 RepID=A0A0G1HZ34_9BACT  ali  24  149.GIENPDEAFRKRYLDLLMD---PEKMRRFERKAKFWEVTRSFLKNKGFIEVETPVL-ESVTGGADAKPFVTH----MNAIDQDFFLRISTELYQKRLIGAGYEKIYTIGPNFRNEGMDDEHLPEYYQCEWYWAYADYRDNMELVKELYRYIAKEVYWTEIDYVEIIKGKLGIDIFKSTDEEMLAAVKKAGVVLTGAINRSR-----LIDNCWKIIRKSIAGPAYLINEPKFMSPLAKSKPENPELTERFHVIIAGSELGNGYTELNDPEDQRQRFEEQQAQREAGDEEAQMLDTDFVEMLEYGMPPTSGWGHS-ERLF-WFLEDVSGREGVLFPPLR. 487
82 0.000e+00UniRef50_A0A2G2MB12 Elongation factor P--(R)-beta-lysine ligase n=2 Tax=Methylophaga TaxID=40222 RepID=A0A2G2MB12_9GAMM  ali  44  1................MTISWQPSAEIKTLKRRAQYLADVRLFFAERDIWEVETPILSLAAPTAPYLDSFTTDYIPIGTHSKQTHYLQTSPEFSMKRLLASESGSIYQIARVFRNGERGTLHSAEFTMLEWYKLGLTSSQLMDEVEALLQQVFNYTVFPRLSYQNVFNDLLGLDVFSCSDEEIKHCGQKNIRSLPNDFDTDRDGWLELLMSYIIEPELKRHKGIFIYDFPSSQAQLAKIKHDQQGVADRFELYIDGVELANGYNELLDADELRRRFEQDNQQRKQQNKAAIPLDEELLAAMQQGLPECSGVAVGLDRLLMLAMNKQSIAQVQSF..... 321
83 0.000e+00UniRef50_A0A2M6WPB5 Lysine--tRNA ligase n=50 Tax=cellular organisms TaxID=131567 RepID=A0A2M6WPB5_9BACT  ali  24  145.GLQDEEERLRKRYLDILFN---PTVRDMIAKRAIFWSSVRQFMTARGFLEVETPIL-ENITGGADARPFLTH----HNALDLDVYLRISGELWQKRLMVAGLEKTFEIGRQFRNEGMDAEHLQDYTQMEFYWAYADYEDGMKLVEELFQEIAQKTFWARYNYRNTIKKYTGXXXXXXXXXXXXXXXXXXXXXYDKEGF-SITRAFDNLWKYC---RKQIVGPGFLVGLPIEISPLAKGDAKNPLMTQRFQLIIAGSELGNGYSELNDPLDQAARFREQQKLRDAGDEEAQMYDQEFVEALEYGMPPVCGFGMS-ERVFSFLMNKP-ARECQIFPLMK. 485
84 0.000e+00UniRef50_A0A2H9TN48 Lysine--tRNA ligase n=1 Tax=Paramicrosporidium saccamoebae TaxID=1246581 RepID=A0A2H9TN48_9FUNG  ali  30  207....NPEHRSRTRHLDLLS---RPANLRHFKTRSAIIKHLRQFLSDRDFVEVETPILS-SKAGGAAARPFVTR----MDALGLPVYLRIAPELFLKQLIIGGFDRVFEIGKVFRNEGIDATHNPEFTSLEMYQSFASCSDMMKLSEELLPHIDFRGPYKRISVVPFLEEKLETCFDLSNEQDTRRKAVKLLGIRYDPSNQTLSYLFDKLIGHLIEP--LCIQPTFIVMHPLIQSPLSREHSENHLLSARFELFVAGKELMNGYSELNNPQQQAERFVSQLEERQNGNSEAHPSDAEYVEAMKAGMPPTAGCGIGVDRLVMLLTN............... 536
85 0.000e+00UniRef50_A0A2R6EDE4 Uncharacterized protein n=1 Tax=Halobacteriales archaeon QH_3_68_24 TaxID=1919153 RepID=A0A2R6EDE4_9EURY  ali  32  1...................................MTRQLRRFLDDRGFLEAETPVL-QNVAGGTDATPFETHLE----AKDQEMYLRIATELHLKRLLVGGFEKVYEVGPVFRNEDIDVTHNPEFTMLELYQAYADYTDMMDLTEDLVAHIDFSPPWPRLTPEEAIEEYSDESIDVTECNDEELRELALAHGGEFPGGYSRGLGIVELFENAAEYEI--VDPTFVVDHPKETTPLCKDHREKEGRIERFELFAAGFELANAYTELNDPVEQGELFAEQVARREAGDEEAHQMDEDFLDALAHGMPPAGGLGVGIDRLAMLATNSQTIKDVIAFPI... 332
86 0.000e+00UniRef50_A0A1J4WDH8 EF-P lysine aminoacylase GenX n=2 Tax=Candidatus Pacebacteria TaxID=1752724 RepID=A0A1J4WDH8_9BACT  ali  39  17..........................LDKFLVREKVINAIRLFFKNQGFHEVETPVLVQSPGTEPYLEVFETELVTQSYEKHKKAYLLTSPELFMKKLLSAGLGNIFQICKSFRNGEISSFHNPEFTILEWYRVEADYLDVMKDCENLFVEYDLTAPWERISVSEAFKKYSGISTEEMLDSQKLVQIAKEKGY-EVDNQTTWEQAYNQILLNEIEPHLGQEKPTILYDYPASQAALSKKKDSDPRFAERFEFYIGGIELGNAFSELTDAGEQQARMVEDLKLRKDFGKVEYKMDKDFIEALEFGMPRTGGIAVGVDRLVMLFADQDSIKNTLFFPID.. 367
87 0.000e+00UniRef50_A0A0G1BZU0 Lysine--tRNA ligase (Fragment) n=1 Tax=Parcubacteria group bacterium GW2011_GWD1_42_9 TaxID=1618938 RepID=A0A0G1BZU0_9BACT  ali  26  152.GLKDIEARLRHRYVDLLMD---EEVRQMFVKKSNFWRTVRGHLSSAGFLEVDTPAL-ETVAGGADANPFVTH----HQALGKDFYLRISLELPLKRLLVGGFEKVFEIGKVFRNEGIDTEHLQDYEMCEFYWTYADYEDLMTFTQELYQEIDWSGKWPRLDYFELIKEHTGVNLAGMTDNELQKLLTKHKVSY--EKNMGAGRLIDLFWKKLVRPKVQ--GPLFVINHPVEVSPLAKRLPTDSSRVQRFQIIVGGTELGNGFSELNDPADQRARFEEQMKLRAAGDTEAQRLDEDFIEALEYGMP................................. 462
88 0.000e+00UniRef50_UPI000DC2002B EF-P lysine aminoacylase GenX n=1 Tax=Bacillus sp. SRB_336 TaxID=1969380 RepID=UPI000DC2002B  ali  42  29..................ADGQPASLQRSLHLRAHLYRLIRHFFSERQVLEVETPILSAAGNTEPNIESFSTLFHGHVDAGARERWLRTSPEFPLKRLLAAGVGDCYELGRVFRNGEAGGRHNPEFTMLEWYRVGWDHRQLMQETIALVDRALAMVGRRVISYRQLFLDEFGIDPVRASIDELRTPLDEFGI---DPQGLSHDDWLDLLITHKVQPALPRDRVTVIHDYPATQCALAKIRPGEPPLAERFELYLGRHELANGYHELNDAAEQRRRFERDNATRRARGQREVPLDHALLDVLGA-MPDCAGVALGVERLLMCLADTDAIADVLAFPFAQA 349
89 0.000e+00UniRef50_A0A2U8DEG5 Elongation factor P lysine(34) lysyltransferase n=1 Tax=Buchnera aphidicola (Melanaphis sacchari) TaxID=2173854 RepID=A0A2U8DEG5_  ali  48  6....................WKPSASIKDLVQRAKIIENIRLFFKKNKILEVETPILSQFTTTDANLTPFSTSYYSPYNDNNKKLWLSTSPEYHMKRLLAAQSGSIYQICHSFRNKEFGRYHNPEFTMLEWYQIDCKMKVFMKEVDRFFQKILNFNKSDQISYQEIFIKYLNIDPLSANSIDILKIFKLLDLEHLISDEIDKNKLIETLFTVKIQPFLGEKNPLFVYHFPAEQASLAFVNENDSRVTERFEIFFKGIELGNGFYELTDYSEHKKRFKKDNKNRFKENLSPRKIDNYFLNAIRYGLPSCSGIAIGLDRIIMIALKKKSIDQVISFSFNRS 327
90 0.000e+00UniRef50_A0A1F6RXH6 Lysine--tRNA ligase n=1 Tax=Candidatus Moranbacteria bacterium RBG_13_45_13 TaxID=1801635 RepID=A0A1F6RXH6_9BACT  ali  24  139FGLKDTEELLRRRYLDLMMN---PETRVIFRKKNIFWQTIRNFLVAEGFLEVQTPVFEHVPS-GAEAEPFVTHY----NALDQDFFLRISLELPLKRLLVGGYEKVFEIGRVFRNEGIDREHLQEYDHMEFYAAYWDTEKGMKFSEDLFRKIVFEVDFRLVDYFTEFKKETGIDLEDVDVADLIKKAEELGIKY--EKKYGKGRMIDTIYKKTVGKKL--IQPCILFGLPVEVSPFAKRDPQNPKKTLRFQIIAGGIELYNAFAELNDPIDQKNRFLEQMKLRAAGDREALMIDEDFVEALEYGMPPAFGVGMS-ERFFAFIMN-KSVRETVIFPPMK. 480
91 0.000e+00UniRef50_A0A0B3B1B1 Lysine--tRNA ligase n=1 Tax=archaeon GW2011_AR19 TaxID=1579377 RepID=A0A0B3B1B1_9ARCH  ali  23  139.GIADEEEKLRKRYLDILMN---PEVKEMFVKKSKFWNAIRNFLLEKGFLEVETPVL-ENSAGGAAATPFKTH----HNALDIDIFLRISGELWQKKLMVAGYEKTFEIGRQFRNEGIDMEHLQDYTQMEFYWAYANYEDGMKLVEEMYKKIAKEIFETLKFESHGYKIDLGKKWEIYDFENLIKKETKXXPKIDLDLNLDKWKMIDLLWKYC---RKKISGPGFLINQPVELSPLAKRNSEDSKKVEQFQVIIAGTELGNGYSELNDPIDQEERFRRQSELKKAGDKESMEHDKSFVEALKYGMPPTCGFGVS-ERLFSYLMNKP-IRECVIFPLMKS 501
92 0.000e+00UniRef50_A0A1X7APG3 Elongation factor P--(R)-beta-lysine ligase n=3 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A1X7APG3_9GAMM  ali  42  6....................WQPSAELDSLRQRGELLRNIRNYFHQEDVMEVETPMLSHHATVDPHIDSFQTVFTPLGTKAQEKLYLHTSPEFPMKRLLSAGSGDIYFLGRVFRNGEAGGRHNPEFTMLEWYRLGIDHHALMDDVTGLLAAVTNFEEQARFSYRELFEEEFGIDPHTATDETLMKLT--HEYVDSGLSGLARNDYLDLLFSTSIEPNLGQIQGVFVYDYPASMSALSRINEQGQKVAARFELFANGYELANGYHELADGHEQRARFEKDLQERELLGKPVYPYDQNMVSALEQGFPDCAGVAMGIDRLHMLIAQKRAIKDVIPFEFFRA 329
93 0.000e+00UniRef50_A0A1V0KHM2 Lysine--tRNA ligase n=5 Tax=Actinomyces TaxID=1654 RepID=A0A1V0KHM2_9ACTO  ali  24  224.....EEQRVRRRELDLLT---RPAARDMVRIRAAVVRSLRENFHRRDYVELETPML-QVIHGGAAARPFVTH----MNAFDMDLYLRIATEIYLKRAVVGGVDRVFEINRNFRNEGADSSHSPEFAALEAYEAYSDYNGMAELTRNLVQQAARDAFWAKIDLYTSISEAVGEEITVGTPREDLVRIAEK-LGLEVDDYAVAGKIAEDIFEVTVGDSL--WAPTFVYDFPEDTSPLTRYHRSKPGLTEKWDLYVRGFELGTAYSELADPVVQRERFEAQALAAANGDPEAMVLDEDFLVAMEQGFPPCGGMGMGIDRLLMALTGQG-IRETITFPIVK. 566
94 0.000e+00UniRef50_A0A2E8WGP0 EF-P lysine aminoacylase GenX n=3 Tax=Gemmatimonadetes bacterium TaxID=2026742 RepID=A0A2E8WGP0_9BACT  ali  40  101..............................EIRARVLRNIRTWFDERDYLEVETPLLIRVPGMEPHLRTFETRSED-----GRQLYLPTSPEYAMKRLLSEGLERIYQICKSFRDEPAAPFHNPEFTMLEWYRAYADYSQIAEDTEQLVAHLARQPPWERLTVREAFSRYSDVDADPCDPDSFLE-AARASKLSDIDAKDDADSAFFKIFLDQVEPRLGSPRPTILTEYPTRMGALAKRSSHDPTIAERLEVYIAGIELANAFTELNDPEEQRARLEQESDKRRDLGMPEYELDQQFLGALEQGVPPSGGIALGVDRLIMLLTDAPHIADVLAFPF... 417
95 0.000e+00UniRef50_F8DZC7 Lysyl-tRNA synthetase n=1 Tax=Corynebacterium resistens (strain DSM 45100 / JCM 12819 / GTC 2026) TaxID=662755 RepID=F8DZC7_CORRG  ali  27  804.GLQNPETRLRNRHLDMTLN---PGVMQSLRTRSAVLNAMRSELVQRDYLEVETPILQP-IHGGANARPFRTYI----NAYDMDLYLRIAPELYLKRLMCGGAPKVFELGRDFRNEGADNKHNPEFTVLEAYEAHGDYRTMMDLTRRLICAAATAVHGQRTASHESDTEIAPCTTIGLDTDIDQLRKIAETVGLHPQAAWDEGKIIEEIYGELVEDTTTL--PTFYIDFPASVSPLTRPHPENPNLCQRWDLVAFGMELGTAYSELTDPLLQRERLEQQSLLAAGGDAEAMEVDEDFLRALEFGMPPAGGLGLGIDRIIMLING-GSMRENLAFPLVK. 1172
96 0.000e+00UniRef50_A0A0S8DPQ3 Lysine--tRNA ligase (Fragment) n=2 Tax=root TaxID=1 RepID=A0A0S8DPQ3_9BACT  ali  28  139.GLKDIELRYRQRYLDLLVN---KEVREIFELRSRLISRIRTFLDGKGFLEVETPMMQPLP-GGATARPFKTH----HEALGVDLYLRIAPELYLKRLLVGGFEKVYEINRNFRNEGISPRHNPEFTMLEVYAAYANYQDMMELACELILDAAKHIFGKYKVNYKDGDIDLSPPWANLTFHEAVTKYAGIDYKAEKDIRHLEEEVVNKIFEKFVEPKL--IKPTFVIDYPARLCPLSKRKPDAPDLAERFELFIGGQELANAYSELNDPLEQRARFEEQVEQ......................................................... 422
97 0.000e+00UniRef50_P67608 Lysine--tRNA ligase 1 n=1307 Tax=root TaxID=1 RepID=SYK1_MYCBO  ali  28  157.....EESRVRQRYVDLIV---RPEARAVARLRIAVVRAIRTALQRRGFLEVETPVL-QTLAGGAAARPFATH----SNALDIDLYLRIAPELFLKRCIVGGFDKVFELNRVFRNEGADSTHSPEFSMLETYQTYGTYDDSAVVTRELIQEYDIDGEWATIQMYPSLSVALGEEIPQTTVDRLRGIADSLGLEKDPAIHDNRGFGHGKLIEELWERTVGKSAPTFVKDFPVQTTPLTRQHRSIPGVTEKWDLYLRGIELATGYSELSDPVVQRERFADQARAAAAGDDEAMVLDEDFLAALEYGMPPCTGTGMGIDRLLMSLTGL-SIRETVLFPIVR. 501
98 0.000e+00UniRef50_A0A1I2IKU7 Elongation factor P--(R)-beta-lysine ligase n=2 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A1I2IKU7_9GAMM  ali  47  7...................HWRPSATLATLKARAELYGSVRSFFAARGVLEVETPILSHHATVDRHIDSFAVSAPRATGAAHV-GFLQTSPEFAMKRLLASGSGPIFQIARVFRAGEQGRYHNPEFTLLEWYRPGFDHHALMDELAELLAHCGIAGPCARLSYREAFERHAGFDPHMLDRERLRARGLAEPQGLSAEEIGDADFWLDLWMSQVVGPCLGTQTPEFVYDFPATQAALARVRPGTPPLAERFELFWKGVELANGFHELTDADEQQRRFEADRRWRAAHGRSDLPYDRHLIEALRAGLPPCAGVAVGLDRLLMLKLALPSVAETLAFAGDRA 329
99 0.000e+00UniRef50_A0A0M4QPM1 Lysine--tRNA ligase n=32 Tax=Actinobacteria TaxID=201174 RepID=A0A0M4QPM1_9MICC  ali  26  144.....EEMRVRQRYVDLIV---RDDAREQVRTRSAIVKAIRDTLHGEDYIELETPIL-QLMHGGAAARPFRTHL----NAFDQPMTLRIAIELYLKRAVVGGMDKVFEVGRIFRNEGVDSTHSPEFTMLEAYEAYGDQFTMAKTMQRIILAAADAVEWPWLPVYQGLSDMVGQEITPDTTATELHAIAAKHE-VKIDPAWDSEKLVVELFGEIVEPTL--IQPTFVCDYPPSAQPLARQHRSKPNLIEAWDLVIDGRETGTAFSELIDPVIQRDRLTQQSLAAAAGDPEAMQLDEDFLRALEYGAPPMGGLGLGVDRLVMLFTGVG-IREAILFPLMK. 480
100 0.000e+00UniRef50_A0A072N3H8 Elongation factor P--(R)-beta-lysine ligase n=7 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A072N3H8_9ALTE  ali  47  6....................WRPTAEQTALKGRARQLAYVRGFFADRDVLEVETPVLGRHGVTDLNLDSISADVSVQGQSGG---WLQTSPEYHMKRLLAAGSGPIFQVSKVFRDGERGSRHNPEFSMLEWYRPGFDDQALMNEVADLVCGWLDCDRPKQLTYRDALITLAQVDPFEISDEALKQRCEE-WLDPAQLADMGRDGCLDLIMSFVVEPNLGRACPEFLTAYPASQAALARTSEHNERTAHRFELYIDGLELCNGYWELTDFCEQRRRFEVDNHLREQAGKPAMAKDEAFLAAIEAGLPDCAGVALGLDRLLMLKLGTRDIAEVLSFPFERA 321
101 0.000e+00UniRef50_A0A261KMQ9 Lysyl-tRNA synthetase (Fragment) n=1 Tax=Hydrocoleum sp. CS-953 TaxID=1671698 RepID=A0A261KMQ9_9CYAN  ali  30  3..........................................................QAIYGGAAARPFITH----HNALDVDLYLRIATELFLKRAICGGFERVFELGRVFRNEGIDSTHNPEFTSLEVYQAYADYFEILGLVEDVICYSITNVHWQVKTMVEAVKDETGLDFDNLEXXXXXXXXXXXXXXXXXXXXXSLGYLLYAVFDQKVESTL--IQPTFIIDFPVEVSPLAKRHHSKPGFVERFELFIHGTEYSNGFSELNDPQDQRKRFEEQIAQREAGDDEAHPMDEDFIQALSLGMPNCGGMGIGVDRVVMLLTNTQSIRDVIMFPTMRS 309
102 0.000e+00UniRef50_K0C758 Elongation factor P--(R)-beta-lysine ligase n=24 Tax=Bacteria TaxID=2 RepID=K0C758_CYCSP  ali  42  9....................WPPTCSAALLHQRAELYRTIRAFFIEKAVLEVETPVLSAAASCDINLDSFCTALSA-----SQKLYLQTSPEFAMKRLLAAGSGSIYQIAKSFRQSERGRFHNPEFTLLEWYRVGFKLADLINEMVELLMLCFGQNLAYRVTYQQLFQQLTGLNPHQLTYSDLMAYATTQGNPEASDICGGKSNGLDYVFSQYVQPKLKKDLVYFVTNYPECMAMLAQLDEGPPVTAKRFEVYFNNVELANGYEELTDAAEQARRFRDELTQREQGGLDGLPMDKNLLAALAHGMPECSGVALGLDRLLMLMTGANAIDDVLTFPIDRA 324
103 0.000e+00UniRef50_A0A2S6H6N5 Lysyl-tRNA synthetase class 2 n=3 Tax=Methylococcaceae TaxID=403 RepID=A0A2S6H6N5_9GAMM  ali  42  1................MLQEWQPTCPIELLRLRARTLAKIRQFFADRSVLEVETPLLGNSIGTDPQLAFFTTEYLSPQSPSRQTLFLQTSPEFAMKRLLAAGSGSIYQIGKAFRNGESGRFHNPEFTMLEWYRVGFTLPQLMDEIAELVGGLLPLQETQRVSYQDVFVSFTGLDPLVFSYQDYCNFARECGLSEAVDICHDHALWLDFIFSHNVQPHLGKNALCMVYGYPACQSSLARINEQCAQITERVELFVNGVELGNGYHELTDAAEQSSRFDKELAIRQQQKLPVSVKDKRLIAALESGLPECSGMAIGLDRLLMLLSGSASIDDVLSFPIHRA 341
104 0.000e+00UniRef50_A0A0G0Q1X8 Lysine--tRNA ligase n=7 Tax=root TaxID=1 RepID=A0A0G0Q1X8_9BACT  ali  25  144.GLQDEEERLRKRYLDILSN---EEVKEMLKKKALFWQSMRAFLVSKGFLEVETPVL-ENTTGGADARPFITH----HNALDIDVYLRISGELWQKRLMVAGLEKTFEIGRQFRNEGMDAEHLQDYTQMEFYWSYANYEDGMLLVEELYKYVAEKTFGTLKFSIGKFEVDLGKKWERYDYRETVKKYTGXXXXXXDKEGFNITRAIDNLWKYC---RKQIGGPGFLVGVPVEVSPLAKRDEANPKITQRFQPIIAGSELGNGYSELNDPIDQAERFMEQTKLREAGDVEAQMNDYDFVEALEYGMPPTCGFGLS-ERLFAFLMN-KSMRECQTFPLMR. 484
105 0.000e+00UniRef50_A0A2D6DRM3 Lysine--tRNA ligase n=2 Tax=Parcubacteria group TaxID=1794811 RepID=A0A2D6DRM3_9BACT  ali  30  143.GLKDVEERFRKRYLDLIMN---KETKEIFKKRSEIIKKLRGLLESNKFIEVETPIL-QSLYGGASAKPFKTHL----NALDMELYLRVAPELYLKRLLVGGLERVFEIGRCFRNEGMDREHNPDFTMLEFYAAYWDWEDLMKFVEQI--------------MHQLDAKVFPEKWDRVEYKDVVKN--------------------DDIKGSFAKLE----KPTFVLHLPDI--PLCKDGQA-------FQGIVQGVELFKAFSEQNDSMEQRKVFEQQEALRKKGDEEAQRLDSDFLEALEYGMPPAAGIGIGIDRLAILLTEARSVRESILFPLMK. 424
106 0.000e+00UniRef50_A0A226NCW9 Uncharacterized protein n=8 Tax=Eukaryota TaxID=2759 RepID=A0A226NCW9_CALSU  ali  26  125............................................................VAGGAMAKPFIT----YHNELDMKLYMRIAPELYHKMLVVGGLDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKLAYEIDFTPPFRRISMVDELEKTLGVKFPSTETEETRRFFDDLCTVRNVECPPPRTTARLLDKLVGEFLEVTCINPTFICDHPQIMSPLAKWHRTRQGLTERFELFVMKKEVCNAYTELNDPFQQRQLFEDQAKAKAAGDDEAMFIDENFCTALEYGLPPTAGWGMGIDRFTMFLTDSSNIKEVLLFPAMK. 425
107 0.000e+00UniRef50_A0A1F5Z233 Lysine--tRNA ligase n=1 Tax=Candidatus Gottesmanbacteria bacterium RIFCSPHIGHO2_01_FULL_42_12 TaxID=1798377 RepID=A0A1F5Z233_9BAC  ali  25  137FGIKDEETRYRQRYLDLLLDENL---RSLFYKKALFWNSMREYLAKNGFLEVETPVL-ETTAGGADAQPFITH----HNALDIDLYLRISGELWQKRLMVAGFEKTFEIGRQFRNEGISREHLQDYTQMEFYWAYANFDDSMRLVEEMYKYVIEKTFGTLKFQVGDYSLDFSGTWERIDYVETIKKLAGVDITKMSDGREVDGIW------KGVRKQIA--GPVFLTGHPVLVSPLAKRMEKNPDYVERYQVIIAGSELGNGYSELNDPIDQSERFKIQQEARDKGDEEAQMNDTEFVKALEYGMPPVSGFGVS-ERLFSFLCNLP-IRETVLFPLLR. 457
108 0.000e+00UniRef50_A0A1T5L605 Lysine--tRNA ligase n=7 Tax=Micrococcales TaxID=85006 RepID=A0A1T5L605_9MICO  ali  29  733.GLLDPETRVRQRHLDLLVNPQAAE---MVRARSYAIQALRDGLLEDGYLEVETPIL-QSVHGGANARPFRTRI----NAYRTDLTLRIAPELALKRLVVAGFPQVFEIGRNFRNEGADATHNPEFTAVEAYRAYADYTDMRQLAQRLITRMAVAVSWPVLSVCDAVSAVTGVTV-TIDSDRAVLEAVSRDHGLDPRSSDDAGHLIERLYEELVEP--ATTAPTFYIDFPASTSPLTRGHRTTPGLAERWDLVAFGTEVGTAYTELADPFEQRARLTAQSLLAAGGDPEAMEVDESFLAALELGMPPTGGLGLGVDRIVMLITGA-TIRESIAFPFVR. 1075
109 0.000e+00UniRef50_A0A1B1NBM7 Lysine--tRNA ligase n=45 Tax=root TaxID=1 RepID=A0A1B1NBM7_9MICO  ali  23  161.....EEQRVRQRYVDLIV---RDEARQMVVDRAALTRAVRRVLEQDGYVEVETPVL-QAVHGGANARPFNTHL----NAFDLPMTMRIALELYLKRAVVGGVERVYEIGRIFRNEGIDSTHSPEFTMLECYQAYGDQFTMADLMRRMILAAADELEWSWLPFYEGLSSAMGESVGVDSSEEDLRRLADAHG-VPVKPEWGADKIAMEIFGDVVEPTL--IQPTFVCDYPALAQPLARPHRSEPGLVEAWDLVIGGVERGTAFSELVDPEVQRARLTEQSLLAAGGDEDAMQLDEDFLRALEYAAPPMGGLGMGLDRVLMLLTGTG-IRETILFPFLK. 497
110 0.000e+00UniRef50_A0A2N5ZU33 Lysine--tRNA ligase n=1 Tax=Candidatus Parcubacteria bacterium TaxID=2053309 RepID=A0A2N5ZU33_9BACT  ali  22  146.GLQDDDKKQRFRELEMISDRR---AYERFKKRFEATRAIREYMWANKFVEVETPIL-QNVYGGTYAKPFTTYYHG----LDQDFYLRIAPEMFLKRTVAGGFERIFEIGKCFRNEGMGPAHLQEFTMFEFYWPYVDYNFLMDFTENLIKEVVEKVYKNFVVKYGDNEINFQPPFPRKTFDELLKMEKSLENKVNVKDKIGWPAKIDELYKKTVRNKL--INPVFVTDYPKELMALAKTKEEEPEKVATFQLVINTWEMIKAYNELNDPIDQRERFEAQERLVIEGDEEAMPFDHDFVESMEYGMPPMAGWGMGLDRFFALLEGEENIRDMVMFPTMK. 492
111 0.000e+00UniRef50_A4T5M9 Lysine--tRNA ligase n=393 Tax=cellular organisms TaxID=131567 RepID=SYK_MYCGI  ali  27  156....NEETRVRQRYVDLIV---RPEARTIARQRIAVVRAVRSALERRGFLEVETPML-QTLAGGAAARPFVTH----SNALDADLYLRIAPELFLKRCVVGGFDRVFELNRNFRNEGADSTHSPEFAMLETYQAYGTYDDSATVTRELIQEYDLDGEWQSLQMYPSLSEALGEEIPATPAEKLWQIADRLGVEIPRDRGYGHGKLVEELWEFTVGDTL--WAPTFVRDFPVETTPLTRPHRSIEGVTEKWDLYVRKFELATGYSELIDPIIQRERFEAQARAAAAGDDEAMALDEDFLAALEYGMPPTTGTGMGIDRLLMALTGL-SIRETVLFPIVR. 497
112 0.000e+00UniRef50_A0A1X1QQB0 Elongation factor P--(R)-beta-lysine ligase n=2 Tax=Cycloclasticus TaxID=34067 RepID=A0A1X1QQB0_9GAMM  ali  40  9....................WPPTCSAALLHKRAELYQTIRTFFVEKSVLEVDTPVLSSAASCDVNLDSFSTKLMKNAQSERL-LYLQTSPEFAMKRLLASGSGSIYQIAKSFRQGESGRFHNPEFTLLEWYRVGFAVADLIEEMVELMLCFNENLAFRTVTYQQLFQQHTGINPHETSQEALMQYATAQGNPEAASICDSVSNGLDYVFSQYIQPGLKKNLVYFVIDYPACMAMLAKLSNTTPQKAKRFEVYFNSVELANGYEELTDSVEQKNRFSDELRERKKEGLDGVPMDQNLLAALEEGLPQCSGVALGLDRLLMLMTASKSIDDVMAFPIDRA 328
113 0.000e+00UniRef50_A0A2E5F976 Elongation factor P--(R)-beta-lysine ligase n=3 Tax=Cycloclasticus TaxID=34067 RepID=A0A2E5F976_9GAMM  ali  41  9....................WPPTCTVAFLQTRAELYQTIRLFFAEKNVLEVETPVLSAAASCDLNLESFSTMCVA-----DQLMYLQTSPEFAMKRLLAAGSGSIYQIAKSFRQSERGRFHNPEFTLLEWYRVGFSLPDLMEEMVELLMLCFQNLAFRTVTYQQIVQQLTGLNPHRATLSELMEYAANQGHPEAVTICDGKSNGLDYVFSQYVQPKLKKEIVYFVTDYPECMAMLSKLSGTQPVTANRFEVYFNNVELANGYEELTDAVEQKKRFQDELTERQQVGLANVPMDENLLAALAHGLPDCSGVALGLDRLLMLMTDAKSIDDVLTFPIDRA 324
114 0.000e+00UniRef50_A0A2E9ZB33 Elongation factor P--(R)-beta-lysine ligase n=4 Tax=root TaxID=1 RepID=A0A2E9ZB33_9COXI  ali  47  1.................MIDWQPSASIATLQQRAHILHQIRQFFHERAIMEVETPLLCQHTVTDPYIDSFAIADHQP------PYYLQTSPEYAMKRLLAAGSGPIYQISKAFRQEEQGSLHNPEFTLLEWYRPGFTHLDLIDEIDTLLQTLIQSKPAQKITYHDLFDTHFAINPHTCSLESLHQCVAKH-INAPSLNSLNRDDCLNLLLTHVIEPTLGIQSPTFIYDYPASQAALAQIRKGSPSVAERFELYINGIELANGFHELQDADEQYHRFQQDLRNRQQLNKSLPKIDQRFITALQAGLPACSGVALGVDRLVTLACSHDVLSKSLSFNWSCA 315
115 0.000e+00UniRef50_A0A1W1DEX8 Lysyl-tRNA synthetase (Class II) n=1 Tax=hydrothermal vent metagenome TaxID=652676 RepID=A0A1W1DEX8_9ZZZZ  ali  30  1....................................MSYIRNFFNDIDFIEVETPML-QTIPGGATAKPFETH----HNALDIGMYLRIAPELYLKRLVVGGMDRVFEINRNFRNEGLSTRHNPEFTMIEFYQAYATYHDLMDLTEKLFRGIAVDVCGDAVIHYQGDDFDFSQSFDRIDLNEDNAKKTAENLNIQVKDNWGLGKIQIEIFEATVEEKL--IQPTF-----------------------RFELFIGGREIANGFSELNDAEDQAARFKAQVAEKDAGDDEAMHYDADYIRALEYGMPPTAGEGIGIDRLVMLFTDSPSIRDVLLFPHMR. 288
116 0.000e+00UniRef50_UPI000948E501 EF-P lysine aminoacylase GenX n=2 Tax=Neptunomonas phycophila TaxID=1572645 RepID=UPI000948E501  ali  44  1................MNSHWQPTAPIAHLQKRADILAQIRRYFANQQVWEVDAAVMSQAAVSDPFIDSLEVAYRPFPEAEATQCYLQTSPEYAMKRLLAAGSGDIYQMGKVFRNGEVGRIHNPEFTMLEWYRLGMDDTQLMDDVEALVTSILGIPPIRRCTYTRIFAEKTGLDIHNDDNQTLADYARAH--IDVDIATDDRDGWLNLIMSHFIEPTLI-DEPIFVTEYPASQSALARVRPDANGVAARFELFIGGMELANGYHELTDPAEQQRRLAADQATRASLNLPQRPLETRLVDALTQGLPDCAGVALGVDRLVMLALGTDRIDQVIPFPFERA 322
117 0.000e+00UniRef50_A0A2H0W3U1 Lysine--tRNA ligase n=3 Tax=Bacteria TaxID=2 RepID=A0A2H0W3U1_9BACT  ali  24  141.GVKDQDTIYRQRYLDLLMN---EDSKKTFKFRSNFIKNLREFYYLEGFDEVETPTFLH-QATGATATPYKTH----NNALDIDIYLRISHELPLKELIIGGMEKVFELGKAFRNEGVDPSHLPEHTHLEHYCAYWNFEDNIIFTEKMTHQVDFSTPFKRVNFIELIKTDTGLDITKTDNKKLLTDIKKAEIEFDGMNDMSLAGLVDNLYKKVSRPKI--INPTILYHYPKYLQPLARVNDQDENIVDQFQLVVNGWEIIKAYSELVDPIDQKERFNDQLKAKAAGEEEVMESDDEFITALEHGAPPISGWGMGIDRVVALLTGHTNLRDVVLFPLLR. 490
118 0.000e+00UniRef50_A0A166WDV5 Lysine--tRNA ligase n=1 Tax=Leptolyngbya valderiana BDU 20041 TaxID=322866 RepID=A0A166WDV5_9CYAN  ali  29  182.GLSDPEARFRRRYVDL---WSNPEAMARLVLRGKIVRDVRAFMEERGFAEVETPVLQAQAGG-AAARPFVTHL----NALDMDLSLRIAPELYLKRLLVAGMPRVFEMSRNFRNEGLSRRHNPEFTSMEAYQAFGDAHTMLELAESMVRRLAEMVCADRAMPWEGLEINYADPFVQVEYGDLFEKARKAAHEYTDAATTDHWLLVDRLFEDKAEQLIDKTRPTFVLHYPSATSPLTRPLEDRPELAGRWDLFIAGMEIGPAYTELNDPHIQEAKFRQQLAGAQADDNTFRTLDEDFLRALRVGMPPAGGIGLGIDRLAMLLTGGASLREVIPFPFMR. 533
119 0.000e+00UniRef50_UPI00096FF357 bifunctional lysylphosphatidylglycerol synthetase/lysine--tRNA ligase LysX n=3 Tax=Micrococcales TaxID=85006 RepID=UPI00096FF3  ali  30  745.GLADPEARVRRRSTDLLAH---PGELELLRRRSSVVAALRRTLADRGFLEVETPML-HVTHGGATARPFRTHI----NAYGTDLSLRIAPELYLKRLLVGGIGPVFELGRSFRNEGADATHNPEFTSLEVYEPHADYVTMRHLAECLVREAATAVHFPVVRVLDAVSEAVGLRVPDTDLDVLLEVASRHGVT--VPERAGWGAVVEELYAELVEP--VTVLPTFYTDFPVETSPLVHPHRTERGLVERWDLVVAGMEVGTAYSELTDPVDQRRRLTEQSLRAAAGDPEAMEVDEDFLHALELGMPPTGGLGIGVDRLVMLLTNT-SIRSVLTFPFVR. 1097
120 0.000e+00UniRef50_F8E208 Lysine--tRNA ligase n=460 Tax=root TaxID=1 RepID=F8E208_CORRG  ali  26  184.....EDTRIRHRYTDLIM---REQARKNAMTRIKVMRALRNALERRGFLELETPML-QTLHGGAAARPFITH----SNALDIDLYLRIAPELFLKRAVVGGLDRVFEVNRNFRNEGVDSSHSPEFAMLETYQAYGDYNTAATATREIIQEVAIEVFWPEIKMYPSLNEALQKKHPDSTVEELKELAKVVGLEVTAKGGWGHGKLVEELWEHLCEDQL--DGPIFVRDFPVETSPLVRQHRSEPGVTEKWDLYVRGFELATGYSELIDPVIQRERFEDQARLAAGGDDEAMVLDEDFLAAMEQGMPPTAGTGMGIDRLLMALTGLG-IRETILFPLVK. 530
121 0.000e+00UniRef50_A0A139AYR9 Lysine--tRNA ligase n=1 Tax=Gonapodya prolifera JEL478 TaxID=1344416 RepID=A0A139AYR9_GONPR  ali  27  221.GLEDAELRLRIRPLALLASADLS---NNLRLRSRIVSYMRRYFDTEGFLEVETPVLS-LKAGGANAKPFVT----WNNGLDAEMRMRVAPELYLKQLVVGGLDRVYEIGKCFRNEGIDNTHLPEFTSCEFYEAYADLNKVMTRTEKLLHGLVQTPPFRRIHVVDTLSAAIGEPLPLPSESCTESKTLSLRHHVALPKPLTLARVYDKLIERFIEH--DCFQPTFLVGHPGVMCPLARRDPTLPATTLRFELFVKGFELANAYAELNDPLEQHTRFVAQFAARTEQDEEVAPPDEDFVRALEYGLPPTGGWGLGIDRLVMILTGAKGIRDVVTFAAVR. 584
122 0.000e+00UniRef50_A0A1H3W7L4 Lysine--tRNA ligase n=1 Tax=Actinomyces nasicola TaxID=208480 RepID=A0A1H3W7L4_9ACTO  ali  28  723.GLTDPEAQVRQRHVDLAIN---DEARRTLAARSAILNSLRASLLAEGYLEVETPILQP-IHGGANARPFTTHI----NAYDLDLYLRIAPELYLKRLCVGGVERVFELGRTFRNEGVDFSHNPEFTILEAYRAHADYIDMLHTIRRLIQNAAIAVHWPIVPIYDGISDHLAPITTETSVEDLQQVCEGLDIAYRPD--WDHGELVLELYEHLIEERTTT--PQFNIDFPLSVSPLTGTHRHNPKLAERWDLVAWGVELGTAYSELTNPIDQRDRLTEQSVKAAGGDPEAMELDEDFLSALEFGMAPSGGLGMGVDRVVMLITG-KSLRETLPFPLVK. 1072
123 0.000e+00UniRef50_A0A0J0UVZ8 Lysine--tRNA ligase n=1 Tax=Actinobacteria bacterium IMCC26207 TaxID=1641811 RepID=A0A0J0UVZ8_9ACTN  ali  30  147.....VEYRSRYREADLMENLQ---SRTVFTMRSEAISGIRVALEARGFLEVETPVFAAD-AGGATARPFVTR----HNALGQDLMMRIAPELFLKRLVIGGMDRVFELGRVFRNEGMSAKHNPEFTMLEVYQAYADYTDMMELVQHVVVEAALASLGTTVRIPSGQQIDLALPWRRASMSDLVFEHTGERIEARMEEVWGSGRCLVAVFEDRVEANL--ISPTIVTGHPVETSPLARHCRTDPSLTERFEVIVGGMELANAYSELNDPVEQRERFMSERSRAQAAGEDTLSLDQRYVEALERGLPPTGGLGIGIDRLVMLLTNSSSIRDVILFPTMRS 490
124 0.000e+00UniRef50_UPI00080A8218 bifunctional lysylphosphatidylglycerol synthetase/lysine--tRNA ligase LysX n=4 Tax=Micrococcales TaxID=85006 RepID=UPI00080A82  ali  28  783..FTDPEARLRRRSMDLIVN---PAESHRLRIRSATIRSIRRTLDAHNFLEVETPMLN-TVHGGASARPFKT----FINAYGVDLTLRIAPELYLKRLVVGDMGPVYELGRDFRNEGADATHNPEFTVLEAYQPYADYNVMRELTERLLKNAAREVFWPVVSVCDALSEAVGQRIDLETNFEELLGLARQHEIHVRDD-MGPGAVIEELYGELVEAK--TSRPTFYKDFPVETSPLAGPHRSEPGLAERWDLVINGTEMGTAYSEMADALEQRRRLTEQSLKAAAGDLEAMQIDEDFLDALETGLPPTGGMGIGIDRLIMMLTGAP-IRGVLAFPFVR. 1134
125 0.000e+00UniRef50_A0A0G0FXW2 Lysine--tRNA ligase n=81 Tax=root TaxID=1 RepID=A0A0G0FXW2_9BACT  ali  23  176.GLQDVEEKLRKRYLDILFN---PEIKEMIEKRAIFWNSVREFLIEKWFLEVETPIL-ETIPGGADARPFITH----HNALDVDLYLRISGELWQKKLMVAGFEKTFEIGRQFRNEGMDAEHLQDYTQMEFYWAYADFEEGMKLVEEMYKYVDFGKKWEKYDYISTVAKHTGVNINEASLEEMEKALQNLKIDYDR-KGFNRARAIDNLWK---FCRKKIAGPGFLINTPIEVSPLAKKNEKNEKLAQRFQVILAGSENGNGYSELNNPIDQAERFTQQQKLRDAGDQEAQRYDRDFIEALEYGMPPTCGFGFS-ERLFSFLMDKPS-RDCQIFPLMK. 516
126 0.000e+00UniRef50_A0A2R6IYT1 Lysine--tRNA ligase n=2 Tax=unclassified Halobacteriales (miscellaneous) TaxID=38063 RepID=A0A2R6IYT1_9EURY  ali  30  150............RYETRAVKFWWGEVRDPVETRYRMTRQLRRFLDDCGFLEVETPVL-QNVAGGTDATPFETHLE----AKDQEMYLRIATELHLKRLLVGGFEKVYEVGPVFRNEDIDVTHNPEFTMLELYQAYADYTDMMDLTEDLVAHIDFSPPWPRMTPEEAIERYSDESIDVTECDDEELRELALAHGGEFPGGYSRGLGIVELFENVAEYEI--VDPTFVVDHPKETTPLCKDHREKEGRIERFELFAAGFELANAYTELNDPVEQGELFAEQVARREAGDEEAHQMDEDFLDALAHGMPPAGGLGVGIDRLAMLATNSQTIKDVIAFPI... 504
127 0.000e+00UniRef50_A0A2E5WMG3 Lysine--tRNA ligase n=1 Tax=bacterium TaxID=1869227 RepID=A0A2E5WMG3_9BACT  ali  23  146.GVSDIEIQYRKRYLQTSTDRQ---AFERFRKRTILVQKIRDFLNENRFMEVTTPTLSSS-ASGALAKPFTT----FHNATKSDFYLRIAPETALKKAVACGFERVYEFAINFRNEGLDPSHLPEFMMLEFYASYWNYEDLMDFTEKMIKKVIQETCYPRVSMRDLIFKDCGIDIYEKDIESLKKAILDKGIKVKDFDNLGYGNLIDNLYKKVSRPKI--INPIFLINHPVELSPLARMNDENPEIVDRFQLVCNTWEILNAYSELTDPVDQKQRFMQQAEYKTQGDDEAMMIDFSFLDAMEHGFPPMAGFGMGIERLLCLLLDQENLRDVVLFPMTKS 491
128 0.000e+00UniRef50_A0A1R0GLP1 Putative lysine-tRNA ligase, cytoplasmic n=1 Tax=Smittium mucronatum TaxID=133383 RepID=A0A1R0GLP1_9FUNG  ali  23  49..LENPDVRFRNRHVDFLVNQK---ARNTIIVRSKVLKIIRQFFDSQGFIEVETPILWPSL-GGANAKPFVTSSSALGNN---ELFLRISPELFLKQLVIGGFEKVYEIGKLFRNEGIDKSHNPEFTSIEFYQAYANLSDLIKTTESLPKEINFSTPFKQINIIDFLEKKLNSSFKFLSTENILSIYKSNKIPTDSVHPITPTKLMDNLISIFIEP--LCINPTFLVGHPIFMSPLAKSKSIVNSVSSRFELFIDGMEFVNAYEELNDPDEQRVRFSMQMIDRKRKDSEALLPNSEYCDALEFGLPPTAGWGMGIDRIISLLSKSKNLREVISFPIIKS 425
129 0.000e+00UniRef50_A0A2T2R194 Lysine--tRNA ligase n=1 Tax=Parcubacteria group bacterium QH_9_35_7 TaxID=1919223 RepID=A0A2T2R194_9BACT  ali  25  143.GLKDKETRLRKRYLDFIDN---PEEQALFERKAKFWKEIRDYLLKKDFLEVYTPVLEKK-AGGAEAEPFVTH----HNALGMDVFLRISGELWQKRLMVGGFEKTFEIGRQFRNEGMSKEHLQDYTQMEFYWAYADYEDCMKMVESMFKEFVQAVWWEKIDYVETIEEKTGINVLTADKKEVKSKLDDLDL--EYDESDGKGRLVDSLWKHC---RKEIKGPCFLVNHPVFVSPLAKRKEDNPELTERFQVIIAGTEIANGYSELNDPIDQAERFKKQAELRAQGDEEAQMFDKDFVEALEHGMPPTTGFGMSV-RAFAFFEDRP-IRECVMFPLTR. 483
130 0.000e+00UniRef50_A4FIY1 Lysine--tRNA ligase n=2 Tax=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 23  ali  27  747.GLSDPHSRVRARHLDLIT---RPEARSVLRARSAATHALRDVLVRSDFVEVETPVLQP-VRGGANARPFSTHI----NAYDLRLYLRIAPELYLKRLCVGGVERLFEIGRAFRNEGVSHKHNPEFTMLEAYQAFGDYTTMRELCRELVVATDLADDWPVIGVHEAVSAATGEEVTADTPVRRLRRLCDDNGIAHLRDW-GRGAVLLELYERLVEAE--TTGPTFYRDFPAEVSPLARPHRHDARLAERWDLVAFGTELGTGYSELTDPVEQRRRLADQARLAAEGDAEAMDVDEDFLTALEYAMPPTGGLGLGVDRLVMLLTG-RSIRDTLAFPLVK. 1093
131 0.000e+00UniRef50_A0A1G2TH32 Lysine--tRNA ligase n=3 Tax=Parcubacteria group TaxID=1794811 RepID=A0A1G2TH32_9BACT  ali  26  145.GLQDIEERFRKRYLDLLSN---PGIKERFVTRAKIIELVRQFYLNDGYIEVDLPNLQP-LAGGATALPFKTH----HNALDMDFYLPIAQELYLKELLAGGMSKVFEIGKRFRNEGIDTTHNPEFTMLESNEAYADAKSQREFIEELFKFVVEGLFGKLQFEYQGQEINL----------------------EPSFKVMPYPEVTDEEYKREIRPTL--VQPTFLVDYPVSANPFAKRKEDNPNLIDRFQLVMGGLELVNAFSELNNSIDQRERYLEEDKKGKAGEKDISPSDLEYLEAMEYGMPPNGGIGIGIDRLVMLLTNVKNIKEVILFPTLK. 449
132 0.000e+00UniRef50_A0A1G0HB81 Elongation factor P--(R)-beta-lysine ligase n=1 Tax=Gammaproteobacteria bacterium RIFCSPHIGHO2_12_FULL_41_15 TaxID=1798282 RepID=  ali  46  10.............................LRERNNFYQQIRQFFQTRDVLEVETPTLSQHTITDVFIDSFQTTY--FNNDTKTPYFLQTSPEFHMKRLLANNSGSIFQICKAFRNGEFGHMHNPEFTLLEWYRVDFDHHDLMQEVSDLLVFLLNCAPATKISYQLLFENHLNIQPHTCDVNALKTIAEKNNLHIDA-THLSKDDWLQLLLSHLIEPHLGFHAPVFIYDYPATQAALAKIRQDQFNVAERFEVYINGQEIGNGFHELTDPLLQLQRFQADQNTRRQQNRFVPEIDGRFMKALESGLPQCAGIAMGLDRLFMLKMGVETIREVLPFAWDEA 317
133 0.000e+00UniRef50_A0A1V5R430 Lysine--tRNA ligase n=3 Tax=Parcubacteria group TaxID=1794811 RepID=A0A1V5R430_9BACT  ali  22  149.GLKDTDTIYRQRYLDLLMN---EESKKVFQFRSDFIRAIREFYWQENFSEVETPTFLH-QATGATATPYKTH----NNALDIDLFLRISHELPLKELIVGGMEKIFEIGKAFRNEGVDPSHLPEHTHLEHYCAYWNFEDNIKFTERMFDYIDFTTPWPRVNFIEMLKKDTGLDIMEYDDAKLLKDIKAKKIEFEDMDDMSLAGLVDNLYKKVSRPKL--VGPVILYHYPKYLQPLARVNDDDNNIVDQFQMVVNGWEIVKAYSELVDPIDQKERFDGQKSAKAGGEAEVMEGDDEFITALEHGAPPISGWGMGIDRTVAILTGQNNLRDVVLFPLLR. 498
134 0.000e+00UniRef50_A0A2P4TFC3 Uncharacterized protein n=1 Tax=Bambusicola thoracicus TaxID=9083 RepID=A0A2P4TFC3_BAMTH  ali  24  224FGLKDKETRYRQRYLDLILN---DYVRQKFITRAKIVTYIRSFLDELGFLE---------------------------------------------MLVVGGLDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYRDLMEITEKLAYEIDFTPPFRRISMVDELEKTLGVKFPSAETEETRRFFDDLCAVRNVECPPPRTTARLLDKLVGEFLEVTCINPTFICDHPQIMSPLAKWHRIHRGLTERFELFVMKKEVCNAYTELNDPFQQRQLFEDQAKAKAAGDDEAMFIDENFCTALEYGLPPTAGWGMGIDRFTMFLTDSSNIKEVLLFPAMK. 540
135 0.000e+00UniRef50_A0A0C1QXW9 Lysine--tRNA ligase n=5 Tax=Clostridiales TaxID=186802 RepID=A0A0C1QXW9_9CLOT  ali  26  156.GIQDMDLRQRHRSLDMIMN---SEVKERFIKRSRALSYIREFMNSIGFFEMETPIL-DTKYGGGEAKPFVT----YVNALSSDVYMNVSPELYLKRLMVGGVDRVYTIGRSFRNEGIDRTHYPEFTLFECYMAYADYTDMMRLMENLYEYIDFKAPWRRARMCDLVKEDTGIDVEFLSREEIVKIVEERELLSEDIKDMTKGDLIMTIFDEYSASKL--VEPTFVIDFPVETSPLCKVHRKNSELIERFEPYAYGVELGNAYSELNDALRQRVLLHDQADKLRAGLETASPMDEEFAVAIDVGMPPAGGLGIGIDRMIMFLTGSNSIKDVIAFPLVK. 505
136 0.000e+00UniRef50_A0A0G1Y8G2 Lysine--tRNA ligase n=5 Tax=Candidatus Peregrinibacteria TaxID=1619053 RepID=A0A0G1Y8G2_9BACT  ali  26  139.GIADQETAWRQRYLDLMSNR---ETYDRFLFRSLFLRRLREFYWAHDFIEVETPVLTNA-ASGALATPFVTH----HKGYDLDVFLRIAAETFQKECLVGGFDRTFEVARCFRNEGLDPSHLQDFTMVEHYAAYWDYEQNMAFTEEMLSAVDFKPPWPRASIAELIQHDCGIDIRTATADDLRKEITRKKIHLEVDASLERGNLIDQLYKKVSRPKI--VQPTFLTNHPTDLSPLARLNDDDPAITDRFQLVVGGWEIVNAYSELIDPVDQARRFEEQAKARAKGDTEAHRKDDEFVKALEYGCPPCSGLGMGIDRIVALLTRQTNLRDVVLFPLMK. 490
137 0.000e+00UniRef50_A0A2G6DPY6 Elongation factor P--(R)-beta-lysine ligase n=1 Tax=Pasteurellales bacterium TaxID=2044943 RepID=A0A2G6DPY6_9GAMM  ali  55  22.....................KPSADIETLVKRASILKQIRAFFENHGVLEVETPILSEFGVTDLALNTFNTDFKPPFGE-SKKLYLSTSAEYAMKRLLSAGIGPIYQISKVFRNEEQGQFHNPEFTMLEWYRPHFSMFRLIDEVEDLMQAILDCNKFEKISYQSIFQKVLKIDPLTTSKLELVSLCQQEGLV--CDESDNRDTLLQFLFTTKIETVIGKDAPCCVYHFPSSQAALARISTEDHRICERFEVYYKGVELANGFHELIDAGEQRRRFESDNFVRQKKEIEVMPLDERFLSAMEKGMPDSSGVALGLDRLIMIALEKEKIKEVLSFDIERA 336
138 0.000e+00UniRef50_A0A1V5TQE2 Lysine--tRNA ligase n=24 Tax=cellular organisms TaxID=131567 RepID=A0A1V5TQE2_9ARCH  ali  26  139.GLQDEEERYRKRYLDILMN---KDVKEMFVKKAKFWNSIRNFLLEKGFLEVETPVL-ESSAGGAAAKPFITH----HNALDLDVYLRISGELWQKKLMVAGYEKTFEIGRQFRNEGMDMEHLQDYTQMEFYWSYANYQDGMKLVEEMYKKVSKEVFGKMKFDIHGYKVDFSKKWEIYDFETLIKKETKXXXXXXXNPSVDKWRLVDQLWKYC---RKKISGPGFLTGQPVELSPLAKRNPEDKRKVEQFQVIIAGSEVGNGYSELNDPLDQEERFKEQSKQKEAGDEESMEHDKGFVEALKYGMPPTCGFGLS-ERLFAFLMG-KTLRECVIFPLMK. 478
139 0.000e+00UniRef50_L0B0U6 Uncharacterized protein n=1 Tax=Theileria equi strain WA TaxID=1537102 RepID=L0B0U6_THEEQ  ali  28  166.GLKDVETRYRQRHLDILVN---KDVHNKLLIRSECIHLIRTYLHKRGHIEVETPILQRFPS-GALANPFSTK----HNAMDMEMFLRIAPELYLKRLIASGFDKVFEIGKCFRNEGISACHSPEFTMVEIYEKLANMDDMIVLVENLVQYLVKQIKWKQITMRDLVLEYARIDVYSSSLPDLESFC--ISQNIEVPKNASWGTLVNALFKNKVEPHL--ILPTHVSYLPLDISPFVYSNDDMPKTARRFESYWMGMEIANGCTEECDPKKVLKNIKENFQ------------DKDFINALEYGMPPTAGVGIGIDRLVMVLANAQNIKDVQTFPLLR. 491
140 0.000e+00UniRef50_O74858 Lysine--tRNA ligase, mitochondrial n=3 Tax=Schizosaccharomyces TaxID=4895 RepID=SYKM_SCHPO  ali  26  180..LTNYEKRFEKRFVDMMSN---TKSLELLEKRYRIIESIRKFFSERGFLEVETPILSHHF-GGATARPFITSDIH-----KLPLTLRCAPELWLKQLVIGGMNRVFELGKNFRNEGIDATHNPEFTSCEAYCAYLNLEGMKKLTEELIRFICLTINFEVIEFIPALQKELNVELSPLDNSENCRKQIFKRCEIMLPKTCTVAHLLDKLFDSLV-LKYNTSSPKFVINHPEVMSPLAKSDIKEQRISKRFELYIGGYEICNAYEEENDPVAQYHKFQAQKYDRLQGDDETPAPDSDFVHALEYGLPPTAGWGMGVDRLVMLMTGQSKISEILPFGSLR. 529
141 0.000e+00UniRef50_A0A117E639 Lysine--tRNA ligase n=22 Tax=Actinobacteria TaxID=201174 RepID=A0A117E639_9ACTN  ali  28  737.GLTDPEAKVRLRALDLVTS---PAARDTIRSRAAVVQALRSGLLERGYLEVETPMLQQ-IHGGANARPFTTHI----NAYDLDLYLRIAPELYLKRLCVGGLEKVFEMGRTFRNEGVSPKHNPEFTMLEAYQAYADYDVMLDLTRELIQEFDISGEWPVKTVYGAISEALGEEVGADTELSVLRRLCDRVGVPYGDGD-GRGDVVLEMYERLVEERTLL--PTFYKDFPTDVSPLTRQHRADPRLAERWDLVAFGTELGTAYSELTDPVEQRRRLTEQSLKAAGGDPEAMELDEEFLEALAYAMPPTGGLGIGVDRLVMFVTGL-SIRETLPFPLVR. 1078
142 0.000e+00UniRef50_A0A1L7CEA9 Lysine--tRNA ligase n=3 Tax=Corynebacterium TaxID=1716 RepID=A0A1L7CEA9_9CORY  ali  26  721.GLSNEETKVRQRYLDLIVN---EDARRQVEARSAIIHSLRSTLMGEKFLEVETPLL-QTIHGGANARPFKTHI----NAYDMGLYLRIAPELYLKRLMVGGVDRVFEIGRNFRNEGADATHNPEFTMLEAYAAYGDYNSMRELTRELIHSIDLADPWRVVTVHGGIAEATGRNITPDTSKEELIELAAEYA-VPVDPEASRGAIVIELHEHLAER--FAIAPTFFCDFPTDVSPLTRQHRTDPRVAEKWDLICFGAEVATAYSELIDPVIQRQRLVNQSLLAAGGDPEAMEVDEDFLLALEYAMPPSGGMGMGVDRLVMMLTE-KNIRETIIFPLVK. 1067
143 0.000e+00UniRef50_A0A1Q5Q2K9 Lysine--tRNA ligase n=1 Tax=Actinomyces nasicola TaxID=208480 RepID=A0A1Q5Q2K9_9ACTO  ali  28  717.GLTDPEAQVRLRHIDLAIN---DATRETLKARSTILASLRKTLMDEGYLEVETPILQP-IHGGANARPFTTHI----NAYDLDLYLRIAPELYLKRLCVGGVDRVFELGRTFRNEGVDFSHNPEFTILEAYRAHADYIDMLHTIRRMIQNAAIAVHWPIVPIYDGISEHLAPITTETSVDDLQVICDALDIAYRPD--WDHGDIVLELYEHLVEDR--TTSPQFNIDFPLSVSPLTGMHRQNPKLAERWDLVAWGVELGTAYSELTNPIDQRDRLTEQSVKAAGGDPEAMELDEDFLSALEFGMPPTGGLGMGVDRVVMLITG-KSLRETLPFPLVK. 1066
144 0.000e+00UniRef50_G4QML9 Elongation factor P--(R)-beta-lysine ligase n=4 Tax=Glaciecola TaxID=89404 RepID=G4QML9_GLANF  ali  47  1..............MTILHQWQPSGSIDSIVKRAQILSKIRNYFVNQNVLEVETPTISPSTVTDVHLEAMKTIHTNPQSVEKTHLFLQTSPEYYMKRMLSAGFPSIYQITKCFRDDEVGRFHNPEFTMLEWYRLDYSMHELIEDVDSILKLVLDTPVCEKISYRELFAVHLDLDIKNDSDLKLVSICKQCGFENIVPSQTQRNMLLQLLFCEEIESKIGLDRPVAVTHFPASQASLAKIDPVDPWLSLRFEIYYKGIELANGFEELTDVKEQKARFTADNEQRKECGLEIKPEDTKFLDALEFGLPACSGVALGIDRLIMLALGKKHISEVLTFDF... 329
145 0.000e+00UniRef50_A0A1S8Q7X2 Lysine--tRNA ligase n=47 Tax=cellular organisms TaxID=131567 RepID=A0A1S8Q7X2_CLOBE  ali  25  158.GIQDSDLRQRHRSLDMIMN---SDVKERFIKRSKAITAIREYLNNMNFIECDTPVL-DTKYGGGEAKPFKT----FVNDLDCEVYMNVSPELYLKRLIVGGIERVYTFARSFRNEGIDRTHYPEFTLMECYMSYADYEDMMRIMEGIYEYIDFKAPWKRETMCNLVKQDTGIDVENFTKEEIISKIKENSLLLEEQNEGSKGELITNLFEAYSEKKL--IQPTFVIDFPKESSPLCKVHRENPDLIERFEPYAYGVELGNAYSELNDPLRQRILLHDQAEKLRGGLETASPMDEEFAIAIDTAMPPTGGLGIGIDRMIMFLTGSNTIKDVIAFPLVK. 507
146 0.000e+00UniRef50_V4LL92 Uncharacterized protein (Fragment) n=5 Tax=Eukaryota TaxID=2759 RepID=V4LL92_EUTSA  ali  25  34...................................................VETPML-HMIPGGAAARPFMTD----HNDLNIKQYMRISPELHLKQLVVGGLDRVYEIGKQFRNEGIDLIHNPEFTTCEFYMAYADYHDLMEMTEDMPIEIDFTPPFRRIDMIADLEKMANLNIPKYLSEEANKYLIDACARFDVECAHPMTSARLLDKLVGHFLEGTCVNPTFIMNHPEIMSPLAKSHRSIKGLTERFELFINQHEICNAYTELNDPVVQRQRFADQLKDRQSGDDEAMAMDEAFCTALEYGLPPTGGWGLGIDRLAMLLTDSQNIKEVILFPAMK. 340
147 0.000e+00UniRef50_R6CUP7 Lysine--tRNA ligase n=7 Tax=Firmicutes TaxID=1239 RepID=R6CUP7_9CLOT  ali  24  139.GLNDTELKYRQRYVDLISN---EESRQVFLGRSKLYAFIHKFLGENGFLEVETPIL-QTAVCGAAAKPFYTH----HNALDIDCNLRIAPETYLKQCVAAGYDRVYEIAKCFRNEGMDTQHLQEFTQVEWYASYWNFEDLMELVGTTKIEYFGKDSWDKINYVEEMRKIFGFDFLEVEDPKELKDKKGLFTYEELEEYKSVSQIVDFVYKKKIREGI--VQPTIMYNYPSMLIPLARRNDKDDRIIDVFQVVACGSELCKAYSELVNPITQRKTFEDQLKAKAQGDDETMDLDENFMLAMEQGMPPISGLGFGIDRLMMIIYNQPSIRDVVLFPLMK. 486
148 0.000e+00UniRef50_A0A177WRQ6 Uncharacterized protein n=3 Tax=Fungi incertae sedis TaxID=112252 RepID=A0A177WRQ6_BATDE  ali  26  106..LEDENIRYRQRYLDMLVHR---STVDLFLKRSKIIRTIRSFFDTREFVEIETPVLS-LMAGGANAKPFTTR----MDVMNLDLQMRIAPELYLKQLVIGGIDRVYEIGKQFRNEDVATKVNGS-TIVEWETADGQIHQI-----------DFSQPFKRIEIIPELEKALGVTLPNVNDQSSMETLLQLCNNIVVQKPFTLPRILDKLISELIEPK--CIDPTFVVGHPVCMSPLAKSGE-NPELADRFELFVGTKELANAYMELNDPAEQRRRFASQRMARDQGDVEAQPMDESFCLALEYALPPTVGWGLGIDRFCMLMTGTKRIKELIAFPILK. 420
149 0.000e+00UniRef50_E5XQK4 Lysine--tRNA ligase n=21 Tax=Actinobacteria TaxID=201174 RepID=E5XQK4_9ACTN  ali  28  759.GLTDPEAKVRLRHVELMTNPQ---ARRALSVRGSVLRALREQLWGEGFLEVETPVLQR-VHGGANAEPFRTHI----NAYDMPLYLRIAPELYLKRLLVGGMERVFEIGRVFRNEGVDGTHNPEFTLLEAYQAHSDYRGMRDLTEQMLRACARAVPWPMIPMLTAVSHALGDEVDENTVPKLRQHLASRGFEFRPD--WDAGQLLLELYERLVEHRTTT--PTFYSDFPLSVSPLTKQHPDRPAITQRWDLVIGGMEVATAYSELNDPVEQRRRLQAQSAAAAGGDPEAMELDEDFLEALEYAMPPTGGLGVGVDRIVMLLTE-RNIRETLAFPLVK. 1093
150 0.000e+00UniRef50_A0A0G1YXX9 Lysine--tRNA ligase n=8 Tax=Parcubacteria group TaxID=1794811 RepID=A0A0G1YXX9_9BACT  ali  27  139YGLEETEVRLRERYLDLLLN---PETRELFRKKDVFWNAFRDILKKEGFLEVELPVL-EALPGGAEAEPFRTH----HNALDTDFYLRISLELPLKKLLVGGYEGVFEIGRIFRNEGIDKEHLQDYTQLEFYWAYRDYRDLMKLLERMYKEINWGKKWGVVDYVDAFREANKLDPLSATEADLRKRAAELRL--EFDKTMGKGRLIDLIYKKTVRPKL--IEPCFLIDPPVEIEPLAKRSERDPRRVERLQIMAAGTELGKGFSELNDPLDQRARFEEQMKLRAAGDKEAQFLDEDFLAALEYGMPPAAGFGVS-ERLFAILMG-KSVRETVFFPLMR. 479
151 0.000e+00UniRef50_A0A1U7LKS3 Lysine--tRNA ligase n=1 Tax=Neolecta irregularis DAH-3 TaxID=1198029 RepID=A0A1U7LKS3_9ASCO  ali  27  231..LKDPEKRFSNRHVDFLVNPQ---SMNSIRIRSLVLNYIRHYLLQKGFVEVETPVLAES-SGGANALPFETSSRAVGD--DVPLHLRISPELWLKRLVIGGFDKVFEIGKSFRNEGIDATHNPEFTTCEFYQSFAGLDELMDMTEELLIGINNTVNFNRLNFIPALEEAMNRPLPDLTSPTIVEELVSLFLHIPLPRLSTAPRLLDKLSSKYLEPQ--CQDPTFIYNIPALLSPLAKSSPTN-TIARRFELYIHAQELCNAYEEENNPLLQRHKFQMQQHDRETHDLETQTVDESFITALEWGLPPTAGWGLGIDRLCMLITAQLRINEVLPFGGLK. 574
152 0.000e+00UniRef50_A0A1N5NCV5 Lysine--tRNA ligase n=2 Tax=Actinobacteria TaxID=201174 RepID=A0A1N5NCV5_9MYCO  ali  27  270FGFTDPEARLRRRSVDLIVN--PEESR-RLRVRAQTIRAIRRTLDADGFLEVETPMLN-TVHGGASARPFKT----FINAYGVDLTLRIAPELYLKRLVVGDMGPVYELGRDFRNEGADATHNPEFTVLEAYQPYADYDAMRLLTERIIKSAARAVFWPVVSVLDAVSEAVGRRIDLDTDFEVLMRLAAEHEIHVRDD-MGPGAVIEELYGELVEAR--TVRPTFYRDFPVETSPLAGPHRSIPGLAERWDLVINGTEMGTAYSEMADALEQRRRLTEQSLKAATGDPEAMQIDEDFLAALETGLPPTGGLGIGIDRLIMMLTDAP-IRGVLAFPFVR. 624
153 0.000e+00UniRef50_A0A2D6TWI3 EF-P lysine aminoacylase GenX n=6 Tax=unclassified Alphaproteobacteria TaxID=82117 RepID=A0A2D6TWI3_9PROT  ali  36  10........................EKMPYLLKRQQIIKAVRKFFDARNYWEVETPILQISPCMDTHIHAFKTGYKDISLEEKQGFYLHTSPEFGMKKLLSAGCERIYQICHVFRNTDNTKQHSPEFTMIEWYQAGLSYEGLMDEACALIDACALAVEWKRISVRECFTQYAAIDLDMYLHDLGGFKAAVRAKGLHVADDDEWDDVFHRVMLEYVEPHLGHDQPTVLYDYPACMAALARLKPQNPDYAERFEIYINGLELANGFGELTDAEEQRRRFVHEMDEKERLYGERYPVDDGFIAALEQGLPPCSGIALGVDRLVMALTGAQHINDVLWHP.... 329
154 0.000e+00UniRef50_A0A0G1BDE5 Lysine--tRNA ligase n=19 Tax=Parcubacteria group TaxID=1794811 RepID=A0A0G1BDE5_9BACT  ali  31  136.GLKDVEERYRKRYLDLLMN---KEAKEKFLVRSNIIKKLRNFLDERDFDEFETPML-QAISGGATARPFKTHL----NALDMDLYLRVAPELYLKRLLVGGFEKVYEIGRNFRNEGMDAAHNPEFTMLEAYIAYKNSDYLKTFLQELFRYLGFDQPWQEKDYDDLIKKYGDFNIAKKNL----------------------------------------IQPTFVNGFPAETLPLSKKLEKNPKKADAFQVIIGGLELVKAFTEQNDPIEQRERFEEQEKLREGGEEEAQRLDEDFLESLEYGMPPCAGFGLGIDRLAMLLTNSHTAREIILFPTMK. 424
155 0.000e+00UniRef50_A0A137NZT8 Lysine--tRNA ligase n=1 Tax=Conidiobolus coronatus (strain ATCC 28846 / CBS 209.66 / NRRL 28638) TaxID=796925 RepID=A0A137NZT8_CO  ali  25  170.GVKEVSVKLRNRTLDLLSDQK---SFSTLKTRFEVLQYLRQYLTTREFLEVETPILS-AQSGGANATPFLTTSK----ALNQDLQLRISPELYLKQLICSGFPKVFELGKVFRNEGIDATHLPEFTSLEFYSIYWNLNDLIKFTENFLINFIFNENFDQIQVIPTLEEKLGEKLPDLYGPVDPFIDLCKRNNVPIKAPFTVNRLIDQMISHYIEP--MCQNPTFLIGHPITMSPLAKHLPNKPLESARFELFINGAEFINAYEELNDPLVQKERFLQQLKDKELGDKEAQEIDTNFIESLMYGLPPTGGWGLGVDRLIGLVTQSKSIRDTVAFPMV.. 514
156 0.000e+00UniRef50_A0A2E7R142 Lysine--tRNA ligase n=3 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2E7R142_9CHLR  ali  30  159YPIVDEDIRSRQRYLDLMAN---SSARDLAITRSRIVRSIRNFMHDRGFIEVET-SMFPDVPGGANARPFKT----VSNALDRELSLRISLELPLKKLLVGDLPPVFEIGRVFRNENVDRDHSPEFTMMESYEPYTDYMGVADMVEGMFHHIARTPPFIKSTYRELMVSFADGFDDRNYQTNEDIMEKARSMNVTTDNSMSRGKLLDRIFSEKVEPNL--IQPTFVMDYPVDSTPLAKKKIDDHSLVERFELFIDGREIANAYSEXXDPVDQRSRMI-QEQDXGIEDDEIPPIDEDFLXAIDHGMPPAGGIGLGIDRLIMLYTGSTNLREVILFPTLR. 515
157 0.000e+00UniRef50_UPI000CEFCD23 lysine--tRNA ligase-like n=1 Tax=Terrapene mexicana triunguis TaxID=1415176 RepID=UPI000CEFCD23  ali  27  183...................................................VETPMMNM-IAGGAAAKPFITH----HNDLNMDLYMRIAPELYHKMLVVGGLERVYEVGRQFRNEGIDQTHNPEFTTCEFYMAYADYNDLMDITEQLLSGMVKHPPFKRVRMMEELEKVTGEKPESLDTEEAEKFLDKLCAKKGIQCTSPRTAARLLDKLVGEFIEVSCINPTFICDHPQIMSPLAKWHRSKKGLSERFELFVMEKEICNAYTELNDPMRQRELFKDQTKAKAAGDEEAMSIDENFCTALEYGLPPTAGWGIGIDRLAMFLTDSNNIKEVLFFPAMK. 491
158 0.000e+00UniRef50_A0A2M8KID3 Lysine--tRNA ligase n=10 Tax=Parcubacteria group TaxID=1794811 RepID=A0A2M8KID3_9BACT  ali  26  143.GLQDMEKRLRQRYLDLLLNQKAGE---IFKRKTLFWQSAREFLTKQGFLEVETPIL-EMVPGGAEAEPFLTHY----NALGQDLYLRISLELPLKKLLVGGLEKVFEIGRVFRNEGMDAEHLQDYTSLEFYWAYHNLADLQKIVQEFFRFIIWAKNFAQIDYFALFQKNVGLDLSNASDADLRAKIKLLKLKTGLDINKGRGRMIDLLYKKICRPKI--IQPSFLLGHPVEVSPLAKRDPQKPGRVLRLQPVAGGVELGNGFAELNDPLEQRQRFEQQMKLRQAGDKEAQILDDDFLTALEYGMPPAAGFGFS-ERLFAFLLD-KSVRETTIFPAVK. 485
159 0.000e+00UniRef50_W8JGY4 Lysine--tRNA ligase n=8 Tax=Bacteria TaxID=2 RepID=W8JGY4_9CHLA  ali  28  166.GLSDKEIRYRKRWLDLISS---EEVRQTFLKRSRIIKLIREYMDAHDFIEVETPIL-QNIYGGAEATPFTTELK----ALHSKVFLRISLEIALKKILVGGTPRIYEIGKVFRNEGIDRTHNPEFTMLEAYAMNIDYHGVMVFVERLIEHVDFKAPWIRMTMKDSLKTYGNIDVDLHGDHELRAILKERTLPESSYATASRGLLIAALFDEFVCDQL--IAPHHITDHPIETTPLCKYLRSDTGYVERFESFCLGKELCNAYSELNDPFLQRKLLEQQMEKKALNPEEYHPIDEEFLEALCQGVGPVGGFGIGIDRLIMILTDSASIRDVLYFPVMR. 518
160 0.000e+00UniRef50_I3CCM4 Elongation factor P--(R)-beta-lysine ligase n=6 Tax=Thiotrichales TaxID=72273 RepID=I3CCM4_9GAMM  ali  46  7..................LTWRSVASFEVLRARSQLYQQIRDFFVAREVWEVETPILSRASVPEPMIAPFYTHY---HAETVEPLFLQTSPELPMKRLLAGGSGAIFQICKVFRDGEAGTKHNPEFSLLEWYRPYFSLADLIQEINELLQLVLACPPVEVVNYCDVFQDYTGLHPLNTPLETL--QYATVTAGLVTHTPLDRDSCLQFLMSQQVEPFIGQTCPTVVQYFPATQAALARKCPTNPQLAARFEVYFKGMELANGFHELADPVEQRARFMEDLQRRAALNLPQHPIDENFLTALAMGLPDCAGVAIGLDRVLMLKVGVERIQQVLSFSIDNA 322
161 0.000e+00UniRef50_A0A1V5LE59 Lysine--tRNA ligase n=1 Tax=Alphaproteobacteria bacterium ADurb.Bin438 TaxID=1852792 RepID=A0A1V5LE59_9PROT  ali  30  1.................................................MEVETPILQP-ILGGANAKPFVTH----HNTLEMDMYLRIAPELYLKRLIVGGLDGVFEIGRLFRNEGLSIKHNPEFTTLEVYWMYKDYFDMMDLCEELVKEIDFSQPFERRTMASLVKEHVGIDFMAIETDEEAKEKCK--GVVEVNEADTWGDLMVRVFEERCEEKL--EKPTHVMDHPISSSPLTKTHRADKRVVERFETYINGWEIANAYSELTNPLDQYNRFKDQVNRREAGDEEANMMDEDFCTALEYGMPPTGGMGIGMDRLCMILTNSPSIRDVIAFPTMR. 297
162 0.000e+00UniRef50_A0A0E9NAJ5 Lysine--tRNA ligase n=2 Tax=Ascomycota TaxID=4890 RepID=A0A0E9NAJ5_9ASCO  ali  27  193....DLDKRMRNRHIDLMVN---QSAANALRVRSKILTYLRKFLVDRGFVEVETPILSDTM-GGASATPFITQSKVTG---KKELSLRIAPELWLKRLVIGSLDRVFEIGKCFRNEGIDATHNPEFTSCEYYQAYANLDDLIRDTEDLLSGMVAHIPFRRIEFIPALETAMGRKLPQLDDENTTESLLTKDLGIKPPSPSTPSKLLDKLASHYLEPQ--CIQPTFITHIPEIMSPLAKGSEINHRVSHRFELYVNSQEICNAYEEENDPISQRAKFTLQQSDRESGDSEIPAVDESFVHALEWGLPPTGGWGMGIDRWVMLMTGKTRIGEVLSFGGLK. 543
163 0.000e+00UniRef50_A0A1V5XQ68 Lysine--tRNA ligase n=1 Tax=Parcubacteria group bacterium ADurb.Bin192 TaxID=1852938 RepID=A0A1V5XQ68_9BACT  ali  26  138.GVQDIEKIYRHREMDLVSSR---ESFDRFKLRSIFLSNCRRYLEDSGFLEVETPILT-SVATGAAARPFVTH----HNAYDMDMVLRIAPETYLKRLIGGGFERVFETAKCFRNEGSDPSHHQEFTQIEYYVAYKDYEWNMDFTEKFLRAVLQKTFGPRYKITDLIKQKTGIDVLEFNEADLVKVMQSKNIQVEEVDKKGIGTLIDELYKHAVRPDL--IAPCFITHHTTEMKPLARRNNEDARLADSFQLVIAGWEVLNAYSELVDPIDQSERMRKQAEFRAAGDEESFELDEDYIQAMEMGFPPITGWGMGIDRIFALLTGQSNLRDIIFFPIMK. 487
164 0.000e+00UniRef50_F5XLE1 Lysine--tRNA ligase n=3 Tax=Actinobacteria TaxID=201174 RepID=F5XLE1_MICPN  ali  27  776.GLTDPEARVRMRYVDLII---RPEARETAYARATVVRSIRDSLARRGFTEVETPIL-QLIHGGANARPFETHI----NAYDLDLYLRIATELHLKRLIVGGMERVFELGRQFRNEGADFKHNPEFTSMEVYQTYGDYNSMRILTQEIIQEAATAVYWPVKTICQAVSEKLGEEVSADTPHATLLRHAER-IGLELDADIGWGPLLEEIYGELCEATTTT--PVFYTDFPKENAPLTRTHRVDPRLAEKWDLVIFAAEQGTAYSELVDPMDQRERLVAQSLLAAAGDPEAMQVDEDFLEALEYGMPPTGGMGMGVDRLVMNLTGL-SIRDTILFPLVR. 1123
165 0.000e+00UniRef50_E3B9M5 Lysine--tRNA ligase n=23 Tax=Actinobacteria TaxID=201174 RepID=E3B9M5_9MICO  ali  26  757.GFTNPEARVRQRYLDLIVN---KDSANLLRARSRGVSALRRAFEERGYMEVETPML-QAVHGGASARPFRTHI----NAYNADLYLRIAPELFLKELAVGGMDRIFELNRNFRNEGADATHNPEFTSVEAYAAHGDYNTMRVLTRELVLEVATAIHWPVVPVHEAVSQATGTTLTNTPLEEVRAVADAHDVHWA--ETMTAGEVVLELYDELVEGQTTM--PVFYTDFPLETSPLTRTHRTDPKLSERWDLVAFGAEIGTAYSELVDPVDQRNRLTEQSFKAAAGDPEAMEVDENFLAALEYAMPPTGGLGIGVDRLIMMLTG-NNIRATLAFPFTR. 1103
166 0.000e+00UniRef50_Q9Z614 Elongation factor P--(R)-beta-lysine ligase n=15 Tax=Enterobacterales TaxID=91347 RepID=EPMA_BUCAP  ali  50  5....................WKPSASIKDLMKRSKIIADIRSFFLKKNIMEVETPILSQSGVTDVNLMPFITNYFSFDNIKKKNLWLITSPEYHMKRLLSAGSGSIYQICRSFRNQEFGQYHNPEFTMLEWYQLSCSMEKMIEEIDFFFQKILNFNKADKISYQEVFMKFLKIDPLSTSLSELFQCYKKFNLKNLIYLENDLNQLIENIFTLQIQPFLGKEKPLFVYHFPSEQACLASINKKDSRVSERFEIFFKGIELGNGFHELTDYFEQRKRFIKDNRKRCDMNLPEQKIDDYFLDAIHHGLPTCSGVAIGLDRLIMIALNKNSIDQVMSFSFERS 324
167 0.000e+00UniRef50_A8BEL5 Lysine--tRNA ligase n=6 Tax=Giardia intestinalis TaxID=5741 RepID=A8BEL5_GIAIC  ali  25  210..LTDINARFRQRYLDFIINNTG----QKIVQRSGIINFIRRFMDQRNYLEVETPML-QTVHGGAAAQPFVCK----SNDLGHDVYLRIAPELFLKRLVVGGLNRVFEINKNFRNESSDQTHSPEFTMMEAYSAYDDLEDMCDLIEGLVSRLVRWYNWRRVPIIETLEQLLSIKFPRLDGEECNGFLVSLLERLDLECKPPLTTARMLDKLVERYLETLTPNPIFLMYHPVLMSPLAKPHRSIPELAERFEVFISCFEVSNAYTELNNPIIQRENFQAQIRDKAAGDMDAMEYDEDFCKCLDYGLPPTGGIGIGIDRLVMLLTNSSTIREVIAFPLM.. 571
168 0.000e+00UniRef50_A0A2M7BT58 Uncharacterized protein n=1 Tax=Candidatus Roizmanbacteria bacterium CG03_land_8_20_14_0_80_39_12 TaxID=1974847 RepID=A0A2M7BT58_  ali  24  2..........................RERFNTRTRLLRHMREYLDGLGFWEVETPIF-HPQYGGANAKPFTTHY----NALGQDMYLRIAFELYLKRLISGGYERVYEIGRDFRNEGFDRSHSPEFTMIEWYEAYVDYHRVMDVTEGLFKHLAQKLNWPRITMNDIMKKELGIEVETASQESLLAYCTEHSIGLIGGE--TKGQIIFAIFEHSIPEKL--IEPIWIIDYPEDVSPLSKNHRSKPGWVERFEGYIGGKEICDGWSELTDPMIQRQRFENDQKASRKDKSEAQQVDEDFLTSMEFGMPPMGGIGIGIERLVMFFTNTWAIREMMLFPTLK. 321
169 0.000e+00UniRef50_J9IEN6 LysyltRNA synthetase putative n=1 Tax=Oxytricha trifallax TaxID=1172189 RepID=J9IEN6_9SPIT  ali  27  195..LKDSESRFQKRYLDLMANN---DLKTFFFKRSQIIKFMRNYLEERGFLEVETPILN-GQAGGALAKPFETESQV----LRQKLELRIAPELFLKKLIIGGFDRVYELGKVFRNEGIDGTHNPEFTSLEFYMAYADYRDLITMTEDMLREGAGQEVHDVKTLEMNFKDELGIDPLPTLRKHLIPKVFQLNEKGLDPLKLNDKQLIDKLIEHHIESK--CIQPSFITNHPMIMSPLAKTHPGAEFLSERFELFVNKKEVINSYSEQNDTDMQRKGFSFQTTMGQEGDEELHRSDEDFLEALSYGMPPTAGWGCGIDRLCMLMLGLNQIREVILFPMFR. 546
170 0.000e+00UniRef50_A0A1Z5I6S2 Elongation factor P--(R)-beta-lysine ligase n=8 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A1Z5I6S2_9GAMM  ali  54  1..................MNWQATLSWKNAQKRAQILQQIRQFFAERQVVEVETPALSQGTVTDVYLDAFTCQYSFLADSTSTSLYLQTSPEFHMKRLLACGYGCIFQIAKAFRHEESGRNHNPEFTMLEWYRIGFDQFDLMHEVAELLQVVLGGNRALFSSYQDIFMQTVAVDPLTVNFAELVEVLNKYDKSADWIEMQDTDLLLQFIFTELIEPTIGINQPQFIYDFPITQASLARVSPEDSRVAQRFECYYHGIELVNGFNELTDANEQQIRFEQDNAKRAAQGLSTRPIDKNFIAALTHGLPQCSGVALGIDRLVMLALDIKKISEVQSFSIERA 325
171 0.000e+00UniRef50_A0A2V6SHX5 Lysine--tRNA ligase n=1 Tax=Candidatus Rokubacteria bacterium TaxID=2053607 RepID=A0A2V6SHX5_9BACT  ali  33  145................................................FVEVETPTM-QAIPGGAAARPFATH----HNALDLSLYLRIALELYLKRLVVGGLDRVYEIGRIFRNEGVSTEHNPEFTMLEFYQAYADYEDLMVLTESLFGDLAQRPPWRRLAYLEGVAGALGLPPAALADRDTVSAAAERTAAARGVDPRGWGWMWKDVFDTFVEPDL--VQPTFVVDFPTALSPLAKQKRDDPTLVDRFELFIGRLELANAYSELNDPHEQRRRFEGQLRARAAGDEEAHPLDEDYLRALEYGLPPTAGEGIGIDRLTMLFTDRPSIREVILFPLLR. 452
172 0.000e+00UniRef50_Q7VEV7 Lysylphosphatidylglycerol biosynthesis bifunctional protein LysX n=609 Tax=Bacteria TaxID=2 RepID=LYSX_MYCBO  ali  27  817.GLLDPEARVRTRYLDLAVN---AESRALITARSSVLRAVRETLFAKGFVEVETPILQQ-LHGGATARPFVTHI----NTYSMDLFLRIAPELYLKRLCVGGVERVFELGRAFRNEGVDFSHNPEFTLLEAYQAHAGYLEWIDGCRELIQNVDISGIWPVRTVHDAISEALGERIDADTGLTTLRKLCDAAG-VPYRTQWDAGAVVLELYEHLVECR--TEQPTFYIDFPTSVSPLTRPHRSKRGVAERWDLVAWGIELGTAYSELTDPVEQRRRLQEQSLLAAGGDPEAMELDEDFLQAMEYAMPPTGGLGMGIDRVVMLITG-RSIRETLPFPLAK. 1170
173 0.000e+00UniRef50_A0A1Q5Q0B2 Lysine--tRNA ligase n=34 Tax=Actinobacteria TaxID=201174 RepID=A0A1Q5Q0B2_9ACTO  ali  25  164..LSD-EERVRRRYVDLVT---RPAARDMVRTRSAVVKSLRKTFDELSFIEVETPML-QVVHGGAAARPFVTH----MNAFDMELYLRIAPELFLKRAVVGGIEKVFEINRNFRNEGADSSHSPEFAMVEAYEAYGDYRTMAILTRNLIQEYDLSGEWAELDLYTSLSEAVGEEIPATDRAKLEAIAEAHEIGLA--SHYTPGKIVEEIWEELAGSKLY--EPTFVMNYPVDTSPLVRGHREREGVVEKWDLYVRGFELATAYSELVDPVIQRERFEQQALVAAAGDPEAMVLDEDFLQAMEYGMPPSGGMGMGLDRLLMALTGRG-IRETILFPLVK. 504
174 0.000e+00UniRef50_N0BI26 Lysine--tRNA ligase n=1 Tax=Archaeoglobus sulfaticallidus PM70-1 TaxID=387631 RepID=N0BI26_9EURY  ali  28  144.GLEDIETRYRQRYLDFIMN---EESRETFFLINKVIHLIRNYLNDNGFIEVYTPILQP-VYGGAFARPFET----YHHFLEEKMYLRIAPELYLKRLLVGGFEKVYEFAPCFRNEDVDPLHNPEFIQLEFYWAYIELSQLMDFLEKMFEEVVFKRPWKKMRMVDAIKEFGGIDVEKMSDDELFNHAKELGIEEERRG-----EIIEKLFDYYAKDKI--VNPTFITHFPVDISPLAKKAD---GYADRMELYIAGMEVANGFSELNNPIEQYMRFKEEEELRKRSDKETMPMDKDYIRALEYAMPPASGVGIGLGRLFMILGNKRTLREVIAFPTL.. 481
175 0.000e+00UniRef50_A0A0G0MRD3 Lysine--tRNA ligase n=1 Tax=candidate division WS6 bacterium GW2011_GWF2_39_15 TaxID=1619100 RepID=A0A0G0MRD3_9BACT  ali  25  153.GLQDKEAKFRQRYLDLIMD---PTKKDKFVSAAKILFAIRSFLNDRGFLEIKVPVLQP-LYGGTNARPFST----YMNALGTDFYLAIAHELYLKRLITAGFENVYNMTGYFRNEGIDRTHNPEFQMLETMTAYKNYEYNMELLESLYKHVAKNVMWNKIMMIDAIKKYAGVDFDRITVQDAHKTLDELGYQGTKPD--TIGECMKEVFELKVEHQL--IQPTIVYGHPVEISPLAKRMTTDPRFVERFEVFIGGVEQGDNWSELNNPVELFERFKEQSLSKKKESDSAHPMDIEFIETMEYGMPPTTGLGPGIERFQMLFTESEYIDDVIFFPLMK. 496
176 0.000e+00UniRef50_A0A2H6AAB4 Lysine--tRNA ligase n=1 Tax=bacterium HR35 TaxID=2035430 RepID=A0A2H6AAB4_9BACT  ali  25  134YKVRDEELLVRHPYLKTI---FYDDERLTFYYRFRLLEELRKILWQEGFIEVETPILQTH-YGGALARPFITYLE----ALKEKLYLRIAPELYLKKMIVGGFEKIFEIGKNFRNEGIDREHNPEFTMIELYWAYQNREGLMKFTQKIIQELVRRYNWQVLKYTEVIKQATGLDYFQSSLDDFLKIAKKEKIEFN-PKIINKGKIVDEIFKKLIRPKL--WEPTFLIDHPKEISPLAKSHPQNPELTLRFQLYLCGFEIANAFGELNDPVDQKERFLAEAEELKKGNLEAHPFDETFITALEYGMPPTAGLGIGLDRLFTILLNKSTIKEVIYFPFVK. 482
177 0.000e+00UniRef50_UPI000C769FA9 lysine--tRNA ligase-like n=1 Tax=Eurytemora affinis TaxID=88015 RepID=UPI000C769FA9  ali  26  168..IENPTKRLSKRYRDILTN---PELRRTLVSRSNIIKFIRHFLEEREFMEVETPILGNA-VGGASATPFLT----YHKEMKLDLFMRIAPELYLKQLIIAGFDRVFEIGKLFRNEGIDASHNPEFTSCEFYMAYADYTDLMQLTQALFSELCQAHNFQRLEFLQALESALDTKLPEDSFKFLLDICTRKEIPVSAPLTVPR--LLDKLASALLEPNL--VQPTFLINHPMIMSPLSKPSPGNPDIAERFELYAGGMELCNAYTELNDPEIQRKTLLTQSGM---SDPESMLPDEGFCTALEYGLPPTAGWGCGLDRLTALLTNTTNIRETITFPLIK. 510
178 0.000e+00UniRef50_A0A1F6BVL9 Lysine--tRNA ligase n=16 Tax=unclassified Bacteria TaxID=2323 RepID=A0A1F6BVL9_9BACT  ali  28  139YGISDEEERHRKRYLDFIFN---PESKKAMDARFQITAVLRELLHKDGFLEVETPILQP-IPGGALARPFQTHF----NALDTDIFLRVAPELYLKRLLVGGFEKIFEIAKDFRNEGVDRDHYPEFTMIELYAAYWDYEMMMEAVERWLKEIAKRAGISEVRFRGKELKGFFRPWPRKKYAELIKEYAGKDVRKL------KTEEIDEVFKKKVRPNL--IDPVYVVDYPKEISPLTKARDDDPEITERAQLLIAGSEFANIFSELNDPIDQRERMEEQERRHRAGDEEASRMDEEFLEAIEYGMPPAAGVGIGIDRLAALLTDTNSIREVISFTNLR. 460
179 0.000e+00UniRef50_UPI000D70FD34 lysine--tRNA ligase n=1 Tax=Geodermatophilus normandii TaxID=1137989 RepID=UPI000D70FD34  ali  27  626.GLPDVETRYRQRYTDLAANER---TREVFRIRHTAVRAIRRHLEDRGFTEVEGPVL-QSIQGGASARPFVTH----HNALDLDLYLRIALELHLKRLIVGGMERVFEIGRVFRNEGIDTRHNPEFTLLEAYQAFADYTDMMDLTEAVVTAALGATPWPRRRFADMIAEVTGAMHPAMPVGEARAVLDRLGV--PYEAGWGPGRLMKEVYDERVQHSI--VGPVFCVDHPREVSPLARTHRDDPAYVERFELIVAGFELCNAYSEQNDAVEQLAAFEAEARAKEHGDPEAGDVDLDYVRALERGMPCTGGLGIGIDRLVVLLAGVDSIREVILFPTLR. 970
180 0.000e+00UniRef50_A0A0U1BQ72 Multifunctional fusion protein n=3 Tax=Mycobacteroides abscessus TaxID=36809 RepID=A0A0U1BQ72_9MYCO  ali  27  450.....EETRVRQRYVDLIV---RPEARQIARQRVAVMRAIRDAMHRRDFLELETPIL-QTLAGGAAARPFITH----SNALDIDLYLRIAPELFLKKALVGGFDKIFELNRVFRNEGADSTHSPEFVMLETYETYGTYDTAATMIRELIQEVADDAMWTTLEMYPSLSEALGEEIPDTPVAELWKIADRVGAEIPTDRGYGHGKLIEELWEHQVGDKMY--APTFVRDFPVETSPLTRQHRSIAGVTEKWDLYVRGFELATGYSELIDPVIQRERFVDQARLAAAGDDEAMSLDEDFLGAMEHAMPPAAGTGMGIDRLLMALTGLG-IRETILFPIVR. 790
181 0.000e+00UniRef50_UPI0002485DF2 bifunctional lysylphosphatidylglycerol synthetase/lysine--tRNA ligase LysX n=1 Tax=Corynebacterium nuruki TaxID=1032851 RepID=  ali  31  775.GLTDPETRLRNRHLDMTVN---PELSRRLRARGAVLGAIRSELGGDGYLEVETPILQKT-HGGAAARPFLTR----SNAYNMDLYLRIAPELYLKRLLCGGLDRVYELGRDFRNEGVDATHNPEFTVLEAYRTHSDYRDMMDLTRRLIQAAAAAVHWPVVSVYGALTDALTGELPSTPVEELRAIAD--IIGFDYRTEWDHGYLVEELYGDYVEDRTTT--PTFYADFPVSTSPLTRPHRSIAGVVERWDLVAWGTELGTAYTELTDPLLQRERLEAQSLLAAGGDPEAMEVDEDFLRALEFGMPPTGGMGIGIDRLIMLIVG-GSIRDVLAFPTTR. 1130
182 0.000e+00UniRef50_A0A2H0TMS2 Lysine--tRNA ligase n=35 Tax=Bacteria candidate phyla TaxID=1783234 RepID=A0A2H0TMS2_9BACT  ali  25  140FGLKDAENLLRKRYLDLMLN---PETKELFRKKNIFWQTIRNFLIKEKFLEVQTPVL-EHIPGGAEAEPFVTHY----NALDEDLYLRISLELALKRLLVGGYERVFEIGRVFRNEGMDRDHLQEYDSMEFYASYWDLEKGMEFSEKLCKEVAWEGKFPKVDYFTEFQKETGIDL-GKEISXXXXXXXXXXXXXXXXXXXXXGRMIDLIYKKTIRPKL--IQPCFLVGHPIEVSPLAKKDSQNPKKVLRFQIIAGGSELCNAFAELNDPIDQRERLESQMKLREAGDKEAQMLDEDFIEALEYGMPPAFGFGMS-ERLLAFLLN-KSIRETVIFPAMK. 481
183 0.000e+00UniRef50_A0A261EZ62 Lysine--tRNA ligase n=71 Tax=root TaxID=1 RepID=A0A261EZ62_9BIFI  ali  27  223....NEDTRTRKPYIGMIAD---PKIRDMVRNRSKAVSSLRHTFESHDFLEVETPML-QTIHGGAAARPFTTH----MNAFDLDLYLRIAPELFLKRCLVGGIERVFEINRDFRNEGVDATHAPEFTMVEAYQAYGNYDTIAALTKELIQTTAMDVFWKQISMYESLSEALGEEITPETPQEHLAQLADK-LDVERDEVENRGKLVEHLWEHFYEDKLY--EPTFVRDFPVETSPLVKGHRSKPGVVEKWDLYVRGFELATGYSELNDPVVQRERFLDQAKDSLAGDEEAGDIDEDFLEALGVGMPPAGGMGMGIDRLLIAMTGA-TIRETITFPLVK. 562
184 0.000e+00UniRef50_A0A2I1PCQ8 Lysine--tRNA ligase n=1 Tax=Kytococcus schroeteri TaxID=138300 RepID=A0A2I1PCQ8_9MICO  ali  31  756.GLVDPEAKVRQRHVDLAVS---QEARDTLRARSAVVRALREGLQDRGYLEVETPVL-QTVHGGANARPFATRI----NAYSMDLFLRIAPELYLKRLCVGGVDRVFEMGRAFRNEGVDATHNPEFTLLEAYAAHEDYRSMMDTTRELVQAAAVAVHWPVVTLHDAVSEALGGQPVGPQSTAAEMHQAARRAGVEVRPDLDAGEVALELYEELVEG--STVRPTFYCDFPSSVSPLTRGHRSTPGVAERWDLVAFGMELGTAYSELTDPLEQRARLTAQSVAAAAGDPEAMSLDEDFLQALEYGMPPTGGLGLGVDRVVMLVTG-RTVRETLAFPLVR. 1102
185 0.000e+00UniRef50_A0A2H0V6Q4 Lysine--tRNA ligase n=2 Tax=Bacteria candidate phyla TaxID=1783234 RepID=A0A2H0V6Q4_9BACT  ali  25  139.GLKDREVAYRQRYLDLIANR---ESMERFQFRSNFIKNLREFYWQKGFYEVETQTLLHS-ATGAHATPYKTH----NNALDIDVVLRISHELPLKELIVGGFDKVFELGKAFRNEGHDPSHLPEHTHLEHYCAYWNFEDNMKFTEEMIDYVDFSTPFKRINYVDLIKKDSGIDITKVDRDELLALIKKQKLEIEDMDEMGFASLVDNLYKKISRPKI--VGPAFLYYYPIELQPLARRNDDDSNIVDQFQLVINGWEIIKAYSELVDPLDQEERFKQQSELKESGDDETMEGDPEYITAMKHGMPPISGWGMGVDRMLAILTCQENLRDVVLFPLMR. 488
186 0.000e+00UniRef50_A0A0G0JKB9 Lysine--tRNA ligase n=1 Tax=Candidatus Daviesbacteria bacterium GW2011_GWA2_38_24 TaxID=1618422 RepID=A0A0G0JKB9_9BACT  ali  23  134YGLKDKEERFRKRYLDLILN---PDIRERFILKSKFWNNIRKFLLDNRFIEVETPAL-EPIPGGADARPFVTH----HFAQDIDLYLRISLELYQKRLLVGGFEKIFEIGRIFRNEGIDEEHLQDYTQMEFYWAYADNEMLIEFVEKMGHEIDWSVPWPRVNYTELLNSYWQVDIDKMSVEDLYKLAEKMQIQ--IESGLGKGRVLDYLYKKTIRPHL--IQPQFLINHPIDVSPLAKRIDKDPDKVGRMQLLAMGSELTNGYSELNDPLDQRARFEEQMALRRIGDEEAQMMDLDFVEALEYGMPPAAGFGMS-ERFFAMLMDQP-VREMVFFPTMKA 475
187 0.000e+00UniRef50_A0A0G0TW94 Lysine--tRNA ligase n=6 Tax=root TaxID=1 RepID=A0A0G0TW94_9BACT  ali  22  136YGLKDIETRLRRRYIDLITN---PEAQDLFVKKAKFWTAARNFLIDNNFLEVETPAL-EAIPGGADATPFTTH----HNALDVDYYLRISLELYQKRLLVGGFEKTFEIGKIFRNEGIDAEHLQDYLQMEFYWAYASFEDLIDFIEKYYRFIIWKNDWPKIDYFDSFKDATGTDLAKDPKINDLFKLAEKVGAKP-NKKLGAGRLIDMIYKKTIRPKI--IQPSLLINHPVLVSPLAKRKEDDPQKVERVQVLAAGTEIGNGWSELNNPIDQQERFEEQQKLRKEGDTEAQMYDRDFVEALEYGMPPAAGFGMSQ-RFFSVLVDKP-IRETVFFPALR. 477
188 0.000e+00UniRef50_A0A1I5ICA1 Lysine--tRNA ligase n=3 Tax=Anaerocolumna aminovalerica TaxID=1527 RepID=A0A1I5ICA1_9FIRM  ali  25  138.GITNIDSCFRQRYLDLIMN---KETRDRFLFKFNFIKEVRRFLEDNGYMEIETPVLIDHPS-GALARPFISH----HNALDMNVYLRIAPETYLKRAIIGGFTKVFEFARCFRNEGIDASHLQDFTMLEGYCAYYNYLDNMAFLQEMLKEIDFSGEWPIVTFRDLIYGDCGIDINQYDTAEMLIAEIERMGIETDIHMLGRGNLIDLLYKKVSRPSI--IDPTFLIEHPTSLSPLARANDDNPEVVDRFQLIINGAEIINAYSELVNPIEQKNRLMEQARLKAGGDEEAMFMDNDYITAMEYGMPPISGWGMGVDRVLQVLTGQDNIKNLIMFPLLR. 485
189 0.000e+00UniRef50_A0A0P7WQ86 Elongation factor P--(R)-beta-lysine ligase n=2 Tax=Idiomarinaceae bacterium HL-53 TaxID=1298881 RepID=A0A0P7WQ86_9GAMM  ali  42  5..................ISWRPTASIETIKARSALYQQIRAFFMERGVLEVETPVLAPCGVTEPHIANLTVTCAAVSSTFRTQ-YLQTSPEYAMKRLIAGGVGDCFEITKVFRDDGVSKRHNPEFTLLEWYRLGFTDADLMEEIVSLLNKLVSFSGVRKVTYQQAFLETLGLCPLTCSSSDLVHSFEAEGLDCRVV-MDDRNSLLDLAMSLLVEPSFPHGDLTFVTEYPSNQAALARVCEHDSRVAHRFEVFLGGLELANGYWELSDAAEQRRRFEADNKRRIELGLPEVPVDEEFLAALGEGLPDCAGVAMGLDRLLMLSLGRSNIKDVLAFPA... 320
190 0.000e+00UniRef50_X2H615 Translation elongation factor P Lys34:lysine transferase n=7 Tax=Gilliamella apicola TaxID=1196095 RepID=X2H615_9GAMM  ali  59  1..................MTWQPSASINNLLKRAKIISQVRQFFTDRCILEVETPTLSQYAVTDVHLNSFSTTFFRPDEQLGRKMSLITSPEYHMKRLLAAGSGPIYQICKCFRNEEISDFHNPEFTMLEWYRIQFDMMQMINEVDDLLQTILDCEPAERVSYQKAFQRHLNIDPLEADQATLVNAVNQLNIGIKTEEF-DKDGLLQCLFTFGVEPHIGHDKPIAVYNFPASQAALAAISSEDHRVAGRFEFYYKGVELANGFKELTNPQEQKQRFEQNNQDRLNLNLPQQEIDIELLAAMENGLPDCAGVAVGLDRLIMLALNSKKLDDVISFTFERA 324
191 0.000e+00UniRef50_A0A2E6NMB6 Lysine--tRNA ligase n=3 Tax=Planctomycetes bacterium TaxID=2026780 RepID=A0A2E6NMB6_9BACT  ali  30  146..LADPETLCRERYLHWTTD---PAARQKMVQRARIISEIRTFLDGRDFLEVTTPTIEMN-YGGAEARPFETHALSGHSA-----FLRISPELPLKRFIVGGFPRVYTICQNFRNEGIDRSHNPEFTMLEWYEAFTDYNFQMEQVEQLVSCVAEKVCGSMKIVYGGKEIDFTPPWKRTTMDEDALREEYKKRDIEPPXPYTWGHAVAGLFEALIEHTI--EQPTFVCDHPVAISPLTKKKRGDDRLVERXEPIVMGMEIGNAYSELTDPVEQQERFIAQQSLADKDGVENHPMDTDFLKAMGCGMPPTGGVGIGIDRLVMLLTDSHSIREVIAFPLMR. 487
192 0.000e+00UniRef50_UPI0008338C29 lysine--tRNA ligase n=1 Tax=Roseimaritima ulvae TaxID=980254 RepID=UPI0008338C29  ali  28  185.GLNDPDRKQRMRYADLAFN---DGVLDTFLDRTKIVKSIRRTLDDDRFCEVEGPTL-HSIAGGAAARPFMTH----HNALDMPLFMRIALELHLKRLMVGGIERVYELGRVYRNEGISVRHNPEFTMLEAYQAYGDYDTMMDLTERLICNAIYTPPFQRRTYAELFQEHAGVDP-----ADEQAVAELARSIGFDTEGKHPDVIKNEVFEEKVEDALQ--GPIFVLDYPASICPLTKRKADAPEVAERFELFICGMELANAYTELNDPDLQEELFKTQLAGMDEEDSMAH-MDHDFVRALRHAMPPAGGLGVGIDRLVMLLTGQKSIRDVILFPALR. 522
193 0.000e+00UniRef50_UPI0009F90BC6 bifunctional lysylphosphatidylglycerol synthetase/lysine--tRNA ligase LysX n=25 Tax=Corynebacteriales TaxID=85007 RepID=UPI000  ali  28  797.GLQDPEARVRQRYVDLAIN---PEIREILVKRSAVTRSLRTTLTGWGYLEVETPILQR-VHGGANAKPFTTHI----NAYDLDLYLRIAPELYLKRLCVGGVEKVFELGRTFRNEGVDQSHNPEFTILEAYEAHADYLRMLTCCRELIQAAAVAANWPVRTMHAAISAALGTEVPDTPLAELRRLCDDAAITYQ--STWDAGHVALEMYEHLVEAH--TEEPTFYTDFPVSVSPLTRSHRSVPGVTERWDLVAWGTELATAYSELTDPIEQRRRLTAQSLLAAGGDAEAMELDEEFLTALEHAMPPTGGLGMGVDRIVMLLTGRG-IRETLPFPLVR. 1143
194 0.000e+00UniRef50_A0A1Q2TR06 Lysine--tRNA ligase n=11 Tax=Bacteria TaxID=2 RepID=A0A1Q2TR06_9ACTO  ali  27  722.GIQNPEARVRLRHVDLIVNPRQ---RAMVRSRSAAIQAVRSTLLGRDYLEVETPILQP-VHGGANARPFRTHI----NAYDLDLYLRIAPELYLKRLMVGGLERVFEIGRNFRNEGADATHNPEFTMLEAYQAHADYNVMKDVMRDMVHEIDLAGPWRTVTIAEAVSTALGEEVGTDTPVAELRRHAE-SVDMPYDPKWGWGTMVQELYEHLAEGT--TVEPTFFSDFPADTSPLTRQHRHDARLAERWDLIIFGSEVGTAYSELVDPVIQRERLTAQSLAAAGGDLEAMELDEAFLAALEQGMPPSGGLGMGLDRLVMMLTGA-SIRETIAFPLVR. 1067
195 0.000e+00UniRef50_D2ZWN7 Lysine--tRNA ligase n=8 Tax=root TaxID=1 RepID=D2ZWN7_NEIMU  ali  31  2.............................................NEHYLEVETPMM-HPIPGGATAKPFVTH----HNALDIPLYLRIAPELYLKRLVVGGLERVFEINRSFRNEGMSVRHNPEFTMIEFYEAFSDYERMMQMAEDIIREVDLESPFERLTIIDAIKKYNPHYTDEQLNDAEWLKKEIVKHGESLPPSPGIGSLQLALFEGCAESKL--WNPTFIVDYPVEVSPLARASDTKQGLTERFELFVVGRELANGYSELNDPEDQAERFKSQVAQKDAGDDEAMHYDADYIRAMEFGLPPTGGCGIGIDRLVMLLTDSQTIRDVILFPQMR. 304
196 0.000e+00UniRef50_A0A0G0NBZ0 Lysine--tRNA ligase n=10 Tax=root TaxID=1 RepID=A0A0G0NBZ0_9BACT  ali  23  139YGLKDIEALLRKRYLDLMMN---QETRELFLKKTIFWKTIRTFLNNEGFSEVDTPAL-EGIAGGADARPFITH----HNALDRDFFLRISLELPLKKMLVGGFEKIYEIGKVFRNEGIDAEHLQDYLAMEFYWAYGDMEKGMDAVERMYKEIVKNVTWPRVDYFVEFKKETGIDLSEVSVEELKKKADELGIKYDTAD--GKGRMIDTIYKKTVRQRL--IQPCFLVGHPLEVSPLAKKDPNDTKRVLRFQPIACKSELGNGFSELNDPQDQRQRFEEQAKLREAGDEEAQMLDEDFIEALEYGMPPAVGFGLS-ERLFSFLMN-RSIRETVVFPPMK. 481
197 0.000e+00UniRef50_Q5Z3P6 Lysylphosphatidylglycerol biosynthesis bifunctional protein LysX n=140 Tax=Corynebacteriales TaxID=85007 RepID=LYSX_NOCFA  ali  28  780.GLADPEARVRQRYVDMAIN---PETRDVLAKRSAVVRSLRESLNSWGYLEVETPILQQ-VHGGANATPFTTHI----NAYDLDLYLRIAPELYLKRLCVGGMEKVFELGRTFRNEGVDFSHNPEFTILEAYEAHSDYIRMMHTCRVLIQNAALAANWPVKTVHGAVSAAVGTEIPRTGVAELRELCDR--VGVPYQHGWDEGQIVLEMYEHLVEAR--TEEPTFYVDFPTSVSPLTRAHRSTPGVTERWDLVAWGVELGTAYSELTDPVEQRRRLTEQSVLAANGDPEAMELDEDFLQALEHAMPPTGGLGMGVDRIVMLITG-RSIRETLPFPLVK. 1126
198 0.000e+00UniRef50_A0A087SF48 Lysine-tRNA ligase n=1 Tax=Auxenochlorella protothecoides TaxID=3075 RepID=A0A087SF48_AUXPR  ali  27  185.GLADVEARYRRRYVDMIVT---PGVTNTLRARSKTISALRRALEDRGFLEVETPVL-ETAAGGADARPFLT----YHNVMQRQLSLRIATELHLKRLVVGGLERVFEVGRIFRNEGVSSRHNPEFTSAVTGSAAITYQD---------TAIDLGAPFRRATMHSLVQEATGVDFGGFSTADTAAAIEAAQLATAIAAATSPGLVVNLLFEALVESTL--EQPTFVLDHPVEVSPLAKRHRDNPALTERFELYVAGRELANSFTELNDPLEQRARFEAQLASHXXXXDYEVALDEDFLSALEVGLPPTGGMGMGIDRLVMLLTDSPSIRDVIAFPLMK. 538
199 0.000e+00UniRef50_A0A142BJ33 Elongation factor P--(R)-beta-lysine ligase n=9 Tax=root TaxID=1 RepID=A0A142BJ33_9GAMM  ali  44  5...................NWQPSASLMTLRKRATLLKGIRQYFDEQAVLEVETPMLSGAATVDVFIDSFQVQYQPLGEGLPRKCYLHTSPEFAMKRLLAAGSGNIYSLGRVFRNGEAGGRHNPEFTMLEYYRVGMDQQGLMDDMTALLGSVSSFVEVSRISYGKVFQQYLDINPHTATLSDLNRLV--HQYVDAHLDKLDRNDCLDLLFSSVIEPDLGKESSVYVYDYPASMSALARVHTNKEGVAARFELFVNGVELANGYHELTDATEQKERFIKEQEKRLAQNYPVYPFDQNLVTALEHGLPDCAGVAIGIDRLLMLMLGKKAIADVISFDFHRA 329
200 0.000e+00UniRef50_A0A1H0KDM5 Lysine--tRNA ligase n=2 Tax=Nakamurella panacisegetis TaxID=1090615 RepID=A0A1H0KDM5_9ACTN  ali  27  751.GLTDPEARVRNRSVDLIVN---PETGAVLAARSVAVGALRTAFWNRGFREVETPIL-QSVHGGATARPFTTHI----NAYDRDLSLRIAPELFLKRLIVGGTGPIFEIGRNFRNEGADATHNPEFTSLEAYLPFADYHRMRQITTDVIREVATAVHWGVVAVHDAVSAACGTTIDPGTPADKLQRIA-LAHQVPAPDGMTAGEIVMDLYDHLVEPKTF--APTFYTDFPIETSPLTRTHRADPRLSERWDLVAFGMEIGTAYSELVDPVDQRARLTEQSLRAAAGDEEAMELDEDFLSAMEIGMPPTGGLGLGVDRLVMMLTGTA-IRSVLTFPFVR. 1097
201 0.000e+00UniRef50_C0VYH9 Lysine--tRNA ligase n=1 Tax=Actinomyces coleocanis DSM 15436 TaxID=525245 RepID=C0VYH9_9ACTO  ali  27  734.GLTDEQMKVRRRYLDLIVN---PVARERVRVRSQVIQSIRQTLLDDTFLEVETPLL-QTIHGGANARPFRTYI----NAYNLDLYLRIAPELYLKRLMVGGADRVFEIGRNFRNEGADATHNPEFTMLEAYQAYGDYNSMRELTQRIIHEVDLAQPWRVITVHQGIAEACGRDVTDTPVSELLEIAAEHGL--EVDPGISRGQLILDLHEELAEQH--TIAPTFYCDFPTEVSPLTRQHREDERIAEKWDLICFGAEVATAYSELVDPVVQRERLLAQSLLAANGDPEAMEVDEDFLLALEYAMPPSGGMGMGVDRLVMMLT-QTSIRETIIFPLVK. 1080
202 0.000e+00UniRef50_A0A1F7AWX4 Lysine--tRNA ligase n=5 Tax=root TaxID=1 RepID=A0A1F7AWX4_9BACT  ali  23  140.GLIDEEAKYRQRYLDMIMN---EGVLDRFKFRSNLLKALREFYWQEGFFEVETPTLQQN-ATGAAATPYCTR----NNAYDLDLVLRISHELPLKVAIGGGFEKVFEIGKAFRNEGIDPSHLPEHTHIEHYCAYWNFEDNMRFTEKMFNEVDFTTPWKRIDFVELLKKDSGIDITKIDVKILKAELKKKKIEIYGMENMGYSTLVDNLYKKVSRPKI--IGPIFLYNYPKSLQPLARTNDKNPEMVDQFQLVVNGWEIVKAYSELVDPIDQAERFKEQAKASADGDEEAMQGDDDYIIAMEHGLPPISGWGLGFDRLVTLLTQQDNLRDCVLFPLMKS 490
203 0.000e+00UniRef50_A0A1V0SFI4 Lysyl-tRNA synthetase n=1 Tax=Hokovirus HKV1 TaxID=1977638 RepID=A0A1V0SFI4_9VIRU  ali  21  156YSVINRDIREKKRYLDLLIDQN---NIQNFIIKQKVCSSFRNFLDSNDFIEVTTPIL-HKITGGASAKPFTT----YHNDTKQTMHMRISPELYLKQLVVGGLNRIYELGPQFRNESADKTHNPEFTSLEFYMAYNDYKKLFTFCENLISSVVLSVNKSHIVKYGDLLLDFSVPFNRLPNDELVKQLTGICNVHKIELPIPSTANKLLDKIISHFLESKCIQPTFLCDHPKIMSPLSKVHRDNNNLTERFELFVAGMEICNAYTELNDPKDQEERFKLQLQDKQNGDQEAQLIDEIFIDALFHGLPPTIGFGCGIDRFVMLLSNKQNIRDIISFPL... 500
204 0.000e+00UniRef50_UPI0008353433 bifunctional lysylphosphatidylglycerol synthetase/lysine--tRNA ligase LysX n=2 Tax=Corynebacterium provencense TaxID=1737425 R  ali  30  775.GLTDPETRLRNRHLDMTVNPQVGF---RLRARAAVLKALRGVLDADAYLEVETPVLQQT-HGGASARPFMTH----SNAYSIDLYLRIAPELYLKRLLCGGMDRVYELGRDFRNEGADATHNPEFTVLEAYRTHSDYHDMMDLTRRLICAAAIAVHWPVVSVYEAVTAALTEELPGTPVEELHRVADA--IDYPWRADWDHGHLFEELYGDFVESRTTL--PTFYVDFPASTSPLTRPHRSIDGVVERWDLVAWGTELGTAYSELTDPLLQRERLEAQSLLAAGGDREAMEVDEDFLRALEFGMPPTGGMGIGVDRLVMLIVGGG-IRDVLAFPMTK. 1130
205 0.000e+00UniRef50_A0A1R1Y2Z1 Lysine-tRNA ligase n=2 Tax=Smittium culicis TaxID=133412 RepID=A0A1R1Y2Z1_9FUNG  ali  25  215..LENTETRFRNRHVDFLVN---QEARNTIIVRSKVLKLMRKFFDDNGFVEVETPILWPSL-GGANAKPFVTSSSALGN---TDLFLRISPELFLKQLVIGGFDKVYEIGKLFRNEGIDKSHNPEFTSCEFYQAYANLSDLIKTTEDLISNIDFTPPFNRINIVEFLEKKLDTKFDDFITDKLVAIYKEKNIPLGSVNPITPSKLMDNLISIFIEP--LCINPTFLVGHPIFMSPLAKSNSNNPIVSNRFELFINGLEFANAYEELNDPDEQRSRFKLQMIDRKRNDSEALLPNVEFCDALEFGLPPTAGWGLGIDRLVSLLSKSKNLREVISFPIIK. 595
206 0.000e+00UniRef50_A0A0G0CC05 Lysine--tRNA ligase n=2 Tax=unclassified Candidatus Peregrinibacteria TaxID=1801912 RepID=A0A0G0CC05_9BACT  ali  21  156.GLKDQEALYRQRYLDLAMNRN---TMERFIFRSDLVKTLREFYWQEGFMEIETPVL-ENISSGATAKPFITH----HNALDIDVYLRIAAELWQKMAIGGGMEKTFEVARCFRNEGIDPSHLQEFTMIEHYAAYWNFEENMRFTERMFEYFDFKAPWPRKEFVKLIEENCGIDVLKTTDPKLLDEIKKKNIQIEDSENLGYGGLIDALYKKVVRPKL--IQPCFVIKHPADMKPLARKNDENEMICDTFQLLVNTWEIINAYSEIVDPVDQRKRFEVQALAKAGGDEEAMMMNEEYLLAMEHGFPPISGWGMGIDRLVALLTEQDNLKDVVLFPLLR. 506
207 0.000e+00UniRef50_A0A2G9M9U8 Lysine--tRNA ligase n=1 Tax=Candidatus Woesearchaeota archaeon CG10_big_fil_rev_8_21_14_0_10_37_12 TaxID=1974463 RepID=A0A2G9M9U8  ali  28  162.GLRDEEVLYRQPELRMIVD---SDAREVFARRSRVISSMRSVLEEAGYIEIEIPTLQP-VYGGASARPFVTSV----NALDLEVYLSISPEIYLKRLMVGGFDGVFFIGKSFRNEGIDKSHHPEFTSMECYKAFWDYNDLMNFTERMVQELDFSAPWRRVRMSDMIKDEIGVDVEQMDESELRTAVQQVYLSIDNSYGVSWGNMVLGLFESYVEKTI--VQPTFVIDHPRESSPLCKLHRGDERFIERFEVFVYGMELANAYTELNDPVLQRRLLEDQERSSAAGDLEAQRMDEAFCQAIEYGMPPTAGLGIGVDRLVMLVTGRTRIKDVIPFPLVR. 521
208 0.000e+00UniRef50_UPI0009FD6E2B lysine--tRNA ligase n=1 Tax=Azospirillum halopraeferens TaxID=34010 RepID=UPI0009FD6E2B  ali  32  146.GLRDTEIRYRRRYLDMLAT---PETVRTLRTRSAVVSALRRALETGDYLEVETPML-HGVPGGATARPFRTR----HNALGREMHLRIAPELHLKRLLVGGLERVFEMNRCFRNEGLSVRHDPEFTTLEVYRAYADGAAMMDLAGALLRTAAAAAGFPDAAMHDLVRGATGIDFPALDPARAMAEAVRLGAPPAEAGPRTWGHALEWVFGAVVEPTL--VRPTFVTALPLDVSPLARASDDDPRLADRFELYANGWELANGFTELADPREQRRRFEAQAAAARAGDEEAMGLDEDYLTALEVGLPPAGGLGIGIDRLVMLLTGSPAIRDVIAFPTLR. 491
209 0.000e+00UniRef50_A0QYV1 Lysylphosphatidylglycerol biosynthesis bifunctional protein LysX n=182 Tax=Actinobacteria TaxID=201174 RepID=LYSX_MYCS2  ali  26  755.GLTDQEARVRARYVDLAVN---TEARDLIRARSGALHAIRETLYSKGFLEVETPILQQ-IHGGANARPFLTHI----NAYDLDLYLRIAPELYLKRLCVGGVERVFELGRAFRNEGVDFSHNPEFTLLEAYQAHADYNVWIDGCRELIQNVDISGQWAVKTVHDAVSEAIGEHIPETELGELRRLCDSAGI--PYLTHWDAGAVVLEMYEHLVEDR--TTEPTFYKDFPTSVSPLTRPHRSIPGVAERWDLVAWGVELGTAYSELTDPVEQRRRLQEQSLLAAGGDPEAMELDEDFLQAMEYAMPPTGGLGMGVDRVVMMITG-RSIRETLPFPLAK. 1104
210 0.000e+00UniRef50_A0A2A2QEQ6 Lysine--tRNA ligase n=3 Tax=Verrucomicrobia TaxID=74201 RepID=A0A2A2QEQ6_9BACT  ali  30  58.GVADREIKYRKRHLDLMSN---EESAAIFVTRSQMVAEIRSFFHQRGYLEVETPMLQD-IPGGAAARPFET----YHNALGMPLTMRIAPELFLKRLLVGGFTKVFELNRNFRNEGISRRHNPEFTMLEAYQAFADFEIMADLVEELVCGLAEKFCWKRANYHDLIAEAAGADFFTLTAEQRRQRCEELGVQISENMEDH--EVVQQVFEKKVEEHSFD--PCFVTRVSSELVPLAKV-THGGKTVEVYELIINGQEISPGYSELNDPDVQRDRLEHQ-----AGGEEEQKVDYDFIETLEHGMPPAGGIGIGIDRLIMMLTGAPTIRDVILFPLLK. 399
211 0.000e+00UniRef50_A0A0G1WIZ8 Lysine-tRNA ligase (Fragment) n=1 Tax=Candidatus Adlerbacteria bacterium GW2011_GWC1_50_9 TaxID=1618608 RepID=A0A0G1WIZ8_9BACT :_  ali  31  144.GLQDAEERFRKRYLDLLMN---TEVRERFQKRTKIILELRQRLQAEGFMEVETPQLQPLP-GGATARPFVTH----HNALDIDLYLRIAPELYLKRLLIGGYGKVFEIGRNFRNEGIDRDHNPEFTMLELYWAWQDYRGLMTFVQKL------------------LKKWLPGKWRTLTFSQLVKNPTE---------------------ENYKEARNKIKEPTFIIDYPEALMPLAKLKPENPKLTESFQLIANGAEVVKGFSELNDPLFQRQQMERQEAEHRRGNEEASRLDEDFLEALECGMPPAAGLGLGIDRLAMLLTETKN--DVITIPA... 429
212 0.000e+00UniRef50_A0A2D7FDW1 Lysine--tRNA ligase n=1 Tax=Filomicrobium sp. TaxID=2024831 RepID=A0A2D7FDW1_9RHIZ  ali  28  160.GISDPELEARERHKSIVSDEV---VRSRLIARSKIISSMRRTLDDQGYLEVETSFL-HPIAGGANAKPFVTH----HNSLDMDLFLRIAPELYLKRVIASGLDKVYEIGKNFRNEGLSFKHNPEFTSLEVYVAYVDYEEMMRIVEDVIVNAVFQRPWKRMSMDGLVLEKTGVDFKELKTADEARAAAEK-LGIEVPKDASWGKILEAVFEEEVESSL--DQPIHVTDLPTDISPLSKPRGDDPRFAERFESYIFGREIANAFSELNDPFLQNQFFQDQAKMRQKGDEEASEPDDDYVRVLEFGLPAAGGLGIGIDRLAMFLTDAHHIRQVVLFPVMR. 504
213 0.000e+00UniRef50_A0A2A4RJU5 Lysine--tRNA ligase n=14 Tax=Bacteria TaxID=2 RepID=A0A2A4RJU5_9BACT  ali  27  208.GLQDTERRYRQRYMDM---WANPDTTRVLILRSKMMSAMRRFLERQDFIEVETPVL-QVQAGGAAARPFMTH----MNALSLDLSLRIAPELYLKRLLVGGMPRVFEVSRNFRNEGLDKSHNPEFTSLEVYQAYGNYETMMELTEGLIRELAQAAPFEKITYAELFEKALGFSIDEIDKARAECEKRGFKTKSKDGTAIDDIFIINELFEEVAEHMIDPARPTFVMDYPASLSPLTRPKPGTEPLADRWDIFIGGMEIGPAYTELNDPDIQEEKFREQLAGVDDEESTFRTFDEDFVNALKVGMPPAGGLGLGMDRIVMLMANQRSIRDVLPFPMMK. 565
214 0.000e+00UniRef50_A0A0Q9A015 Lysine--tRNA ligase n=3 Tax=Actinobacteria TaxID=201174 RepID=A0A0Q9A015_9ACTN  ali  27  768.GLTDPEARVRMRHLDLVA---GPAARDVVRARSTAVQALRQGLLQRGYLEVETPMLQQ-IHGGANARPFTTHI----NAYDLDLYLRIAPELYLKRLCVGGLEKVFEMGRTFRNEGVSYKHNPEFTMLEAYQAYADYDEMLQLARELIQGAATAAFWPVRTVHGAISEALGEEIDADTELAALQRHCDRAG-VPYTPDDGPGDVVLEMYERLVEERTLL--PTFYKDFPTDVSPLTRQHRLDPRLAERWDLVAFGTELGTAYSELTDPVEQRRRLTEQSLLAAGGDPEAMELDEDFLDALEYAMPPTGGLGIGVDRLVMFLTGL-TIRETLPFPLVR. 1109
215 0.000e+00UniRef50_A0A1G1Y163 Lysine--tRNA ligase n=5 Tax=Bacteria candidate phyla TaxID=1783234 RepID=A0A1G1Y163_9BACT  ali  23  139.GLQDQELKYRRRYLDLIAS---PETYERFLRRSELIKTLREFYWNHGFIEVETPILT-NTASGALAKPFVTHY----NALDLDVYLRLAPEIYLKECLIGGMERVFEIGRCFRNEGLDPSHLQDFTLCEHYAAYWNFEDNMKFTEEMFSFIDFTPPWPRVSFAELLKKDCGLNIDELTXXXXXXXXXXXXXXXXXXXXXGRGNLIDALYKAVSRDRIIXXX--FLINHPLDLSPLARKNDKNPQIVDRFQLLVNTWEIVNAYSELVDPVDQKERLEVQAKAKAQGDQEAHGKDDEYIKALEHGCPPASGWGLGVDRLITLLTKQDNLRDAVLFPLLR. 488
216 0.000e+00UniRef50_P43826 Elongation factor P--(R)-beta-lysine ligase n=1748 Tax=root TaxID=1 RepID=EPMA_HAEIN  ali  62  4.................LNHWQPSADIKNHLKRAKIIAKIRQFFTERGLLEVETPVLSEFGVTDLHLSTFSTEFLAPFGEQSKTLWLSTSPEYHMKRLLAAGSGPIFQISKVFRNEEAGNRHNPEFTMLEWYRPHFHMHRLINEVDDLLQQILDCPPAESLSYQFVFQEYVGLDPLSAERSELIEAARKHNFMAEDNE--DRDTLLQFLFSEVVEPQIGKERPIAVYHFPSTQAALAQVSPEDQRVAERFEFYYKGLELANGFHELADAQEQRHRFELDNQQRQKCELPTREIDERFLAALEAGMPDASGVALGIDRLMMIALDCEKINDVISFAVDNA 323
217 0.000e+00UniRef50_A0A1V4RH94 Lysine--tRNA ligase n=4 Tax=FCB group TaxID=1783270 RepID=A0A1V4RH94_9BACT  ali  28  149..VSDPDFIYRHRSLDLMLN---ESSRNRFIARSRIITAIRGYLDSDGFLEVETPILQQ-IYGGAAADPFVSHY----NSMDDQCYLRIATELYLKRLVAGGIHRVYELGKDFRNEGVDRTHSPEFTQLELYEAWTDYQGMMTRFENIVHDIDLTPPFKRIPFVAALHEKSGEKLFEWSTEKLSGLVSSLGL---GDDINERPALLDKLFDHYVTPGI--IQPSFVVDYPVELSPLAKQKADDPGITERFEAFIAGLELANAFSEQNDPVYQRKVLENQAAQHRRG-----VVDNEFLYALEVGMPPAGGLGIGVDRLVMILTGAASIRDTILFPYLR. 485
218 0.000e+00UniRef50_A0A2E4D1D2 Lysine--tRNA ligase n=2 Tax=bacterium TaxID=1869227 RepID=A0A2E4D1D2_9BACT  ali  26  136.GISDPETRQRKRWVDMAIGGDIAKDV-VFI--SRFFQKAREYWQSEGFLEVFTPMLHQ-IPGGAYARPFKTH----HNALDLPLYLRIAPELYLKKLLVGGCPKVFEIGRNFRNEGISKKHNPEFFGLEAYEAWGSFETMMDSFEWMGKKISLKGKFNRLDFRQALIDEIGVDIDKMSTLKDYKNVFKKH-NLSWGNSMTIGRSQDKLYGEFIESKI--VNPTFVTGYPKAMSPLAKSIPGNKNWTQRFELVIAGCEVANAFGELHDPDEQSHRMKSQQDAKDSGDLEAQPIDDSYIEALEFGMPSAGGIGFGIERLLMMFLNKDSIRDVILFPMLK. 478
219 0.000e+00UniRef50_A0A178X2R7 Lysine--tRNA ligase n=20 Tax=Actinobacteria TaxID=201174 RepID=A0A178X2R7_9PSEU  ali  27  758.GLTDPETRVRQRYLDLAVN---PDSANMLRLRSTVVRAVRERLHQGTFLEVETPML-QTIHGGANARPFVTHI----NAYDMRMYLRIAPELYLKRLCVAGVERVFELNRNFRNEGVDATHNPEFTMLEAYQAYADYNAMRHLMRDLIQYAAEAAYWPVIPVHKAVSEALGEEVDSTPVATLRKLCAAAGVPVPEEA--SAGDLVLKAHEHLVEG--STVLPTFYTDYPTEVSPLTRQHRTDPLLAERWDLIAFGSEVGTAYTELTDPLEQRRRLEAQSLRAASGDVEAMELDEDFLLALEHGMPPTGGLGLGVDRLLMMLSGT-SIRQTVLFPFVR. 1104
220 0.000e+00UniRef50_A0A0L0ST03 Lysine-tRNA ligase n=1 Tax=Allomyces macrogynus ATCC 38327 TaxID=578462 RepID=A0A0L0ST03_ALLMA  ali  27  63..IKDQEKRTRNRVLDLLVNVDLRRRLRTRTT---VIQHVRDFLASRDFLEVDTPVLS-TQAGGANARPFTTTAH----AYGLDMALRVAPELWLKKLVVAGFDRVFELGKQFRNEGFDATHNPEFVTCEFYMAYANLSDLMGMTEQMSHEVDFTGPYRVIDVVPFLEAKLGPLPRPTMEADLEAYCVKHHVPLPAYPR-TAPRLLDAIISHVIEPE--CVQPTFVRGHPRIMSPLAKSMQENPLLAARIELFVAGKELVNAYEELNDPVEQRDRFMQQQRDKDSGDVEAQPLNDEFCRALEYGLPPTAGWGLGIDRLCMMLTGAHHIREVMPFPTVR. 415
221 0.000e+00UniRef50_A0A1F5Q9A3 Lysine--tRNA ligase n=8 Tax=cellular organisms TaxID=131567 RepID=A0A1F5Q9A3_9BACT  ali  26  144.GLKDTETRLRKRYLDLLAN---PEVREMFRKKSVFWNTVREYLVKRGFLEVETPVL-EAVPGGAEAEPFITH----HNALARDFYLRISLELPLKRLLVGGYEKVFEIGRIFRNEGISTEHLQDYTQMEFYWAYADYNDLMGMLGELYPEIDWGKKWKRYDYYDLFQEHTGIDLSKTTXXXXXXXXXXXXXXXXXXXXXGR--LIDLIYKKTVRPKL--IEPGFLLDPPVEIEPLAKRTPKDPNRVERVQVMAWGTELGKGFSELNDPIDQRGRFEDQMKLREAGDKEAQQLDEDFVEALEFGMPPAAGFGMS-ERLFAVLMD-KSVRETVIFPPMK. 483
222 0.000e+00UniRef50_A3ZMZ1 Lysine--tRNA ligase n=17 Tax=Planctomycetales TaxID=112 RepID=A3ZMZ1_9PLAN  ali  31  343.GLTDPELRQRMRYLDLA---HTDGAIERFVKRTEIVKSIRKTLADQNFIEIEGPTL-HAIAGGAAARPFITH----HNALGMELYMRIALELHLKRLLVGGMERVFELGRVYRNEGISPKHNPEFTMLEVYQAYGDYRSMMDLTEAVITMVNFAPPFERRTYAELFQENTGVDP--TDDAAVKRYAINLGLETEGKHP---DVIRNEIFEEKVEDQLK--GPIFVMDYPASICPLTKRKTDNPAVAERFELFINGMEVANAYTELNDPDLQDKLFRTQLDGQADEDSMA-KMDHDFIRALRNGMPPAGGLGIGIDRLVMLLTNTQTIREIILFPLLR. 680
223 0.000e+00UniRef50_A0A2P6MWI2 Lysine--tRNA ligase n=1 Tax=Planoprotostelium fungivorum TaxID=1890364 RepID=A0A2P6MWI2_9MYCE  ali  27  182..LTHTDTRFMKRHLDLLTNRR---SRDTLIARSKVITCVRDFFTSRGFIEMETPILG-AKAGGANATPFVTQ----GQAIGDHLFLRIAPELYLKQLVIGGMEKVR------RNEGVDATHNPEFTTCEFYQAYSDYNDIMDMTQELLRDIVGKVTGHVIDFSKNFARDLVTKLEETMNEKLPENFIAHRKGVYIPKPHTPARILDKLVGHFIEP--LCIQPTFIMNHPLCLSPLAKSIPDRPQCTERFELFINEAEYCNAYSELNDPEEQRVRFRQQAEDKKLGDADSQVPDEEFCEALECALPPTGGFGLGVDRFVMLLTGSESIKEVIPFPIMK. 525
224 0.000e+00UniRef50_A0A2S8FXP9 Lysine--tRNA ligase n=4 Tax=Blastopirellula marina TaxID=124 RepID=A0A2S8FXP9_9PLAN  ali  29  347.GLTDPELRQRMRYLDLA---YGDGVLDRFVQRTQIVRSIRDTLVGEGYYEIEGPTL-HTIAGGAAARPFET----FHNALGMPLVMRIALELHLKRLLVGGMERVFELGRVYRNEGISPRHNPEFTMLEVYQAFGNYETMMELTENIIKEIDFTPPFARKCYSDLLAEHAGIDPE--SEGEVIACAKKLHLETDGKHP---DVLRNEIFEETVEDKL--IGPVFVIDYPASICPLTKRKADNPAVAERFELFIQGMELANAYTELNDPDLQEKLFRTQLEGMDEEDSMA-RMDTDFVRALRNGMPPAGGLGIGIDRLVMLLTNSATIREIILFPLLR. 684
225 0.000e+00UniRef50_A0A2U1QLF2 Lysine--tRNA ligase n=1 Tax=Artemisia annua TaxID=35608 RepID=A0A2U1QLF2_ARTAN  ali  23  302YTLKDLETRYRHRYLDLMVNSQVT---RTFKTRAFAIDYIRDFLKKRNFLEVETPMM-HTLAGGAGAHPFVTH----QNDLNMMFFMRIAPDPYLKQLIVGGVERVFEIAKQFRNEGIDLTHSPEFTTCEFYMAYADYNKLMEL--------------SEIMLSELEKEANLSIPKDLSSDEANKYLVDACTAFDIECPPPQTTAHLLDKLVEHFLKEKCVNPTFMMNYPEIMSPMAKGNRSKPGLTERFELFINKHKIADGYTTLNDPVVQRQRFTDQLKNALEYGLPAMALDEMFIKSLEYGLPPTGGWGLGIDRLTMLLTDSQNIKECILFPAMR. 656
226 0.000e+00UniRef50_A0A1G7KSD5 Lysine--tRNA ligase n=3 Tax=Actinobacteria TaxID=201174 RepID=A0A1G7KSD5_9ACTN  ali  27  148.GLTDVETRYRQRYTDLEVNER---TREVFRIRHTAVRAIRRHLEDAGFTEVEGPVL-QTIQGGASARPFVTH----HNALDLDLYLRIALELHLKRLIVGGMERVFEIGRVFRNEGIDTRHNPEFTMLEAYQAFADYGDMMDLVEGMVTSAARAAPWPRRRFADMIAETTGTMHPAMPIAEARAVLDRLGLAHEPD--WGAGRLMKEVYDQRV--QHSVVGPVFCIDYPREVSPLARTHRDDPAYVERFELIVAGFELSNAYSEQNDPVEQLAAFEAEARAKQHGDPEAGDVDLDYVRALERGMPCTGGLGIGIDRLVMLLASVDSIREVILFPTLR. 492
227 0.000e+00UniRef50_UPI00094CCF0A lysine--tRNA ligase n=2 Tax=Buchnera aphidicola TaxID=9 RepID=UPI00094CCF0A  ali  25  159.GLQDQELKYRKRYLDLMSNNN---IKKIFKKRSRILSVIRIFMEKKNFLEVETPMM-HSIPGGANAKPFIT----YHNTFNSKMYLRVAPELYLKRLIIGGFNKIFEINRNFRNEGVSTRHNPEFTMMEIYMAYSNYKDMMIFLIKLLKYITKKICNTSTIYYDNYTIDFKKKIKKITMSDLKNLKKAKKIMKEIPSDISLGEAINIIFEKTTEKKI--IKPTFITSYPIEVSPLAKSCSKNKSFTERFEFFLAGYEIANGFSEXXXXXXXXXXXXXXXXXXXXXKKKHYQYDKEYITALEHGLPPTAGLGIGIDRLIMIFTNQKNIRDVILFPTLR. 504
228 0.000e+00UniRef50_A0A2R5GQI0 Lysine--tRNA ligase n=1 Tax=Aurantiochytrium sp. FCC1311 TaxID=2023137 RepID=A0A2R5GQI0_9STRA  ali  31  123FGLRDKGVRYRNRHLDLLANGQ--AVAAPFQVRAQVMRFLRDYFHQRNFLEVETPTLVPS-AGGALARPFKTRAVALDNA---EVSLRIAPELYLKQLVVGGIDRVFELGKVFRNEGVSAVHNPEFTTLELYQAFADYEDLMAMTEDLFANLD-IQIGDDARAAAAIGEHLGGDGLGLSSEDLRGPFARLPVLEGLEDHYNLPKLVDTLIGRHLEPK--CHRPTFLCDHPIAMSPLAKAHPDRPGLSQRFELFVRGKEIVNAYTELNDPAEQLRRFQLQTQGRDAQDRPVMPVDAAYCKALEYGLPPTAGWGLGVDRLVMMLTGRSSIRDVIAFPML.. 515
229 0.000e+00UniRef50_A0A2U1IWI1 Lysine--tRNA ligase n=2 Tax=Harpellales TaxID=61421 RepID=A0A2U1IWI1_9FUNG  ali  25  193..IENIETRFRNRHVDFLVNEN---ARNTIITRARILKLIRKYFDDNGFIEVETPVLWPSL-GGALAKPFVTKSSSLG---DTDLFLRISPELFLKQLVIGGIDRIYEIGKVFRNEGIDKSHSPEFTSCEFYQAYANFDDIINTTETLNKTLDFTPPFNRINITEYLSKKLDTNLEFLHTETNTENIVEKLIEITLKKPYTPTRLLDNLISNLIEP--LCIQPTFLLGHPILMSPLSKAKSKLE--SARFELFIDCSEYVNAYEELNDPDEQRSRFKLQLADRNSGDVESLVPNNDFCEALEYGLPPTSGWGMGVDRLVTLLTNSKSIREVISFPIVK. 543
230 0.000e+00UniRef50_A0A1Z8MN70 Lysine--tRNA ligase n=1 Tax=Rhodopirellula sp. TMED11 TaxID=1986614 RepID=A0A1Z8MN70_9PLAN  ali  30  186.GLTNPDLKQRMRYADLAFNEGP---LETFMARTKIIKSIRNTLDSHDFCEVEGPTL-HTVAGGAAAKPFNTH----HNALDMPLTLRIALELHLKRLMVGGMERVYEIGRVYRNEGLSPRHNPEFTMLELYEAYGDYRSMMDITEQMICTVDFTPPFERATYADLFQKATGVDP--ADDVAVLELAKKIGLDTAGKH---LDVVRNEIFEEKVEDSL--EGPIFVIDYPASICPLTKRKRDNPDIAERFELFICGMELANAYTELNDPDLQQKLFETQLEGQDEEDSMA-KMDHDFIRALRHAMPPAGGLGVGIDRLVMILTGQKSIRDVILFPVLR. 523
231 0.000e+00UniRef50_R5MEN3 Lysine--tRNA ligase n=1 Tax=Mycoplasma sp. CAG:956 TaxID=1262908 RepID=R5MEN3_9MOLU  ali  24  139.GLQDTELKYRRRYVDLIMN---QESRNVFLGRSKFYAFLHRYLGENGFLEVETPIM-QTAVSGAAAKPFFTH----HNALNLDMNLRIAPETYLKQCIAAGFDRVYEVAKCFRNEGMDTEHLQEFTQVEWYVAYWNFEDTIVFFQKFINELNFDGNWDRINYIDAMKEILGDDFLTITDPNALKELKNLFTMADMAEYKSISQIIDFVYKKKIRANI--VGPTILYNYPAVLKPLARRNDNDSNAVDVFQVVVCGTEICNAYSELVNPEIQRANFEEQAKAKSQGDDETMELDEDFMGAMEQGMPPISGLGFGIDRLMMLFYNQESIRDVVLFPTMK. 485
232 0.000e+00UniRef50_D0LB45 Lysylphosphatidylglycerol biosynthesis bifunctional protein LysX n=523 Tax=Actinobacteria TaxID=201174 RepID=LYSX_GORB4  ali  28  788.GLTDPEARVRQRYVDLAIN---PRSRELLATRSVVVKALRDFLADRGFMEVETPILQQ-IHGGANATPFQTHI----NAYNLDLYLRIAPELYLKRLCVGGVEKVFEIGRNFRNEGVDFSHNPEFTSLEAYAAHSDYLKMLDLTREMIQHAATAAHWPVRTVHEVVSEGAGVEITSDTESELRGICDRLEIAYRPD--WDAGQIVLELYEHLGEDRTTV--PTFYTDFPTSTSPLTRAHRSKPGVAERWDLVAWGVELGTAYTELTDPVEQRKRLTAQSILAADGDPEAMELDEDFLTALEYAMPPTGGLGVGVDRVVMLITGQ-SIRESLAFPMVK. 1134
233 0.000e+00UniRef50_UPI0007117CC3 lysine tRNA ligase n=1 Tax=Blastocystis sp. subtype 4 TaxID=944170 RepID=UPI0007117CC3  ali  27  177..IKDPDVKYRKRYLDLIVSKN---TREIFYKRSKIIKLIRKFMEEEGFLDVETSILS-AQAGGAVATPFITH----SNTQDQDLALRISPELYLKELVIGGFERVYEMGKVFRNEGLDNKHNYEFTTIEAYMTYQDYTDWMKKTEELLNRICFAPPYRQIDVTEELTRQLGPLPDEDSIPSLVELCKKHGI--EVSTPLTLPHVLDALIGRFIEPQ--CIQPTFIINHPMVMSPLSKEHE-HSGKSERFELFVHGVELVNAYTEQNSPVIQEQSFTIQGKQREVGDKEIPPADLTFINALEYGLPPTTGWGMGVDRLVMMMTNQSSIRDVVLFPVLK. 519
234 0.000e+00UniRef50_A0A0P0FJK5 Lysine--tRNA ligase n=5 Tax=Verrucomicrobia TaxID=74201 RepID=A0A0P0FJK5_9BACT  ali  30  162YGIRHTETKYRQRYLDLISN---PASCEVFRQRIRIIHEIRSYLEGNGFLEVETPMM-QVVPGGAAAEPFKTH----HRALDMDLFLRIAPELYLKQLLVAGFPRVFELNRNFRNEGISRHHSPEFTMLEAYIAYSDFEQMALLVEEMICHIAKKVCGWKRARYSDLIRSIQPSWYELSSDQKRACCTQMGL--ETTDSQEDFEITQRVFEKFVEEKI--IDPLFVTHCPRELVPLAKQNEIDLSVVDAYELVINGHEISPGYSELNDPDIQRRRLEYQS------GGEIQKLDLDFLTALEYGMPPAGGLGLGVDRLVMLLTGAESIRDVILFPHMRS 504
235 0.000e+00UniRef50_A0A1F6C6L9 Lysine--tRNA ligase n=8 Tax=Bacteria TaxID=2 RepID=A0A1F6C6L9_9BACT  ali  28  148.GLQDVEERLRRRYLDLIMN---SAERELFEKKSRFWYAMRSYLIHESFLEVETPVLEHTP-GGADAEPFATH----MNALDMDLYLRISLELPLKRLIVGGFEKVFEIGRIFRNEGVDREHLQDYTQLELYWAYVDYKKMMTFVRLMYQTIDWGGIWKTVEYVDVFKEKTGLDPLAAKEADLISLAKKHKL--DPDKHIGRARLLDLLFKKLARP--SMIQPVFLVNPPVEIEPLAKRMSGDPMRVERFQVMACGSEIGKGFSELNDPIDQRARFEEQMKLRKAGDREAQMMDEDFVEALEYGMPPTAGFGTS-ERLFSVIMNRP-IRETVFFPLMR. 487
236 0.000e+00UniRef50_A0A0G0FNI4 Lysine--tRNA ligase n=9 Tax=root TaxID=1 RepID=A0A0G0FNI4_9BACT  ali  29  146..IADAEIMQRQRYLHTLVD---PDARDRFRIRSKIVQSMRDYFDSLGALEVETPVL-DTTYGGALAKPFITN----HNALDTEMYLRISNELYLKRMTVGGFEGVFEFSRDFRNEGMDRTHNPEFTQVELYMPFWDYNNMMDMTEDLMSGIARQLHWRRVSIYEGIREMLGIDPSNISDSRLRTIAHQYEI-----DTYTRGDVLVELFEKVWEKDL--IQPTFVMDYPADTSALTKRHRTNPDLTERFEIFVAGMEVGNSYSELNDPRDQRTRFETEKLKREHGDKEAMPFDEDFILAMEYGMPQQAGIGISIDRWTMLLTDTNHIRHVIYFPPVR. 494
237 0.000e+00UniRef50_A0A058ZAC9 Lysine--tRNA ligase n=1 Tax=Fonticula alba TaxID=691883 RepID=A0A058ZAC9_9EUKA  ali  26  217............RHLELILD---TTARERFRIRSRVIATLRRFLEDLDFLEVETPVLS-AIPGGASARPFQTT----SNALGRDLSMRISPELYLKRLVIGGFERVFEIGKQFRNEGIDHDHNPEFTTCELYQAYANCEDMMDLTENLFREIDFAPPFQRMSIPHELEILLGAPVPDLSTDVELEFFVERVIDRLPPAPLTAARVVDHLVSEYLEPR--CDQPTFLTGHPAALSPLAKAHPALAHASDRFELFVAQRELVNAYSEQNDPNAQYQSFHQQAASRLAGDDEAHVPDHDYCQAMRYGLPPTGGWGLGVDRLVMMLTGSAHIRDIILFPATKS 561
238 0.000e+00UniRef50_F9NXQ3 Lysine--tRNA ligase n=105 Tax=Bacteria TaxID=2 RepID=F9NXQ3_9ACTN  ali  25  759.GFNDPEAKVRQRYLDLIVN---PGARDQLRARSNAIRAVRETLLSHDYIEVETPIL-QTIHGGANARPFRTHI----NAYDLDLYLRIAPELYLKRLMVGGAGRVFEIGRNFRNEGADATHNPEFTMLEAYQAYGDYVQMRHLTREMIHEVDLANEWHVVTVNEGISRGLGEEVTADTPKETLMGYANKLGIATLPKW-SRGDVVLELHEHLSEH--VTVEPTFFCDFPTDVSPLTRQHRDDPRLAEKWDLIIFGSEVGTAYTELVDPVIQRERFTAQSLLAAGGDPEAMELDEDFLEALEYAMPPSGGMGMGLDRLVMMLTNA-SVRETISFPLVR. 1105
239 0.000e+00UniRef50_A0A1H0CUA7 Lysine--tRNA ligase n=3 Tax=Actinobacteria TaxID=201174 RepID=A0A1H0CUA7_9ACTO  ali  29  712.GIRDPETRVRQRHLALIVDPRE---REMVVARAHAIQAVREELLARDYLEVETPILQP-VHGGANARPFKTHI----NAYDLDLYLRIAPELYLKRLMVGGMERVFEIGRNFRNEGADATHNPEFTMLEAYQAHADYNVMKDVTRELIREIDLSAPWRTVSVCDAVSEGLGEQVPDTPVQALRAHADALAM--PYDPRWEWGNLMQELYEHLAEST--TVEPTFFTDFPAQTSPLTRPHRGDARLAERWDLIVFGAEVGTAYSELVDPVLQRERLTAQSLAAAGGDPEAMELDEAFLEALEQGMPPSGGLGVGLDRLVMMLTGA-SIRETIAFPLVR. 1057
240 0.000e+00UniRef50_C7DCH1 Lysine--tRNA ligase n=1 Tax=Thalassobium sp. R2A62 TaxID=633131 RepID=C7DCH1_9RHOB  ali  28  138.GMSDVEAIYRARYIDLVSN---QDSKDRFLARSKIVRAIRRTFEGMDYVEVETPML-HPISGGAAARPFTTHY----NALDSQFYLRIAPELYLKRLIVGGLAPVFEINRNFRNEGVSKKHNPEFTMLEAYEAFADFETMKQRIAEICEAACFKAPFQEIEMAELIKNTLGIDFREIP-DAAAARAAMAEKGVEVPADATWGECMEVAFDEYGEATL--IQPTHVTMYPSEISPLSKPCLDDPRFCERFESFANGWEIANAFSELNDPEKQLAIFEGQVAQDASRGETEREVDYEYVAALDFAMPPTGGLGLGIDRLAMLLTDATHIKEVILFPTLR. 481
241 0.000e+00UniRef50_UPI0005F80AF7 lysine--tRNA ligase n=1 Tax=Teredinibacter sp. 1162T.S.0a.05 TaxID=1286364 RepID=UPI0005F80AF7  ali  25  152.GLADQELRYRQRYVDLVVN---PEIRKVFQTRSRIVEFIRSYLNQADFMEVETPML-QVIPGGATAKPFVTH----HNALDIEMYMRIAPELYLKRLVVGGFERVYEINRNFRNEGLSTRHNPEFTMLEFYQAYADYKDLMALTEDMLRTYDFAQPFVKMTMAESVKQFLCEAIDWLMNPKTRGSHAELIIKTPEKGEWEFGKYLTEIFEATVEHRL--VQPTFITEYPWEVSPLARRSDADGFVTDRFEFFIGGREIANGFSEXXXXXXXXXXXXXXXXXXXXXDDEAMHYDADYVRALEYGLPPTAGEGIGIDRLVMILTDSPSIRDVLLFPHMR. 523
242 0.000e+00UniRef50_A0A2A9F8X2 Lysine--tRNA ligase n=1 Tax=Amycolatopsis sulphurea TaxID=76022 RepID=A0A2A9F8X2_9PSEU  ali  27  759.GLIDPETRVRQRYLDLAVN---PESAQMLRLRSTVVRAVREHLHQGDYLEVETPML-QTVHGGANARPFITHI----NAYDMRMYLRIAPELYLKRLCVAGVERVFELNRNFRNEGVDATHNPEFTMLEAYQAYADYNSMRNLTRELVQHAAEAAFWPVIPVHEAVSLALGEEIDETPVPVLRRLCTAAGITVPEEA--GHGDLVLKAHEHLVEG--STVLPTFYTDYPTDVSPLTRQHRVNPRLAERWDLIAFGSEVGTAYTELTDPIEQRRRLEAQSLRAASGDVEAMELDEDFLLALEHGMPPTGGLGLGIDRLLMLLSGA-SIRQTVLFPFVR. 1105
243 0.000e+00UniRef50_UPI000DD02040 EF-P lysine aminoacylase GenX n=1 Tax=Aliidiomarina sp. B3213 TaxID=2249757 RepID=UPI000DD02040  ali  46  6...................SWQPSAALENIKARSALQQQIRAFFLERDVVEVETPILAASGVTEPHIANMQVHAESGQFKGLHKLYLQTSPEYAMKRLLCAGIGDCFQISKVFRNDEISSRHNVEFSMLEWYRLGFTDVELMAEIELLMREIFPDVASQYLTYQDAFIRYAQVDPLAANAQELEASLMQKGIDCEVVKG-DRAALLDLLMSCVVEPSLDREQLTFVYHFPAEQASLAKRCEQDDRTAHRFELFYGGLELANGYWELQDPIEQRARFEKDNTQRGSMGLPEVPIDERFLAALESGLPACAGVAMGVDRLLMLKLGAKHIKEVLTFTTDSA 324
244 0.000e+00UniRef50_A0A0G1R834 Lysine--tRNA ligase n=2 Tax=Parcubacteria group TaxID=1794811 RepID=A0A0G1R834_9BACT  ali  26  143.GLQDVEERFRHRYLDTLMS---PEVKQRFVLRSKMVSEIRKFYDDNGYTEVETPRL-QILAGGATAEPFVTH----HNALDIDFHLTIAQELYLKELLIGGFTKVYEIGRKFRNEGIDATHNPEFTMLESNESYADALSQRQFIEKLFKHLVKKMFNADSIIHNEQKIDFAENFSVITFFDLLQRHAATQLGVTVEPEESLEKIMDNIYKKTCRPKL--VQPTFIIDYPVSFNPFAKRKEENPTLIDRFQLVAGGIELVNAFSELNNPVDQKERYLEQDKKKAKGEHDISPSDKGYLEAMEYGMPPNGGIGIGIDRLAMLFTDAKNIKEVILFPTLR. 485
245 0.000e+00UniRef50_A0A1F7TYM3 Lysine--tRNA ligase n=1 Tax=Candidatus Uhrbacteria bacterium RIFCSPHIGHO2_02_FULL_53_13 TaxID=1802389 RepID=A0A1F7TYM3_9BACT  ali  26  141.GLSDVEMRFRQRELDLITN---PAVRHTFVQRAHIISAIRRFFDDHGFLEVDTPILQHVAA-GASARPFVTH----HNALDEDLYLRIAPELFLKRCVIGGFERVYEIARCFRNEGIDHTHNPEFSQVEAYAAYMDYETLMGFMEELICTLDFSNAIPRKTYRDLIVEKSGIDVDTLEDVESARTAAR-TVGVDVQMEWSLGTVIDEIWKKAVRPSI--VQPIFVTDYPASITPLAKRKEDNQNRIEMFQLVVGGLEIMKAFGELNDPVDQEMRMNENEEAHQRGDDDAQRRDDAFIRAMQHGMPPMSGVGMGIERITQVLTDSHNIKEVILFPTLRS 486
246 0.000e+00UniRef50_UPI000373B0F8 bifunctional lysylphosphatidylglycerol synthetase/lysine--tRNA ligase LysX n=1 Tax=Catelliglobosispora koreensis TaxID=129052  ali  27  706.GLTDPEAKVRQRYLDLITS---DEARTTLKARSAVIYSLRQSLFSRDYIEVETPMLQP-VHGGANARPFITHI----NAYDMRLYLRIAPELYLKRLCVGGVEKVFELGRTFRNEGVSFKHNPEFTMLEAYEAYADYLSMLDLCRTLIQNAAQAASGSQALVHDGVEYDLGGQWPVYSINEAISHALGEEVTPPFDPTWGQGELILELYERLVEH--STLAPTFYKDFPTDVSPLTREHRDDPRLAERWDLVAFGTELGTAYSELVDPVEQRRRLTAQSLKAAGGDPEAMELDEDFLQALEYAMPPSGGLGIGVDRVVMLLTG-KTIRETLPFPLVR. 1047
247 0.000e+00UniRef50_A0A0T9RZ40 Probable lysyl-tRNA synthetase 2 LysX n=5 Tax=Actinobacteria TaxID=201174 RepID=A0A0T9RZ40_MYCTX  ali  27  14..FTDPEARLRRRSTDLLVH---PDQMQNLRLRTAVIKALRARLDAEGFLEVETPIL-HTVHGGASARPFRTYI----NAYGEDLTLRIAPELYLKRLVVGGSGPVYELGRDFRNEGADATHNPEFTVLEAYRPYADYVQMRELTERLIKDAAQSVFWRVVSVCDALSEALGRRVDVQTDFEELLTLAQQHG-VRVHEGMGPGAIVEELYGELVEAH--TVEPTFYTDFPAETSPLAAPHRSVPGLAERWDLVINGMEMGCAYSELADPLVQRERLTEQSLKAASGDLEAMEVDEDFLYALETGMPPTGGLGLGVDRLVMLLAQTQ-IRGVLSFPFVK. 360
248 0.000e+00UniRef50_A0A1J4U2X4 Lysine--tRNA ligase n=2 Tax=Candidatus Kuenenbacteria TaxID=1752740 RepID=A0A1J4U2X4_9BACT  ali  25  141.GLKDEESCYRQRYLDLIAN---DETIKRFKFRSRFIKILREFYAQNGFEEIDTPILA-NQASGALAKPFKTH----HNALGTDIYLRIAPETYLKESIVGGYEKVFEVARCFRNEGMDPSHLQDFTMVEHYAAYWDYVDNMRFTERMFEYIDFSLPWKRVSFCEQLIEDADIDIDKYENDKLREAIKRKKIKIEDIDKLGRGNLIDALYKLVSRPKI--INPTFLTNHPLDLSPLARRSDNNIKAVDRFQLIINTWEIINAYSELVDPIDQEERFRVQEKAKKDGDEEAHGKDDEYIEAMKHGMPPISGFGMGIERIVALLTGQTNLRDVVLFPLMK. 491
249 0.000e+00UniRef50_A0A2I1KS28 Lysine--tRNA ligase n=7 Tax=root TaxID=1 RepID=A0A2I1KS28_9ACTO  ali  29  757.GLQDPEMRVRQRHLALIISSRD---RRMLVARSHAIQAVRSTLLQRGYLEVETPML-HPVHGGANARPFRTHI----NAYDLDLYLRIAPELYLKRLMVAGADRVFEIGRSFRNEGADATHNPEFTMLEAYQSYADYTVMKEVVQDLAVHAAKAAPWRTVSVCDAVAEHLGEPVDASTSLGTLQAFADR-LNLAYDPAWGWGTLVQHLYEHLAEGT--TAQPTFFTDFPAETSPLTRPHRSLPLLAERWDLIIFGSEVGTAYSELVDPVLQRERLTAQSLAAAGGDPEAMELDEAFLQALEQGMPPTGGLGVGLDRLVMMLTGA-SIRETITFPLVR. 1102
250 0.000e+00UniRef50_A0A1F5NPE0 Lysine--tRNA ligase n=1 Tax=Candidatus Doudnabacteria bacterium RIFCSPHIGHO2_01_FULL_46_14 TaxID=1817824 RepID=A0A1F5NPE0_9BACT :  ali  25  148.GLKDVETRLRKRYLDLLAN---PDVREMFRKKSVFWKTVRDFMIEKGFLEVEMPVL-ESVPGGAEAEPFVTH----HNALDRDFYLRISLELPLKRLLVGGYEKVFEIGRIFRNEGISTEHLQDYTQMEFYWAYADYHDMMEMLVELYQEIDWGKPWKKYDYYELFKKNVGLDLHKATVNDLKTAADKLKIKY--EKFADKGRLIDLIYKKSVRPTLIESG--FLIDPPVEVEPLAKRSSSDPSRVERLQIMAWGTELGKGFSELNDPIDQRERFETQMKLRAAGDKEAQQLDEDFVEALEYGMPPAAGFGMS-ERFFAVLMD-KSIRETVIFPPMK. 487
251 0.000e+00UniRef50_A0A2G9YDJ7 Lysine--tRNA ligase n=3 Tax=Parcubacteria group TaxID=1794811 RepID=A0A2G9YDJ7_9BACT  ali  33  108YGLKDKEIRFRKRYLDLLMN---EEAIKIFEKRSEIIRKIRAFLDKNNFIEVETPIL-QTIPGGTLAKPFKTHL----NALDLDLYLRIAPELYLKRLLVGGFERVYEIGRCFRNEGMDKNHNPDFTMLEFYVSYWDFEKLMDFT------------------------------------------EKLMQEFGFPEKWTRAEYSKIVRNSEKEAFQKIKKPTFVWGHPLEISPLAKKIDSK--RAARFQGIINGIEIINAYSELNNPIEQKERFKEQETMRKKGDQEAHRMDKDFIEALEYGMPPAAGFGMGIDRLTMLLTNAKTLREVILFPTMR. 393
252 0.000e+00UniRef50_A0A1D8MSF4 Lysine--tRNA ligase n=5 Tax=cellular organisms TaxID=131567 RepID=A0A1D8MSF4_9ARCH  ali  27  136FGVEDEELRYRDRPLHLTMDM---EARDRFRTRSEIISELRSFLESREFMEVETPTIQP-VYGGANAEPFETHV----NDRDMDAYLRISPELYLKRLIVGGYERIFEIATNFRNESIDTTHNPEFTMMELYQAYADYEDMMELTEELVEHIAVEVPWRRMTMHEAIEEHGGLEVEEMSDEELREAMDELGI--ELDSGFERGLAIAEIFEEVAEEEL--VQPTHITDYPEETTPLCMDHRSEEGLIERFESFIAGMELANAYTELRDPIRQREHFEREHQRQEEGDDKAHPLDMEFVEALELGMPPTGGLGIGIDRLVMILTDQESIRDVLFFPMM.. 477
253 0.000e+00UniRef50_Q9Z6X5 Lysine--tRNA ligase n=97 Tax=root TaxID=1 RepID=SYK_CHLPN  ali  30  167.GLSDKEVRYRKRWLDLISSR---EVSDTFVKRSYIIKLIRNYMDAHGFLEVETPIL-QNIYGGAEAKPFTTTME----ALHSEMFLRISLEIALKKILVGGAPRIYELGKVFRNEGIDRTHNPEFTMIEAYAAYMDYKEVMVFVENLVEHVDFKAPWIRMTMKESIATYAGIDVDVHSDQKLKEILKKKTTFPEAFATASRGMLIAALFDELVSDNL--IAPHHITDHPVETTPLCKTLRSDTAFVERFESFCLGKELCNAYSELNDPIRQRELLEQQHTKKELLDSECHPIDEEFLEALCQGMPPAGGFGIGVDRLVMILTNAASIRDVLYFPVMR. 519
254 0.000e+00UniRef50_A0A2G0V6U5 Lysine--tRNA ligase n=2 Tax=Candidatus Tremblaya phenacola TaxID=1010676 RepID=A0A2G0V6U5_9PROT  ali  26  168.GLINKELCYRQRYLDLVYNER---ARYIFKARTHIISELRSYMLSNSYIEVETPMM-HLIPGGALARPFITH----HNTLNIDMYLRVAPELYMKRLVVGGFEKIFEINRSFRNEGLSAYHNPEFTMMELYMAYANYIVLMELVEDLFKYIAISKAFIKIPMLESICSFCSSITYADLTDIKLTKDIASSLDIKLEKEWGLGKVQTHIFKRVVESMLK--QTTFIINYPSEVSPLARRLDRNPFLSERFEVFINGKEVGNGFSELNDSSEQSLAFINQLKEKEPNDREA-----DYIKSLEYGLPPTAGLGIGIDRLVMVLANASNIRDVILFPTMR. 510
255 0.000e+00UniRef50_A0A257RXL1 Lysine--tRNA ligase n=2 Tax=unclassified Actinobacteria TaxID=1752188 RepID=A0A257RXL1_9ACTN  ali  28  130.GIADFDLRYRHREADLWANELSRRSLLRRSA---AVRSMRERCWGQGFVEVETPILN-AIPSGAYAKPFVTH----HNALDTDFYLRIAPELWLKRLVVGGFERVFEIGRLFRNEGVSPRHNPEFTSIEIYAAYWDYEDMMSFTEELVAGVALDVPWARRPMAELASEAVGEEVSANTPRERLAHLLDERG-VAAHASWGPGRCLAELFEATSEDNL--WDAVFVTGHPVETSPLARRDPHDELITQRFESYAAGRELSNGFSELTDPREQRARFEDQARLAAAGDDEAMVLDEDFLRALEWGLPPTAGMGMGIDRLAMLLADEANIREVIAFPTLK. 472
256 0.000e+00UniRef50_A0A1F9Q9R4 Lysine--tRNA ligase n=7 Tax=unclassified Elusimicrobia TaxID=1797919 RepID=A0A1F9Q9R4_9BACT  ali  24  146.GLTDSETRYRDRYLDLLTN---DDVRALFVKRSQIVAALREVLNGEGMLEVETPVLC-SQAGGASARPFIT----FHNAYKNELYMRIALELPLKKLLIGGFQGAYEIGRVFRNEGVDTRHNPEFTMVEAYKAYSDYHGMAELVEKLFERFIQIPPFRRLSLPEEWKAKTGEDIHNILDGKRFNRALAKRLHIECGPDTTSAKIFDRIMDEKILADLQ--QPTFVFDHPTAITPLAKCKPGDECLVERFEFFAGTEEIANAYSELNDPEDQKSRLVEQLQQQEENNGEADILDKDFIVAMEYGMPPMGGIGIGIDRVTMLLTGKPSIREVVLFPLLR. 493
257 0.000e+00UniRef50_A0A0F6YJX1 Lysine--tRNA ligase n=2 Tax=Sandaracinus amylolyticus TaxID=927083 RepID=A0A0F6YJX1_9DELT  ali  29  162.GLTDVEKRYRERYVDLFAN---PAVARVFHARSRIVRALRSFLDGRDFLEVETPLL-HPLRGGAVAKPFETH----HNELDMKLYLRIAPELYLKRLLVGGFDRVYEIGRAFRNEGVSTRHNPEFTILEFYCAYATYEDLRTEMHARAPEWWLDEPFARVDMREAIGDLLPTPFDGALTRELLDDPTELHATIELAKSHTHGERVFVLYEVLVEPDLPKSVPVFVMHHPFDVSPLARKSDRDPFITDRFELFVEGREVANAFSELNDPDDQASRFRAQLDRRTKGDEEAMDYDADYVRALSHGMPPAGGFGLGVDRLVMMLCGQASIRDVLLFPAMR. 566
258 0.000e+00UniRef50_A0A0L0G023 Lysine--tRNA ligase n=1 Tax=Sphaeroforma arctica JP610 TaxID=667725 RepID=A0A0L0G023_9EUKA  ali  23  157..LKDTGIRFRQRYLDMMVNPQ---TIQSIKVRSKMLRYLRDYLDRHRFIEVETPILND-VAGGANARPFITEADS--GANKQPYKLRIAPELYLKQLVIGGLDRVYEIGKVFRNEGVDSTHQPEFTTLEFYEAYGDFETLISRTQDIIQEINFGKPYNRIEVMSELQKHLGPIDLDSPDERLMNFCEEHGIQSHLTSTRSHATLIDKLIGHFIEPQ--CVNPTFIIYHPKIQSPLAKERPEEPNTCYRFELFVRGQEICNAYVELNNPVEQRQRFKAQEKDFNFGDSEAQLPDEGFCTALEYGLPPTTGWGMGLDRMLMLLTNNTQIREVQTFPQMK. 518
259 0.000e+00UniRef50_A0A1G0JRK5 Elongation factor P--(R)-beta-lysine ligase n=1 Tax=Gammaproteobacteria bacterium RIFCSPLOWO2_12_47_11 TaxID=1798301 RepID=A0A1G0  ali  47  1................MKTKWQPAVSFEMLLARARLLEKLRKFMNKHGILEVETPILVDAAVSDPHIESFETALQYPGGRHIRKHFLHTSPEYAMKRLLASGSGPIYQICRVFRDNEIGKYHNPEFTMLEWYRPEYDHHQLMDELDELLQVLNFKPA-QKKTYAEVFKEKTDLDPHTTALVELQKTATDYGYTAQGDE---RSVLLDFIFSHCVCDHLGHECPHMIYDFPVVQSALARIRHSDPPVAERFELFIHGLEIANGFHELCDAGEQKKRFVQDNLQREKSGKPEVFIDEKFIEALKYGLPPCAGVAVGVDRLLMAMHHCTDIREVIAFPVDRA 319
260 0.000e+00UniRef50_A0A2S9F0E1 Lysine--tRNA ligase (Fragment) n=6 Tax=Mycobacterium TaxID=1763 RepID=A0A2S9F0E1_9MYCO  ali  27  426.GLTDQEARVRARYVDLAVN---TDARELIKARSGVLHAIRETLVGKGFLEVETPILQQ-IHGGANARPFLTHI----NAYDLDLYLRIAPELYLKRLCVGGVERVFELGRAFRNEGVDFSHNPEFTLLEAYQAHADYNVWIDGCRELIQNVDISGEWAVKTVHGAVSEALGEHVDETDLPTLRRLCDRAGI--PYLTHWDAGAVVLEMYEHLVEDQTQ--APTFYKDFPTSVSPLTRPHRSVPGIAERWDLVAWGVELGTAYSELTDPVEQRRRLQEQSLLASGGDPEAMELDEDFLQAMEYAMPPTGGLGMGVDRVVMLITG-RSIRETLPFPLAR. 772
261 0.000e+00UniRef50_D6ZB64 Lysine--tRNA ligase n=1 Tax=Segniliparus rotundus (strain ATCC BAA-972 / CDC 1076 / CIP 108378 / DSM 44985 / JCM 13578) TaxID=640132  ali  27  755.GLTDPEAKVRLRHVELMTNPQ---ARDALAKRGAVLRTLREQLWGEGFLEVETPVLQR-VHGGANAEPFRTHI----NAYDLPLYLRIAPELYLKRLLVGGMERVFEIGRVFRNEGVDATHNPEFTLLEAYQAHSDYRGMRDLTEQMLRASAQAVPWPMIPMLTAVSQALGDEVDEHTPAAKLRQHLVERGFECRPDWDS-GQLLLELYERLVEHTTTT--PTFYSDFPLSVSPLTKQHPDRPGVTQRWDLVVGGMELATAYSELNDPVEQRRRLQAQSEAAASGDPEAMELDEDFLAALEHAMPPSGGLGVGVDRVVMLLTG-RTIRETLAFPLVK. 1089
262 0.000e+00UniRef50_D2SH05 Lysine--tRNA ligase n=7 Tax=Geodermatophilus TaxID=1860 RepID=D2SH05_GEOOG  ali  27  153.GLSDVETRYRQRYVDLEVNER---TRQVFRIRHAAVRAIRRHLEDRDFTEVEGPVL-QTIQGGASARPFVTH----SNALDLDLYLRIALELHLKRLIVGGLERVFEIGRVFRNEGVDTRHNPEFTLLEAYQAFGDITDMMELTEGLVTAAARAAPWPRKRFADMIAEATGTMHPAMPIDDARAVLDRLGI--PYEASWGAGRLMKEVYDEKV--QHSVVGPVFCVDYPREVSPLARVHRDDPAYVERFELIVAGFELCNAYSEQNDPVEQLAAFEAEARAKSHGDPEAGDVDTDYVRALECGMPCTGGLGIGIDRLVMLLAGVDSIREVILFPTLR. 497
263 0.000e+00UniRef50_A0A2M8ESA0 Lysine--tRNA ligase n=1 Tax=Candidatus Shapirobacteria bacterium CG_4_9_14_0_2_um_filter_39_11 TaxID=1974478 RepID=A0A2M8ESA0_9BA  ali  26  149.GLRDPEILYRQRYLDLLTN---PETRRRFEIRTRVVKNMRLILDSYDFTEVETPIL-QTEASGASAKPFITH----HNALDLDLYLRLAPETYLKRLLVGGLERVYEIGRNFRNEGIDASHLQDFTMLEFYAAYWNARKNLAFTENLIKEVDFSGTWPIRTYREVVLRHSGVDIDEASSQELREIIKERNIPIEKMDSLNLGQLIDKLYKTTTRPYL--IDPQFLVEFPTSLSPLARGMDKKPGYVDQFQLLVGGWEVAKGYSELVDPIEQRKRLVEQATLRREGDEEAMPLDEDYIKAMEYGMPPNSGVGIGIDRLVVILTETENLRNIIFFPLTR. 493
264 0.000e+00UniRef50_A0A1D3D5S4 Putative lysyl-tRNA synthetase n=1 Tax=Cyclospora cayetanensis TaxID=88456 RepID=A0A1D3D5S4_9EIME  ali  29  179...............................LRSKVIRFMRDFLEDNGFVEVETPMM-HPIFGGANAKPFITH----HNDLKTDLYMRVAPELYLKMLTVGGMEKVYEIGKNFRNEGIDMTHNPEFTACEFYWAYADYNDTMKLTEEMLSAMDFTPPFRRLCLVEEIEKQAGVTLPRLDGPECLEFMKSLIKKHELPNPFTPAKALDSLGGRFVETQ-CTTKPTFIIEHPQVMSPLAKWHRSKPELTERFELFLMGKELCNAYTELNDPKKQRECFMDQAKARDQGDDEACPIDENYILALEYGLPPTSGWGLGIDRLTMFLSDQITIKEVILFPSMR. 506
265 0.000e+00UniRef50_A0A075V4S8 Lysine--tRNA ligase n=112 Tax=Actinobacteria TaxID=201174 RepID=A0A075V4S8_9PSEU  ali  26  756.GLTDPETRVRQRYLDLAVN---PDSTAMLRMRSTVVRAVRERLHQGDYLEVETPML-QTVHGGANARPFITHI----NAYDMRMYLRIAPELYLKRLCVAGVERVFELNRNFRNEGVDATHNPEFTMLEAYQAYADYNTMRTLTRELVQCAAEAAYWPVIPVHEAVSAALGEKIDASTSVAELQRLCRAAG-VPVNEDAGHGDLVLKAHEHLVEG--ATVLPTFYTDYPTDVSPLTRQHRVDPRLAERWDLIAFGSEVGTAYTELTDPLEQRRRLEAQSLRAASGDVEAMELDEDFLLALEHGMPPTGGLGIGVDRLLMMLTGA-SIRQTVLFPFVR. 1102
266 0.000e+00UniRef50_A0A2H9QI95 Lysine--tRNA ligase n=3 Tax=unclassified Archaea (miscellaneous) TaxID=93506 RepID=A0A2H9QI95_9ARCH  ali  24  144.GLKDEENRLRKRHLDAIMN---PELIETFKKKTRIIKTVREFMDKQGFLEVQTPIM-QLIYGGASAEPFKTH----HNTLNTDFYLRISTEMHLKRLIIAGFEKIYEIGPTFRNEGMDSSHLQEIPHFEFYWAYQDYEELMKFTEKLMTYFDFTTPYQRISFRELLLKNAGIDIDDCSTYESLKKEIIKKKIPDIDAEKHYGALLDELYKRTCRPKIK--QPTFLTNYPVEMIPLAKRNESDSSKINTVQLLVNGWELVKAYDELNNPLDQRSRLLEQQEFLKKGDKEAHPLDEDFIEAIEQGMPPTAGFGLGLDRLCMFLLNQPSIRASVFFPLMK. 490
267 0.000e+00UniRef50_A0A1F9V9P1 Lysine--tRNA ligase n=2 Tax=unclassified Elusimicrobia TaxID=1797919 RepID=A0A1F9V9P1_9BACT  ali  30  163.GLKNIELCYRYRELDLISN---PESRTLFEMRAKIIQSLRSLLYKEGYLEVETPMI-QALAGGAVARPFET----FHHALNQKFYLRIAPELYLKRCLVGGFEKVFELGRVFRNEGIDTLHNPEFTILEAYEAYGNMESMMELTQRLIVETAKNVSSPNLNLKTPFESYTLGELFQKHVGSEEAIWVKEQNWKKFSEKYSNEKIFDRLFSEKIAPHL--VNPTFVTEFPADFSPLAKCVEGSTQLADRFELYIQGEELANAYSELNDPMEQKLRIEKQNKTKKAQTDEGVVLDTSFIESLEIGMPPAGGLGIGVDRLVMFLTGQNSIRNVLLFPTLKS 508
268 0.000e+00UniRef50_A0A1M3BMA7 Lysine--tRNA ligase n=1 Tax=Solirubrobacterales bacterium 70-9 TaxID=1895833 RepID=A0A1M3BMA7_9ACTN  ali  27  168.GVTDAETRYRRRYLDLILDEP---SRRVFQIRSAVISATRRTLLDKGFREVETPVLLD-QAGGAAAKPFITH----HNALDIDMTLRIALELNLKRLIVGGMNRVFEIGRVFRNEGVDTRHNPEFTLLEAYQAFGDYEDMMDLTEAIVEACCIEAIGTTVVTINGKEVDLKPPWRRATMAELIEENAAAKMHPSMPDVWGSGKIMAEVYDDSSEHLL--VEPTFVLDHPREVSPLARAHRDDPTLTERFELVVAGRELANAYSELNDPVDQAERFQKEADLQAGGDEEGEPVDNSYVEALEYGLPPTGGLGIGLDRLVMLISGAEAIRDVILFPTLR. 510
269 0.000e+00UniRef50_A0A1Y5PGT3 Lysine--tRNA ligase n=106 Tax=Actinobacteria TaxID=201174 RepID=A0A1Y5PGT3_9MYCO  ali  27  746.GLQDPEARVRARYVDLAIN---AEARDLIRARSNVLHSIRETLFTKGFLEVETPILQQ-IHGGAHARPFKTHI----NAYDLDLYLRIAPELYLKRLCVGGVERVFELGRAFRNEGVDFSHNPEFTLLEAYQAHADYRVWIDGCRELIQNAAIAANWAVKTVHDAVSEALGEHIDAETELTDLRRLC-HAAHIPYLTHWDAGAVVLELYERLVEE--ATEAPTFYTDFPASVSPLTRPHRSKPGVAERWDLVAWGVELGTAYSELTDPVEQRRRLQEQSLLAAGGDPEAMELDEDFLQAMEYAMPPTGGLGVGVDRVVMLITG-RSIRETLPFPLAK. 1094
270 0.000e+00UniRef50_A0A0D2X2W4 Lysine--tRNA ligase n=2 Tax=Capsaspora owczarzaki (strain ATCC 30864) TaxID=595528 RepID=A0A0D2X2W4_CAPO3  ali  27  255FKLTDPDIRARQRALDMLANPQL--IPRMLKTRHAIFRSIRRMMDAQGFIEVETPSLC-ALAGGANARPFITKARAISG---HPLNLRIAPELYLKQLVIGGIDRVYEIGKQFRNEGMDADHHPEFTTMEMYQAYANFDDLFDFTESLLVSTLFQRPFKRISIMPALEEALGEPLPDLTATQDLINLFERRKFHGLPQPPTIPKMIDELVSLFLEPQ--CINPTFLCYHPKAMSPLARESPENPALSLRFELFVNGFEICNAYAELNNPHEQRARFAEQAKARDAGDDEAQPMDSAFCDALEYGLPPTVGWGMGLDRLVMLLTDSANIREVIPFPMLR. 628
271 0.000e+00UniRef50_A0A0G0IN59 Lysine--tRNA ligase n=1 Tax=Microgenomates group bacterium GW2011_GWC1_38_12 TaxID=1618512 RepID=A0A0G0IN59_9BACT  ali  30  145.GLKDVEERYRKRYLDLILN---ESVKERFDIRGRVVSSIREFLDARGYKEVETPTLQP-VYGGGFAKPFITH----HNALDSDFYLRISDEMYLKRLIVGGFEKVYEITKVFRNEGVDYDHNPEFTMFEAMLVEA------------------------------VKEYAGIDPLSWSFEEAKESAKKLVVKEEKEHMHTIGEVAAFVFEELVEEKL--IQPTFIYDYPIEVSPLAKKC-DDERFTQRFEMFAAGTEFGNNYTELNDPVDLSKRFIEEKKREKAGFEEAHQTDYDYLTAIEYGFPPTCGVAIGIDRIVMLFTDAQSLKEVILFPTMR. 445
272 0.000e+00UniRef50_A0A1G1V790 Lysine--tRNA ligase n=1 Tax=Candidatus Blackburnbacteria bacterium RIFCSPHIGHO2_02_FULL_44_20 TaxID=1797516 RepID=A0A1G1V790_9BAC  ali  25  136.GLKDTEERYRKRYLDLLLD---PEVKNRFDKRAKLIKETRKYLDDKGFIELETPTLQP-LYGGANAKPFKTRV----NVLDQEFYLRIADELYLKRLVIGGYEKVFEICKDFRNEGLDLTHQPEFTMMEFYEAFADYNTIMERTEGLFKHLAQEVKWRRIEMSEIIKETLRLDIEEETEESLKNYCEENNIELVGGEA--KGQLIFTIFEHKITDNL--IEPTWVIDYPKEVSPLSKDHRSKPGWVERFEGYIGGKEICDGWSELTNPIEQXXXXXXXXXXXXXXXXXXXXXDEDFLEAMEYGMPPLGGIGIGIDRLSMFFTNTWSIKEVVLFPLMR. 477
273 0.000e+00UniRef50_L8PQP3 Lysine--tRNA ligase n=4 Tax=Actinobacteria TaxID=201174 RepID=L8PQP3_STRVR  ali  28  429.GLADPEARVRMRYLDLVSS---PAARDVVRARSTAVQALRQGLLERGFLEVETPMLQQ-IHGGANARPFHTHI----NAYDLDLYLRIAPELYLKRLCVGGLEKVFELGRTFRNEGVSYKHNPEFTMLEAYQAYADYDVMLDLTRELVQEYDLSGPWPVKTVYGAISEALGDEI-GPDTELLRLHRHCDRAGVPYTGDDGHGDIVLEMYERLVEVKTQL--PTFYKDFPTDVSPLTRQHRQDPRLAERWDLVAFGTELGTAYSELTDPVEQRRRLTAQSLLAAGGDPEAMELDEDFLDALEYAMPPTGGLGIGVDRLVMFLTGL-TIRETLPFPLVR. 770
274 0.000e+00UniRef50_A0A2D6Q3S7 Lysine--tRNA ligase n=2 Tax=Bacteria candidate phyla TaxID=1783234 RepID=A0A2D6Q3S7_9BACT  ali  25  139..LEDVEERYRRRYLDMLMN---PRVKEVFEKRSQIINSVRKFLEEKDYIEVETPVL-QTIYGGGRARPFKTH----HNTLDIDIYLRISTELYLKRLIAGGLEKVFEIAKVFRNEGMDRSHNPEFTMLETMEAYADYMDNMDLIEEMFEYVDFKRPWERIKLEDLFKEHTGVGIHEIDTLKKATTLAKK-LGVEVRDFMTDGEILLEIFEKKCTDQL--VQPTFVYDYPADFYPLAKRKADNPKLVESFDIYVAGMEMGTNWSEQNDSQVLXXXXXXXXXXXXXXXXXXXXXDTDFLDMLEYGMPPTSGIGPGLDRWVMILTDSPSIRDVILFPTLR. 481
275 0.000e+00UniRef50_A0A2W6B399 Lysine--tRNA ligase n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2W6B399_9CHLR  ali  29  141.GLADVETRYRRRYLDLISN---EESRRILTIRSKLTRDLRRYLDACDFIEVETPILQP-LYGGAAAAPFVTRYE----SLDTEVYLRIADELYLKRLIVGGLERVYEIGKDFRNEGFSRKHSPEFTMLELYQAYADYSDMMNLLEDMLSSVAQSALGTQKLTFDEHEIDLTPPWRRMSLFDAMAQFAAEARSVDMAPNATRGNLIEHLFSALVEPHL--IQPTIIYDYPVDFSLLAKRKKDDSTLAERFEMFVGGIEIANAFTELNDPFDQRERMRDASGLR---GDEHQEVDADYLLALEHGMPPTGGMGFGTDRLTMVLTGAHHIRETILFPLLR. 482
276 0.000e+00UniRef50_A0A2H0TYV6 Lysine--tRNA ligase n=2 Tax=Candidatus Magasanikbacteria TaxID=1752731 RepID=A0A2H0TYV6_9BACT  ali  26  144.GLNDEESRYRKRYLDFLVN---PEEKAKIVVRGKILRYLREFLQNENFIEVETPVL-ETISSGAMAKTFDTHL----NAYDLDVHLRICGELWQKRLLVGGFEKTFEMGRAFRNEGVDHQHNPEFTMLEYYWAYADYEDNMTLHEKMIPYVVFIGPYPRITFHDAVLKYSGIDIDEFTDLEELKKVMSAKGY-DHENLTERGKLLDNLYKQSARKEL--IQPTFVLNYPIELKPLAKKAK-DPRYTEMFQLIVNGFELSNSYTELNDPIDQRERFEEQVKNKEEGDDEAMANDWSYVEALEHGMPPATGTGIGIDRFAALITGSHTLREVTAFPLMK. 486
277 0.000e+00UniRef50_A0A2G6I7F1 Lysine--tRNA ligase (Fragment) n=1 Tax=Sorangium cellulosum TaxID=56 RepID=A0A2G6I7F1_SORCE  ali  29  12.GLSDVELRYRHRYVDLVAN---AEARSIFRARTLVVRALRSFLDERGFLEVETPTMN-ALVGGAAAKPFKTK----HNAFDMELFMRIAPELYLKRLVVGGFERVYEVARCYRNEGLSTRHNPEFTMLEFYMAYATYETLMDMTEEMFRYVDAYLAFERRTMRDLFRDRVGLTVQALADAALMKQAFEKAQQDKISDCESHGERLFLLYELLVEPDLARSIPVFVTDYPVEVSPLARRQTGDSNLVDRFELFVHGRELCNAFSELNDPEDQAARFRAQVAKKDRGADETMDYDEDYIRALEHGLPPTAGFGVGIDRLTMSLTAQDSIREVILFPLMR. 403
278 0.000e+00UniRef50_A0A1L4D1E3 Lysine--tRNA ligase n=1 Tax=Silvanigrella aquatica TaxID=1915309 RepID=A0A1L4D1E3_9PROT  ali  25  136.GIEDIETRYRQRYLDIIMNN---ESRDVFKKRFEIVKALRRYLEDSGYHEVETPIL-QTTPSGALARPFFTH----HNALDIDCVMRIACETYLKRCIGAGIDKVYEFARSFRNEGISATHLQDFTMLEFYASYWNSDKMRLFVEGMMNEIDFSGEWPVYEYSFLVQRDSGIDIKKYTRESLAEQIKAKNIRLDDDINTSWANMVDSLYKKVSRPKL--IQPCFLVKYPVEMAPLARRNSKEPQYVDFFQFLVNGVELVKAYSELVDAIDQRERFEEQMQAREHGDDEAMPIDEEFLTAMEHGFPPIAGVGIGIDRLTMILCGCENIKDTVLFPLLR. 481
279 0.000e+00UniRef50_A0A2E5UF68 Lysine--tRNA ligase n=15 Tax=Planctomycetes TaxID=203682 RepID=A0A2E5UF68_9BACT  ali  29  162.GISDAELRYRXRYVDMYTN---PETIXTFKKRSDIIRAIRSYMETDRFVEVETPMMQP-LAGGAAARPFSTH----HNALDIPLFLRXAPELYLKRLLVGGMRKVYEINRNFRNEGVSKKHNPEXTMLEAYEAFGDCETMLELTEGMVHEVDYNKPXDRISYGDLFERALGFSMC----DEASVRAKGSELHIDGSDSMDQWLLVSEIFDACVEETIDPTRPTFVTDYPSAISPLTRPHADNDSLSHRWELFIXGMEIANSYTELNDPDLQLQRFTEQLDGADDEVQAXRTLDEDFIHALRVGMPPAGGLGVGXDRLVMLLTSNESIRDVVLFPXM.. 502
280 0.000e+00UniRef50_A0A2D6VN11 Elongation factor P--(R)-beta-lysine ligase n=40 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A2D6VN11_9GAMM  ali  58  1.................MSNWQPSADIETLRERAVIXRRIREFFYARDVMEVETPSLSAASVTDVHLVTFSTEFVGPGHAGGLPLYLQTSPEFAMKRLLAAGSGAIFQLCKAFRNEEAGSHHNPEFTMLEWYRPGFDEFALMDEMDELMQLVLGVESAERLTYQQAFMNALGVDPLTADISTLQQLATAQGFADIAANETHRDTLLQLLFCMKVEPTIGQEKPCFVYHFPASQAALAQICQHDERVAGRFELYFKNMELANGFNXLTNGKEQAARFSEDNQYREANGLKQVPMDERLIAALEHGLPQCAGVALGXDRLIMLATNKQKIKDVLAFDVERA 324
281 0.000e+00UniRef50_A0A063YHQ5 Lysine--tRNA ligase n=70 Tax=Bacteria TaxID=2 RepID=A0A063YHQ5_9MOLU  ali  27  145.GLIDIEDRYRHRYVDTIVN---EKARNTFILRTKIIKLIREYFDNLDYLEVDTPVL-HPILGGAAAKPFVTFY----NALNHNFYLRIATELPLKKLIVGGYERVYEIGRIFRNEGVDTTHNPEFTSIEFYEAYSDVWGMMDRTEELFRFITKKLNFKKLNIVEALNEKLGIDLRKLNDKDAKELAKKHNI--KWQSYYKLGHLINELFEKYIEETL--IQPTFVYGHPIEISPLAVKDPEDPRFTLRAELFINKKEFANMFTELTDPIDQXXXXXXXXXXXXXXXXXXXXXDWDYINALEYGLPPTGGCGIGIDRLIMLLTQNDSIREVLLFPQLK. 485
282 0.000e+00UniRef50_M8BR39 Lysine--tRNA ligase n=1 Tax=Aegilops tauschii TaxID=37682 RepID=M8BR39_AEGTA  ali  22  190YVLRDQETRYRQRYLDLMVNH---EVRHIFKTRSKIVSFIRRFLDGLDFLEVETPMMNM-IAGGAAARPFVTH----HNDLNMKLYMRIAPELYLKELVVGGLDRVYEIGKQFRNEGIDLTHNPEFTTVEFYMAYADYNDLMELTEAMPIEIDFTPPFRRIDMIEGLEAMAKLEIPDISSDETNKYLIDACAKYDVKCPPPQTTTRLLDKLVGHFLEETCVNPTFIINHPEIMSPLAKWHRSRPGLTERFELFVNKHEVCNAYTELNDPVVQRQRFEEQLKDRQSGDDEAMALDETFCTALEYGLPPTG.............................. 515
283 0.000e+00UniRef50_D6GV50 Lysine--tRNA ligase n=3 Tax=Candidatus Parvarchaeum TaxID=662758 RepID=D6GV50_PARA5  ali  26  138YGLEDTEKRFRKRYLDLIINR---ESMEKIKKGSIMVSKIREILGKKGYTEVVVPILQP-IPGGANAKPFITHY----NSLDRDFYLKIASELYLKRLLVGGFEKVFDISKNFRNEGIDTRHNPEFMMLEAYQAYGDLSSMLELTEEIIKEAIYAANGTYSIKFGEKNIDFS-KFEIKTMEEMVKEKTGVNNDQEDSKVESYGEAINAIFEAEISDNI--INPVFVTKFPIEVSPLAKNMEDDPRFVYRFELYIAGMEIANAFSELNNPIEQIKRFEEEARRKNKGIDETQEFDKDVIEALGYGMPPTGGVGIGIDRIQMLGTNSKSIKEVIPFPQLR. 472
284 0.000e+00UniRef50_A0A2L0EN74 Lysine--tRNA ligase n=19 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A2L0EN74_SORCE  ali  29  194..FKDVEARYRMRYVDLVAN---PHVAGVFRARTAIVAALREFLDARGFLEVETPTM-HTLVGGAAAKPFKTH----HNALDLELFMRIAPELFLKRLVVGGFERVYEIARCYRNEGLSTRHNPEFTMLEYYQAYATYETLMDATEAMLRHVDARLRFARVPMAEGLARALERSGLPADVPQRVAADDAPIKEWAKKKCESPGELVFCAYEYVVEPFLTRDYPVFIIDYPFEVSPLARKKDSDPALVDRFELFIEGRELCNAFSELNDPEDQDARFRAQVAKKSRGEEETMDYDADYVRALEHGLPPTAGFGMGIDRLTMLLTGATSIRDVILFPLLR. 568
285 0.000e+00UniRef50_A0A1I3HI75 Lysine--tRNA ligase n=1 Tax=Planctomicrobium piriforme TaxID=1576369 RepID=A0A1I3HI75_9PLAN  ali  28  143.GVTDIETLLRHRELDLI---YTSGVRDKLLLRSKILNSVRQTLGGQNFVEVETPVL-HAIAGGAAARPFKTH----HNALDLQLYLRIALELHLKRLMVGGIERVYEIGRVFRNEGIDATHNPEFTMIEIYQAYGNYETMMDLTEAIVTNIDFSPPWPRRTYADLFREHAGCDMTNLEAVQEKAREQARLGHIKPDGHIHPDVVVSEVFEACVEDKL--VGPIFVIDYPASICPLTKRQAGNPLIAERFELFIHGMELANAYTELNDPKLQEQLFLTQLEGLSEEDSMA-KMDMDFIQALKVGMPPAGGLGIGIDRLVMLLTNSHTIRDVIYFPLLR. 504
286 0.000e+00UniRef50_A0A0G3EFD9 Lysine--tRNA ligase n=2 Tax=Kiritimatiellaceae TaxID=1921783 RepID=A0A0G3EFD9_9BACT  ali  31  145.GLQDVETRYRRRYLDLMSN---DDVRELFRKRTAMMDALRRMLRDRGYLEVETPMIQP-LAGGAAARPFKTRYQ----ALGADMYFRIAPELYLKRLIVGGLDRVFELNRNFRNEGLDRTHNPEFTALELYEAFGDRNTMQRLAQDLIAGVAEEIFGSLTTEWYGHEIDLTPPWREVTFESLLERAEAEKRGIEVEPDWSVCKIAQEIYEHEIEPHLT--APTFVTRLPAELVPLAKPCDDDPRFVDVFELVIGGREIAPAYSELNDPAEQRRRFEAQ-----AGGDPS-KIDVDFLESLEYGMPPTGGMGIGIDRLFMLLTGSEAIRDVILFPQMRA 481
287 0.000e+00UniRef50_A0A0U0S3E5 Lysine--tRNA ligase n=14 Tax=Bacteria TaxID=2 RepID=A0A0U0S3E5_MYCTX  ali  27  132.GLLDPEARVRTRYLDLAVN---AESRALITARSSVLRAVRETLFAKGFVEVETPILQQ-LHGGATARPFVTHI----NTYSMDLFLRIAPELYLKRLCVGGVERVFELGRAFRNEGVDFSHNPEFTLLEAYQAHADYLEWIDGCRELIQNVDISGIWPVRTVHDAISEALGERIDADTGFFTLRKLCDAAG-VPYRTQWDAGAVVLELYEHLVECR--TEQPTFYIDFPTSVSPLTRPHRSKRGVAERWDLVAWGIELGTAYSELTDPVEQRRRLQEQSLLAAGGDPEAMELDEDFLQAMEYAMPPTGGLGMGIDRVVMLITG-RSIRETLPFPLAK. 485
288 0.000e+00UniRef50_D8M8H7 Lysine--tRNA ligase n=2 Tax=Blastocystis TaxID=12967 RepID=D8M8H7_BLAHO  ali  28  164..LKDPDVKYRKRYLDLLIS---QHTRQVFYTRSKIIQLIRSFLTAEGFLDVETSILS-GLAGGAVATPFVTRSQ----SQNRDLALRISPELALKELVVGGLDRVFEMGKVFRNEGLDSKHNFEFTSVEAYMAFHDYTDWMRLTEKLLHHVCFAPPYRRIDVQEELERILGPLPDENSIPELLAICEKQQV--KVNPPVTLPRVLDALIGRFIEPQ--CVQPTFIMNHPAVMSPLSKVNEAT-GKSERFELFVNGVEIVNAYTEQNDPVKQEMSFAKQGEQRAIGDKEIPPADLTFLNALEYGLPPTAGWGMGVDRLVMLMTNQSSIRDVIFFPVLK. 506
289 0.000e+00UniRef50_A0A1F9TW74 Lysine--tRNA ligase n=2 Tax=unclassified Elusimicrobia TaxID=1797919 RepID=A0A1F9TW74_9BACT  ali  29  144.GLKDPEARARQRELDLLSN---EDSRAVFASRSRIIQTLRTLLAARDYMEVETPMMQQVP-GGAVARPFET----FHNALKQKFFLRVAPELFLKRCLVGGFEKVYEIGRVFRNEGIDTFHNPEFTILEAYEAYGNIDTMMDLTEYLVTDKCRKKPFARRSIPELFKEYVGKDYTAFMDEH---------------------KAFDHAFDEKIVPHLT--EPTFVTDFPAELSPLAKLRADNPRLTERFELYVDGGEIANAYSELNNSEEQRRRLVEYRKSRTQGSEEGMGLDESFIEALEYGMPPAGGLGIGVDRLVMLFTGQTSIRNVLLFPTLK. 461
290 0.000e+00UniRef50_F8L9N0 Lysine--tRNA ligase n=1 Tax=Simkania negevensis (strain ATCC VR-1471 / Z) TaxID=331113 RepID=F8L9N0_SIMNZ  ali  27  411.GLTDKGTRYRKRWLDLITH---QDVMERLKMRSFLVSNIRKYFEESGFMEVETPVL-QNIYGGAEARPFISEL----NALHQTMYLRIAIEISLKKLIVGGLSRVFEIGKVYRNEGLDRTHNPEFTMLEAYAAYWDYNDVMIFTENLFHEIDLKTPWKRLSMKDAIKLYAKCDPDKMSEAEMRTKLKAKIEDEDLQKA-PRGKLIAYLFEEFAEEHL--IQPHHIIDHPIETTPLCKLHRDEEQFVERFETFILGYEFCNAYSELNDPELQRQLLVEQNVKREGGDVEANPMDEEFIEAICQGMPPTGGLGIGIDRLTMLFTDAFSIRDVIYFPMMR. 763
291 0.000e+00UniRef50_A0A1Y1W9N7 Lysine--tRNA ligase n=1 Tax=Linderina pennispora TaxID=61395 RepID=A0A1Y1W9N7_9FUNG  ali  27  181.GLTDTQKRFRNRHVDLLVNPQ---AKHNLVTRAKVLKYIRSYLDTRDFTEVETPVLSPN-VGGASAKPFVTTAAAFGNSR---MFMRVAPELFLKQLVIGGMDRVYEIGKQFRNEGVDADHNPEFTTCEFYQTYATLDDLMAMTEEMLRGMAHAVPFRRIDVTQFLRDKLPGLPNDFSSPDALPQLLDLKNNLSAPQPHTVPRLLDRLIGHYIEP--LCQQPTFLIGHPSIMSPLSKCTDDSAQVSARFELFVNGKELVNAYEELNNPNEQRAKFMVQATERAAGDEEVPEMDQAFCDALEFALPPTGGWGMGVDRVVALLAGVRHLRETIAFPVMK. 533
292 0.000e+00UniRef50_A0A0G1A9G0 Lysine--tRNA ligase n=33 Tax=root TaxID=1 RepID=A0A0G1A9G0_9BACT  ali  25  148.GLKDIETMYRKRYLDLITN---KETFDRFKFRSDFIWELRKFYVENGFLEIDTPVLS-NTASGALAKPFTTHY----NALDLDVYLRIAPELFLKEAIVGGFDRIFEVARVFRNEGMDSSHLQEFTMIEHYAAYWDFEDNMRFTEKMLTEVDFSGPWQRVSFRELLLQDCNIDIDAFPTEDLREEIKKKGINIVDIEKLGRGNLIDSLYKKVSRPKL--VKPVFLINHPLDLSPLARKNDTNPLIVDRFQLVINGWEILNAYSELIDPIDQNERFDFQTKAKLGGDEDAMTKDDDYVEAMEYGMPPISGWGMGLERIVALLTQQKNLRDVVMFPLLR. 497
293 0.000e+00UniRef50_Q4JCI5 Lysine--tRNA ligase n=55 Tax=Thermoprotei TaxID=183924 RepID=SYK_SULAC  ali  27  152.....PEFRYAHRYVDFLYNDL---ARRNMEIRYSTIRRIREFLYSKGFMEVETPILQP-VYGGALAKPFMSHV----NYLNENWYLRISLELYLKRYIVGGFNKVFEIGKVFRNEDIDVTHNPEFTLLELYWAYADYNDIMRLTEEMLQDVVKNIQFRKITMIDSLTEVLGKDVDKMSDEELKSLMDKNGL-KPRGNMYIRGLMIEKLFDKLVTPTL--IQPTFVLDYPVETTPLCKPHRSKQGLVERFELYVAGMELANAYTELNDPIIQDMLFKQEQEMFKRGDEEAHPYDVDFVRALSYGMPPTGGLGIGIDRLIMLLTNNMSIKEIIPYPMLSA 494
294 0.000e+00UniRef50_A0A1W9R7N6 Lysine--tRNA ligase n=4 Tax=Bacteria TaxID=2 RepID=A0A1W9R7N6_9BACT  ali  28  123..LKDVEVRYRQRYLDLISN---PTSAQVFLGRSKVISFIRDFFAKEEYIEVETPML-HPLAGGASGKPFVTR----HLSLDCDVYLRIAPELYLKRLLVGGFDKIYEINRSFRNEGLSSRHSPEFTMLEAYCAYQNYEYMMEVCEKLFSSLLEYLYGRLEINYQGYSIDFTPPWLRVSLAEILEEELGIKSSDSKEKAIKKMRNYFRLTEDLMEKRYSRTKPVFVTDFFTWASPLAKRKKDNPNLVERFELFIAGLEIANGYSELNDPIEQRRRFEEHLEFEEELLKK---IDEDFILSLEYGMPPAVGLGIGIDRLVMLLFNQPSIKDVILFPLHR. 464
295 0.000e+00UniRef50_A0A2A4YDH6 Lysine--tRNA ligase n=1 Tax=Candidatus Aerophobetes bacterium TaxID=2030807 RepID=A0A2A4YDH6_9BACT  ali  25  166.GLADKGTRYRKRWLDLISS---SEVMNVFQMRSSIMRLTREHLHQEGYMEVETPIL-QNTYGGAEARPFTTHI----NALDQDMFLRISIEIGLKKLIIGGLSKIFEIGKVFRNEGIDKTHNPEFSMLELYAAYLDYNDIMCLTENLFAHIAKKLFWKRMTMKDSIKTYADLTVEKMSDEEMKKHLLDKTGADPKKNTAPRGILIAMLFEELVEEHL--VQPHHIIDHPVETTPLCKWHRDEKGMVERFETFILGYEFTNAYTELNDPIVQRDLLEQQAVKKDAGDDEAHPMDEEFIEAMCQGMPPTGGLGIGMDRMTMLFTGVSSIRDILYFPIMK. 520
296 0.000e+00UniRef50_B2KAS9 Lysine--tRNA ligase n=4 Tax=Elusimicrobia TaxID=641853 RepID=B2KAS9_ELUMP  ali  26  148.GVQDTEIRFRNRHVDLIAN---EDIKEIFVKRSKIISSIRKTLDGLGYLEVETPTLTPD-AGGAIARPFET----FHNALKMPLYMRIALELYHKRLIVGGLDRIYEIGKMFRNEGIDTTHNPEFTMMELYQAYGDVNTMADVFEAVLANAAEKPPYERVSMPEAWQKYVGEDIHNILDGRDFKRAEAKRLGLKVDEEESSGKIFDMIFDERII--VNYTNPMLMMDYPTAVSPFSKTKEGDSAIVERFEAFVCGSELGNAYTEINDPADQAQRLKDQAAQKAKDNEDNSEIDTAYIEALESGMPPTGGMGIGIDRMIMLLTGQDSIREIVFFPLLK. 495
297 0.000e+00UniRef50_F6FFJ6 Lysine--tRNA ligase n=4 Tax=Mycoplasma TaxID=2093 RepID=F6FFJ6_MYCHI  ali  26  135YGIKDKEIQLRNRVVHCLVD---QDVFNTFKFRAKIIRYIRNFLDDRGYLEFETPIL-ESNYGGANAVPFRTHYK----ALKSDFFLRIATEISLKKIIISGFSKVYEIGRVFRNEGIDSTHNPEFTSIEIYTVNHGLDEVMDLTESLFKHISFKEPFRRVSISDLLKEKISVDFYNDDISLERAKLAQEYDVHVEKHQETVGHIFHLLFEELVEKDL--VDPTFVTGFHKDVSPLSKADPQNPNFTLRYELYIGGKEFSNGFAELNDPDDQLERFKKQVEERDLGNEEAFDVDYEYIEAMKYGLPPTGGIGIGIDRLVMLFTEKKSIKDVIFFPQLK. 479
298 0.000e+00UniRef50_A0A2E7RMP6 Lysine--tRNA ligase n=11 Tax=cellular organisms TaxID=131567 RepID=A0A2E7RMP6_9BACT  ali  32  148.GMSDVELRARMRYVDLFAN---EGIRPHFLKRSAVLSSIRNTLAQHNYNEVETPVL-HPIYGGANARPFHTH----HNTLDMGLYLRIAPELYLKRLLVGGLERVFELARVFRNEGISNRHNPEFTMLEFYEAYADFSIMADRTEQIVVEAARATPFQRIRYADAFLEHVG--IEATDREALVERLKTEGIEVTGEGDYFWWKAVNNLFERFAEPQLR--GPVFVTHYPAAICPLAKPSAEDPTWAERFEFFLGGMELANAFSELNDPEQQLENFERQVQD---SDEEAPAVDYDYVRALAYGMPPAGGCGIGIDRLVMILLGSDSIRDVLLFPLMR. 492
299 0.000e+00UniRef50_A0A2E3WL56 Lysine--tRNA ligase n=4 Tax=Bacteria TaxID=2 RepID=A0A2E3WL56_9BACT  ali  27  149.GXTNVETRXRQRYVDLISN---DEVKQIFLQRSQIVNXIRNFXVNKGFLEVETPXL-HTVAGGAAAKPFKT----YHNTLDMDLILRIAPELHLXRLVVGGMEKVFEIGRNFRNEGISTQHNPEXTMIELYEAYSNYEXMMXMIEELVXSCVXLYSNDRKIVYQEKEIDFXGPWXRVHMIXWLDXILKXADKMKINHFDLPGKAITEIFEEKXLK--GVLXPVFVYGFPIDVSPXARRNNDXPMIAXRFELFVNEKEIANAFSELNDPEDQFDRXNKQLELKSKGDDEASDMDEDYINAXRFGMPPTAGAGLGIXXLVMLLTDSPSIREVILFPHMR. 487
300 0.000e+00UniRef50_R1F8A9 Putative Lysyl-tRNA synthetase n=1 Tax=Emiliania huxleyi TaxID=2903 RepID=R1F8A9_EMIHU  ali  33  199.GLADVNKRYRQRYLDMIVN---PRVRATFAARARITAYLRRYLDERGFLEIETPCLNAQP-GGAEAKPFET----YHNALGLDLTLRIATELYLKRLVIGGVERVYELGRIFRNEGISTRHNPEFTSIELYQAYADYEAHDRPPGELVAGAARHVAGGTSVEYQGASIDLAPPWRRVTMAEL----------------------------ELCEPEL--VQPTFVLDHPTE---------------ERFELFAVGRELANAFSELTDPVDQRARFEAQAAKKAAGDEEACGVDEDFLTALEHGMPPTGGLGIGIDRLVMLLTDSPSIKDVIAFPLLR. 482
301 0.000e+00UniRef50_A0A1E2ZIQ7 Elongation factor P--(R)-beta-lysine ligase n=137 Tax=root TaxID=1 RepID=A0A1E2ZIQ7_9GAMM  ali  47  6...................DWRPSASVEMIRARAEMLSHIRRFFDQIGVIEVETPVCSRFAATDPAIESFNTRYTGPEAVQGLDLYLHTSPEFPMKRLLAAGSGPIYQICKVFRNGELGRRHNPEFSLLEWYRPGLDYHQLMDEVANLINRTARPLQTEKLTYAQAFERWLGMNPHAADLDHLRQCAVDQGISGAEQAIEGRDGWLDLLLSHLIEPQLGQHGMTFLYDYPASQAALAQVREDRYPVAERFELYIGGMEIANGFQELTNAGLQRKRFNEDNRRRGSSRQAEVPMDEALLDALVAGMPECSGVALGLDRLLMVLTGTHDIRQVVTFDIGRA 327
302 0.000e+00UniRef50_A0A2H0ULF3 Lysine--tRNA ligase n=12 Tax=Patescibacteria group TaxID=1783273 RepID=A0A2H0ULF3_9BACT  ali  24  139YGVKDIETRLRQRYLDLLMN---PELRQMFRQKSIFWQKTRDFLTNEGFLEVETPVL-ESTTGGAEARPFATH----HNALDIEMYLRISLELPQKRLLVGGFEKTFEIGRVFRNEGMDADHLQDYTQMEFYAAYHNYNDLMRISEKLINEIDWSGEWKTIDYCDEFKKETGIDIADCNLEQLQEKAKELGIKFEKNDGMGR--LIDSIYKRTVRAKV--IQPVFLIHHPVIISPLSKRVEKEPHKTERVQLLAGGSELTNGFSELNDPIDQRERFEQQAKLREEGDDEAQMMDEDFVIALEHGMPPAAGFSYS-ERLFAVLMDKP-IRETVFFPTLR. 479
303 0.000e+00UniRef50_A0A142XN76 Lysine--tRNA ligase n=2 Tax=Gemmata TaxID=113 RepID=A0A142XN76_9BACT  ali  30  146FGMGDIEFRLRHRYLDMI---YTPDTLRRAHQRVKIIRTIRTHLDAQGYMEVETPTL-HAIAGGAAARPFETH----HNALDIDLFVRIALELPLKRLLVGGIEKVYELGRVFRNEGISPRHNPEFTMLELYQAYGDYRSMMDLTEGLIVACVFEPPFQRAKYADLFHEHVGCDMTDEVAVRAAARAENIELEMAPTKGAPKVALVQELFEDLVEEKL--VGPVFVYDYPSPLCPLTKRKRENPAIAERFELYVHGMELANAYTELNDPITQEQTFTQQLAGLSDEDSMA-KMDHDFIRALRHGMPPAGGLGIGIDRLVMLLTNTQTIRDVILFPLLR. 494
304 0.000e+00UniRef50_A0A1N4IJ28 Lysine--tRNA ligase n=2 Tax=Actinobacteria TaxID=201174 RepID=A0A1N4IJ28_9MYCO  ali  26  189.GLSDPEAKVRQRYLDFTMNTGQ---RDLMVIRSNTFRTIRETLQSRGFLEVETPVL-QTVHGGANARPFLTHI----NAYNLDLYLRIAPELYLKRLLVGGFDRVFEMGRNFRNEGVDATHNPEFSMLEAYQAGGDYNTMRELTRTMVHEIDLAEEWRTVSLTDAISEKIGEEVSTATSIETLRRIAARTG-LTVNPKWGWGMLLQEIYEEVAEG--STVAPTFYTDFPAETSPLTRQHRTDPMLAEKWDLIIFGSELGTAYSELVDPVLQRERLTAQSLAAAGGDPEAMQLDEDFLTALEYGMPPAGGMGMGLDRLVMLLTEQ-TIRSTITFPLAK. 534
305 0.000e+00UniRef50_A0A2N2EUD0 Lysine--tRNA ligase n=3 Tax=unclassified Elusimicrobia TaxID=1797919 RepID=A0A2N2EUD0_9BACT  ali  29  134.GLKDEEQILRKRYLDILTHER---SRNNFKARSRVISGIRKFLDEREFMEVETPIL-HGIAGGAEAEPFKTH----HNALDLDLSLRIAPELYLKRLLVAGYDRVYELGRNFRNEGISTRHNPEFTMLELYQAYSNCQGMMDLCEELIPAIDINKPFRRIAVFEALLEKTGINFENLERAFLAESASKLGIEFEKDASAP------KIFENLSEGILLETEPVFMHDFPEEFSPLAKPKPGT-KIADRFELYMNGMEIANAYSELNDPAKQRENFEAQVSDASAKN-----IDEDFLEALEYGMPPAGGLGIGIDRLVMVLIKSASVKDVIIFPQLK. 465
306 0.000e+00UniRef50_A0A2M7UIG8 Lysine--tRNA ligase n=1 Tax=Candidatus Peregrinibacteria bacterium CG_4_10_14_0_2_um_filter_43_11 TaxID=1974776 RepID=A0A2M7UIG8_  ali  23  186.GLKDREKCYRDRYLDMVMN---PETRKRFLVRSRFIQTLRDFYYEHGFVEIETPIL-ENVSSGATAKPFTTH----HNALDIDVYLRIAGELWQKTAVVGGFERTFEIGRVFRNEGMDPSHLQEFTMVEHYAAYWNYEDNMNFTEQMFEHLLFNTPWPRVEFYSLIKKDSGIDVHDFDNDDLCAVMKKKGIVIEEMDTMGFGSLVDHLYKKVSRPKL--IQPTFVIRHPVDMKPLARKSDDNSNLCDTFQLLVNGWEVINAYGEIVDPIDQRERFENQARAKAEGDEEAMSMNEEYLRCMEHGMPPMSGWGMGVDRLLTLLTHQDNLRDLVLFPLMR. 536
307 0.000e+00UniRef50_A0A2E1X464 Lysine--tRNA ligase n=7 Tax=Bacteria TaxID=2 RepID=A0A2E1X464_9BACT  ali  28  140..ISDREILYRRRYLDLISS---PESRQRFRLRRDFISALRKGLDEAGFDEVETPVL-QTKPSGALATPFETH----HASLDMPVYLRIAPETYLKRCVVAGFDRVYEFARVFRNEGMDPSHLQDFTMLEYYAAYWNYVDNMDFTEELLKEIDFSGPWPRLTLTELIEQYASINILEHTDAQLRAALDKAGIEIDDADKLGRGALIDLLYKKTVRPRIT--QPTFVTSHPVDLSPLARRNDDNSQISDRFQLVIHGWEVLNAYSELVDPIDQRARLEEQAQLNAEGDDEAMVMDEDYLLAMEHGMPPISGWGMGIDRMVALLSGAENLRDVVLFPLLK. 483
308 0.000e+00UniRef50_A0A0W0QX13 Lysine--tRNA ligase n=11 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A0W0QX13_PSEFL  ali  26  154.GLTDTEQRYRQRYVDLIVN---EDVRQTFRVRSQVIAHIRSFLMQRDFLEVETPML-QTIPGGAAAKPFETHFETHHNALDLEMFLRIAPELYLKRLVVGGFEKVFEINRNFRNEGVSTRHNPEFTMLEFYQAYADYEDNMDLTEELFRELAQLVPFVRLSVFDSILKYNPELTADDLNDIDKARAIAKKAGAKVLGFEGLGKLQVMIFEELVEHKL--EQPHFITQYPFEVSPLARRNDDNPNVTDRFELFIGGREXXXXXXXXXXXXXXXXXXXXXVADKDAGDDEAMHYDADFVRALEYGMPPTAGEGIGIDRLVMLLTNSPSIRDVILFPHMR. 552
309 0.000e+00UniRef50_A0A1Y0H9D4 Lysine--tRNA ligase n=1 Tax=Armatimonadetes bacterium Uphvl-Ar2 TaxID=2004468 RepID=A0A1Y0H9D4_9BACT  ali  28  148YGLTDTNVRFRHRHLDLITN---PDARRTLVDRSRIVTAVRRCFNAWGYLEVETPMLQQE-AGGAAARTFSAHY----NAYDLEVDLRISLELYLKRILCGDIPRVYEIGRVFRNEGVSNRHNPEFTLLEFYEAYADLEVMMQRVEDLFRTVATEVFWRRVDLLSAIEEHSGLTAEDLSSLQNAKAALKNRNVVNPEEERHLGGLIEKLLEVFVEPHLQ--EPSFVIGYPLETSPLAKKDPNRPGFTRRFEGYVLGREICNAFSEINDPIDQRERFQAQMAERASGDDEAHPMDEDFLYALESGMPPTGGCGIGMDRMVMLLTGARHIRQVMFFPMMR. 519
310 0.000e+00UniRef50_Q2JFY7 Lysine--tRNA ligase n=30 Tax=Frankia TaxID=1854 RepID=Q2JFY7_FRACC  ali  32  127.GLSNVEARYRRRYLDLLVN---AESRERFQTRANIIRRIRRLLDDNDFLEVETPILQEA-ASGAAARPFITR----HNALGEDFYLRISPETYLKRIVVGAYDRVYELGRNFRNEGMDSSHLQEFTMLEWYAAYWDYRDNMAFVRELILTVLDDVLGTRAVTYEGVKLDFGADWPEIDYRAEVERRTGIDLTVVRDLPTLRARLVDLLYKKTVRPDL--VQPCFLVHHPAELVPLARRSDTDPTALDMFQVVVNGVEIVKAYSELVDPAEQRQRLEEQAALREAGDDETMMLEEDFIEAMEYGMPPMSGLGLGIDRFVALLTGAPTLRDVVLFPTMR. 469
311 0.000e+00UniRef50_UPI000B53D02C lysine--tRNA ligase n=1 Tax=Haliangium sp. UPWRP_2 TaxID=1931276 RepID=UPI000B53D02C  ali  26  185...TDDDWRYRQRYADMIVH---PEAAEVFRKRATIVREMRHFFDERGYVECDTRMLLPT-NGGAAARPFRTH----MNVLNLDLNLRIATELDLKRLVVGGIDRVYEIGRIFRNEGLSRFHNPEFTTIEFYQAYATYADLMDLTEALFERLCLAVNFRRATMRQLVKQARPDAPDGPCTDAEWAALPGYAKQVLGDASPEYGHCLVALFERFVESSL--VQPTFVCEFPTVVSPLSRKNDRDPRFVDRFELFVVGKEIANAFSELNDPDDQRERFLSQVAAKQRGDHEAMDYDEDFCRALEYGMPPTAGEGIGIDRLTMLLCNQASIHDVIPFPQLR. 529
312 0.000e+00UniRef50_A0A0V0Y8S0 Lysine--tRNA ligase (Fragment) n=3 Tax=Trichinella pseudospiralis TaxID=6337 RepID=A0A0V0Y8S0_TRIPS  ali  28  461YGLKNQETRYRMRYLDLIINNN---VRSIFIRRAQILNYIRKYLDSIGFLEVETPMMNM-IPGGATAKPFVTH----HNELDRDLYMRVAPELYLKMLIVGGIDRVYEIGRNFRNEGIDLTHNPEFTMCEFYMAYADYNDLMKITEDLLSTIDFTPPYRKISMYFELEKKLNVPPKELVKEENRRFFDDLCLKHEVECPPPRTTARLLDKLVGEFIEIDCITPTFIIDHPQIMSP----HRTIPGLTERFELFVMTRELCNAYTELNDPVVQRERFEEQAKAKAAGDEEAQPIDEMFCNALEHGLPPTAGWGMGIDRLTMLLTDQNNIK.......... 851
313 0.000e+00UniRef50_A0A2U1FBG0 Lysine--tRNA ligase n=4 Tax=Actinobacteria TaxID=201174 RepID=A0A2U1FBG0_9PSEU  ali  27  173.GLADVETRYRQRYADLEVNER---TREIFRIRHAAVRAIREHLAGVGFTEVEGPVL-QSIQGGASARPFVTH----HNALDLDMYLRIALELHLKRLIVGGMERVFELGRVFRNEGVDTRHNPEFTMLEAYQAFADYHDMMDLTEGMVQEIDLRPPWPRQRFADMIADRTGVMHPDMPIDEARRILDGLGI--AWEQGWGAGRLMKEVYDERV--QHDVVGPVFCIDYPREVSPLARAHREDPAYSERFELIVAGFELCNAYSEQNDPVEQMAAFEDEAQAKRNGDPEAGDIDLDYVRALEYGMPPTGGLGIGIDRLVMLLASVDSIREVILFPTLR. 519
314 0.000e+00UniRef50_A0A293NF82 Lysine--tRNA ligase n=1 Tax=Phycisphaerae bacterium TaxID=2026778 RepID=A0A293NF82_9BACT  ali  30  172.GLTDQEARYRRRYVDMYTN---PETMQVFYGRSRIISCIRRFMEARDFVEVETPMM-QAIAGGAAARPFITH----HNALDMQLFMRIAPELYLKRLLVGGMPKVFEINRNFRNEGLSRRHNPEFTMLEAYQAFGDCETTLELVXSMCREVATMLAGSMVRPWGDLEIDWSKPFARRXYEDLVREGAGVEMRXXIXDAXTRXHWLLALFESRGEPLLDPSVPTYVTGFPXAVSPLTRPDADDPVVSHRAELFVAGMELGNFYTELNDPAVQLARFEDQLDGADDEVNAFRAMDRDFIDALEVGMPPAGGVGVGIDRLVMLMTNQSSIRDVVLFPLMK. 515
315 0.000e+00UniRef50_A0A1F5NAJ3 Lysine--tRNA ligase n=13 Tax=Bacteria candidate phyla TaxID=1783234 RepID=A0A1F5NAJ3_9BACT  ali  31  144.GLQDAEERFRKRYLDLLMN---TEVRERFQKRTKIILELRQRLQAEGFMEVETPQLQPLP-GGATARPFVTH----HNALDIDLYLRIAPELYLKRLLIGGYGKVFEIGRNFRNEGIDRDHNPEFTMLELYWAWQDYRGLMTFVQKL------------------LKKWLPGKWRTLTFSQLVKNPTE---------------------ENYKEARNKIKEPTFIIDYPEALMPLAKLKPENPKLTESFQLIANGAEVVKGFSELNDPLFQRQQMERQETEHRRGNEEASRLDEDFLEALECGMPPAAGLGLGIDRLAMLLTETKNIREIILFPTLR. 433
316 0.000e+00UniRef50_A0A1L6MZN1 Lysine--tRNA ligase n=3 Tax=Proteobacteria TaxID=1224 RepID=A0A1L6MZN1_9DELT  ali  28  154.GLTDTESRYRQRYVDLIAN---PHVADVFRARSYILNTIRKVLGDAGFLEVETPTM-HSLIGGAMARPFVTH----HHTLHMNLFMRIAPELYLKRLLVGGLERVYEIGRCYRNEGISTNHNPEFTMLEFYQAYVTYKELQDFSEFLLRSIDESLPFARVPMYQAVKEPWKTEISTWSQSSLRAKAINWSRFHDVWCQCSHGERLFVCYEFLSEPFLIEDYPVLIQDYPFETSPLARRNDQNPHLVDRFELFIAGRELCNAFSELNDPEDQAERFRVQLQKKEKGDEEAMDFDEDYIRALEYGMPPATGFGMGIDRLTMLLTNCSSIRDVILFPLLR. 541
317 0.000e+00UniRef50_A0A2V5RL94 Lysine--tRNA ligase n=2 Tax=Verrucomicrobia bacterium TaxID=2026799 RepID=A0A2V5RL94_9BACT  ali  32  175.GLQDIEARYRERYLDLLTN---DHSRAIFEKRVAIVRETRRFFEDRGFLEVETPIL-QTIAGGAAAEPFRTH----HKTLGLDLYLRIALELYLKRLLVGGFNKVFEINRNFRNEGISRKHNPEFTMLEAYWAYADFEKMANLVEELICYLAEKPPWRRARYHDVVREVAGKDWFELSSEQRRDRATNEFKLEILPQLADF-EVTHHVFEKLVEEK--TVDPLFVTHCPKELVPLAKQNAADNSLVDVFELIINGVEIAPGYSELNDPLVQRQRLLEQA------GEEKQKIDEEFLLALEHGMPPAGGIGVGMDRLTMFLTGAESIRDVILFPLLR. 517
318 0.000e+00UniRef50_A0A0G4IPN8 Lysine--tRNA ligase n=6 Tax=Plasmodiophoridae TaxID=37358 RepID=A0A0G4IPN8_PLABS  ali  30  116..LASPEARQRQRHLDLLVNR---DTVRRFRQRAAVVSCIRAFLDDRGFLEVETPVLW-STAGGANARPFETRGVALASALE----LRVAPELFLKQLIVGGLDRVYEIGKVFRNEGMDRTHHPEFTSCEFYMADANYEDLMPMTEALLAQVAFAGPFERLDVVGTIEKQLNLQPPDESKRQAALLDIASGAHLQIPAAPSSASLLEAMIAQRVEP--LCVSPTFLVNHPTLLCPLAKQSNDNGVLADRFELFVKGQELCNAYSELADPDEQRRRFKEQERLGGRATPEIAASQAEYCDCLEYGLPPTAGWGMGIDRLVMLLTGADHIRDVVLFPALRA 461
319 0.000e+00UniRef50_A0A124FQH1 Lysine--tRNA ligase n=1 Tax=Marinimicrobia bacterium 46_47 TaxID=1635279 RepID=A0A124FQH1_9BACT  ali  29  157..FSDKELRYRKRYLDLIVN---PAVREVFVQRANIMRWTREFFDARGYLEVETPVLQP-IYGGASARPFVTH----HNALDTDFYLRIADELYLKRLIIEYMMDLVEDYIRAVAEKSGRMT-------------------MKYSEE---TLDFSRPFARKAMFDLFEESLGQDIRDYDTSELKKLCKERGV--DVDPAWNYGQLIDELFSELVEPRL--ISPTFVIDYPKAVSPLAKTRRDNTRLVERFELYIGGFEYANAFSELNDPVDQRERLESQAKLRELGDLEAQVVDEDFLQAVETGMPPTGGVGIGLDRLVMLMTGQTSIKDVILFPAMR. 459
320 0.000e+00UniRef50_A0A0G1FGU3 Lysine--tRNA ligase n=2 Tax=Parcubacteria group TaxID=1794811 RepID=A0A0G1FGU3_9BACT  ali  25  138.GLKDTETKYRQRYLDLIAN---PESKKLFLFRSNVIKAVREFYWRNGFQEVETPTLLH-VATGAVANPYKTH----HTALNQDLFLRISHELPLKELIVGGFEKIFEIGKAFRNEGIDPSHLPEHTHLEHYSAYWNFEDNIAFTEKMFSYLFEKQPWPRYNFVELIKEKTGIDVLAYEAADLRSDIKKKNISFDGIDQMSLAGLMDNLYKKIVRPTL--INPTFLTTYPEILQPLARRNDENQNVVDQFQLVINGWEVVKAYSELVDPIDQQQRFAQQSEHKEQGEIEVMEGDDEYITSMKHGMPPISGLGMGLDRLVALLSGNSNLRDVVLFPLLR. 483
321 0.000e+00UniRef50_A0A2M8GVA3 Elongation factor P--(R)-beta-lysine ligase n=247 Tax=root TaxID=1 RepID=A0A2M8GVA3_9VIBR  ali  62  6....................WQPSATVERLQQRAGILASIRHFFAEREVLEVETPALSHATVTDIHLHTFHTRFIGPDYANGKKLYLMSSPEFHMKRLLAAGSGSIYQIGKSFRNEENGRYHNPEFTMLEWYRTGFDHHELMDEMDELLQMTLHCMPAERMTYQQAFLTVLKVCPLQAPMGELKHAAAELGLSDIADPEQDRDTLLQLLFSMGVEPMIGQQVPAFVYDFPASQAALARINRDDSRVADRFEVYFKGIELANGFHELDNPDEQLARFETDNRQRVGMGLTPQPIDYHLIEALKAGLPACAGVALGIDRLVMLALGCDHIEQVTAFAFPRA 324
322 0.000e+00UniRef50_A0A2M8EJ22 Lysine--tRNA ligase n=1 Tax=candidate division WWE3 bacterium CG_4_9_14_0_2_um_filter_48_10 TaxID=1975078 RepID=A0A2M8EJ22_9BACT  ali  25  139.GLKDVEERYRKRYLDLILN---PEIRERFNVVFKIVGSMRQFLLSEGYTEVLTPSLQP-LYGGTLARPFITRF----NALDADFYLRISNEMYLKRLIVGGYEKVFEFSVDFRNEGIDTTHNPEFLQMETMWAYADYKDNMELAERMFAAIAKNPPWRRIPMVKAVEKETKVDWTKVEDLKDAK-AAAQKLGVDVRGKNLKGQILEEIFDTLVRPTI--IQPTLICNYPRDIMPLAKTVEDDLEYTENFEIFIAGMEFGLSYSEGNDPLLLRENFEAQAKLRREGQLETHPIDEGFLEALEYGMPPTSGLGVGMERLLMLLTNTSSIREVMFFPALR. 481
323 0.000e+00UniRef50_A0A0G1X1R1 Lysine--tRNA ligase n=2 Tax=Parcubacteria group TaxID=1794811 RepID=A0A0G1X1R1_9BACT  ali  30  146.GLKDDDERFRRRYLE---SVRDEAVRERFLMRSKIIQSIREFLLKRGFVEFETPVLQR-LAGGASAVPFETH----HKALDIPLYLRIAPELPLKMLLIGGFPKVFEIGRAFRNEGIDVTHNPEFSIVEWYEAFGSAEKAMGDVEKLLKNLVVEATGSAALPFGESEINLEKPFSIITYRELLTHYAGLSSDEIEKKS---AKELDALYKRLCRPRL--IQPTFVTEYPEEMLPLAKKL--KEGIVDAFQLIIGGYELVKAFSELNDPLDQRKRFEREARKKAQGDEETQPSDEEFLEALEYGMPPAGGVGIGIDRLTMLLTNTKNIREVIFFPTLR. 467
324 0.000e+00UniRef50_A0A0I9W5K2 Lysine--tRNA ligase n=3 Tax=Enterococcus cecorum TaxID=44008 RepID=A0A0I9W5K2_9ENTE  ali  31  116.GVTNKEIMYRQRYLDLIAN---EESRKVFLKRLEILSEIRRYFSSNKFLEVETPILNMT-SSGAAAKPFITH----HNSLDKDLYLRIAPELYLKQLMVGGFTKIFEIGKNFRNEGVDTTHLQEFTMIEWYAAYWDFNDNIEFSKELLCTVVRLVKWAELDYTSEMNRVLGIDILNVSLEELQKHCLKFNIIDDINKAKSTAALIDAIFKRKVRPYI--IQPTIVYNYPRIMVPLARINDEDERLIDMFQIIVCGMELVKSYSELINPFQQIVAFEEQEENKKNGDEESMDIDWEFIKAMEYGMPPMSGAGLGIDRLVALLLNKESLRDVIFFPNVR. 461
325 0.000e+00UniRef50_A0A2T7I6V3 Lysine--tRNA ligase n=1 Tax=Theileria orientalis TaxID=68886 RepID=A0A2T7I6V3_THEOR  ali  27  158FGLKDNEVRFRQRYLDIMMN---DDSMNVLKTRSRIIDYLRRYFKSKDFFEVETPML-KTTSTGASAKPFVTH----HNELDMSLFMRIAPELPLKLIIIGGFEKVFEIGKCFRNEGIDPTHNPEFTSLEFYWAYADYNDLIKTTEDLLSSLVFDLFGKYEVTYHEVVIDFTPPFERVSMIEELENNMKTKLSPPYDSEENPAKLIDQLVGHFIEDRI--VKPTFIVDFPQCTSPLAKWHRSKENLVERFELFICGKELINAYTELNDPITQRDCFKQQQKAKDLGDDEAQPPDEAFCTALEYGLPPTGGWGMGIDRLTMFLTDKNNIK.......... 503
326 0.000e+00UniRef50_A0A1W9RC25 Lysine--tRNA ligase n=1 Tax=Candidatus Omnitrophica bacterium 4484_70.1 TaxID=1970782 RepID=A0A1W9RC25_9BACT  ali  30  131.GLKDIEVKYRQRYLDLIAS---PDARQVFLKRIEIIEFIRDFFKKLGYKEVETPLL-HLIPGGARGTPFATYYQ----AIDTQVYLRIAPELYLKRLLVAGFDKIFEINKSFRNEGISARHSPEFTMLEAYCAYQDYEYMIKICEDLVSSIDFTPPWPRISFVEIFEKELGVFPSDSPEVVRKKLSEKLNISL---KELSRSQIINLV-EEWIERRLREEKPIFIVDFFSWMSPLAKTKKENPYVAERFELFIGGIEVANSYTELNDSIKQRENFEAQIKEEEGVKK----IDEDFLLSLEYGMPPAAGLGIGIDRLIMLLLNQASIRDVIFFPLLR. 468
327 0.000e+00UniRef50_A0A2A9FWU7 Elongation factor P--(R)-beta-lysine ligase n=34 Tax=Bacteria TaxID=2 RepID=A0A2A9FWU7_9VIBR  ali  61  1................MQPNWRPTASIEQLRQRARLIEAIRQFFAERQVMEVDTPAMSHATVTDIHLHTFQTEFVGPGYADGSKLFFMTSPEFHMKRLLAAGCGCIYQINKAFRNEENGRYHNPEFTMLEWYRVDFDHHKLMDEMDDLLQLVLKCAAAERLTYQQAFMDVLGVCPLDGTMTELKTAAGKLGLSDIAEQEEDRDTLLQLLFSVGVEKKIGQDAPAFVYDFPASQAALAKINLHDHRVADRFEVYFKGIELANGFHELDNPNEQLARFEQDNAKRVGMGLKPQPIDYHLIAALKAGLPNCAGVALGIDRLIMLALGCDHIDQVTAFPFPIA 323
328 0.000e+00UniRef50_R1DFC1 Putative Lysyl-tRNA synthetase n=2 Tax=Emiliania huxleyi TaxID=2903 RepID=R1DFC1_EMIHU  ali  24  226.GLADKETRYRQRYLDLIMN---PTTRSTFITRTRAINFLRRFLDMHGFLEVETPMMN-AIPGGATARPFITK----HNDLNLDMYMRIAPELYLKMLVVGGLDRAHATGRLFTAGGVASRHNPEFTTCEFYWAYADYEDPTTRTHCSPTRTGPHVECRGVSSHSLLCQVHGRAPLADDDTSATRPRHGLCAEHGVECKPPLTTYRLLDKLVGEFLESQCLHPTFITDHPKIMSPLAKDHRSKPGLTERFELFANYHEMCNAYTELNDPVEQRARFAAQARRKAAGDDEAMFVDDGFITALEYGLPPTAGWGMGIDRLCMLLTDNESIKEVLLFPAMR. 577
329 0.000e+00UniRef50_A0A2M8NKV2 Lysine--tRNA ligase n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2M8NKV2_9CHLR  ali  26  135YGLANEEQRYRRRYLDLIMN---KDVAEVFRKRSIIISSVRRTLERHGFLEVETPTLQP-LYGGANARPFITHINAYDG---MPMYLKISDELYLKRLLIGGFDKVYEIDKDFRNEGISYRHNPEFTMMECYAAYWDYTDIMRLVEEIYRDAAFRDPWERLTMKDGIRRHLAIDVDELSDAELAAELNRRRPAPGDAEPFNRGKAIAELFE---FTEDHYIQPTFIIDFPRETTAFCKPHRDDPTLIERLEPYIARMEVGNGYTELNDPVLQRQFMMDE------RGDDAQPLDEDFIQAMEYGMPPAGGLGLGIDRMVMLLTNQSKIRDVLLFPTMK. 487
330 0.000e+00UniRef50_A0A1Q7TI60 Lysine--tRNA ligase n=16 Tax=unclassified Verrucomicrobia (miscellaneous) TaxID=417295 RepID=A0A1Q7TI60_9BACT  ali  31  140.GLQDIEARYRQRYLDLITNDQ---SRAVFAKRFLIVREIRRFLEDRGFVEVETPML-QSVAGGAAAEPFATR----HKALGLDLYLRIAPELYLKRLLVGGFNRVFELNRNFRNEGISRKHNPEFTMLEAYWAYADFGKIADLVEEMICHVAEVLPWRRARYHDLMREVAGEDWFEISSEERRERAKDLGV--EILPQLADFEVTQHVFEKLVEEKSFD--PLFVTHCPKELVPLAKQNRQQPELVDVYELIINGAEISPGYTELNDPIVQRQRLLEQA------GEETQKLDEDFLLALEHGMPPAGGFGLGIDRLTMLLTGAESIRDVILFPLLK. 493
331 0.000e+00UniRef50_A0A1Y4DAN0 Lysine--tRNA ligase n=1 Tax=Elusimicrobium sp. An273 TaxID=1965617 RepID=A0A1Y4DAN0_9BACT  ali  25  149.GLQDTEVRFRKRHLDLIAN---EDVKDIFIKRAKIITSIRKTLDDKGFLEVETPILNPD-AGGAVARPFET----YHNALKMPLYMRIALELYHKRLIIGGMDKIYEIGHMFRNEGIDTTHNPEFTMMELYQAYGDVNTMADLFDEIGHEVDLRPPYTRVHIPEKWKEMFGRDIHEVLDGRQFNRAKAKEQGVKFTADDSDSDIFDELFEGKLLAE--YHNPVIAMDYPTAVSPFSKTKPGDPEIVERFEVFVNGQELGNAYTELNDPADQLQRLKDQAAAKAEDAKNADIVDADYIEAMESGMPPTGGMGIGIDRIVMMLTGQDSIREIILFPTLK. 499
332 0.000e+00UniRef50_A0A1V5RDG8 Lysine--tRNA ligase n=3 Tax=Bacteria TaxID=2 RepID=A0A1V5RDG8_9BACT  ali  30  1..............MDLIVN---DEVRETFRKRSRIISEIRKFLDAKGFMEVETPMMQP-LAGGARAKPFVTH----HHALATDLYLRVAPELYLKRLLVGGFEKVYEINRNFRNEGISVRHNPEFTMMELYQAYADYTDMMSITEELVRHLVMMLYWKRISFYGALEETTGMDFRKVNVRE-----AAKKLHVKFDEDMEDIDVLNEIFGEKVEKNL--WDPTFVVDYPTVMTPLAKAKAEDPELVYRFELFIAKMEVANAFSELNDPAVQRGRLEKQQELI----GEHKEIDDDFLMALEYAMPPAGGLGIGIDRLVMLLTNRISIRDVILFPQLK. 322
333 0.000e+00UniRef50_A0A0U1E0Q2 Lysine--tRNA ligase n=28 Tax=Terrabacteria group TaxID=1783272 RepID=A0A0U1E0Q2_9MYCO  ali  27  197.GLTDQEARVRARYVDLAVN---AEARDLIRARSGALHAIRETLYAKGFLEVETPILQQ-IHGGANARPFLTHI----NAYDLDLYLRIAPELYLKRLCVGGVERVFELGRAFRNEGVDFSHNPEFTLLEAYQAHADYNVWIDGCRELIQNVDISGEWAIKTVHDAVSEALGEHVTETDLATLRRLCDAAHI--PYLTHWDAGAVVLEMYEHLVEDR--TEAPTFYKDFPTSVSPLTRPHRSIPGVAERWDLVAWGVELGTAYSELTDPVEQRRRLLEQSLLAAGGDPEAMELDEDFLQAMEYAMPPTGGLGMGVDRVVMLITG-RSIRETLPFPLAK. 543
334 0.000e+00UniRef50_A0A261Y4C1 Lysine--tRNA ligase n=1 Tax=Bifiguratus adelaidae TaxID=1938954 RepID=A0A261Y4C1_9FUNG  ali  29 1330.GLKDPEKRFRNRHVDFLVNPQAS---NILRTRSKIIASIRHYLESKGFLEVETPILS-SQSGGANAQPFVTTAH----ALDMSMQLRIAPELYLKQLVVGGFDKVFEIGKQFRNEGIDADHNPEFTTCEFYYAYANLETLYSLTEDMVKDVAKSISFRRLHVLDELERVLGPLPPLDNTSESDAIQAAASHNLTIPKPHTLTRVLDKLISEYIEPQ--CIEPTFLYGHPVCMSPLAKAMTDNRGVSARFELFLQGKEIVNAYEELNDPQEQRERFAKQQLDRQSGDVEAQLPDAAYCDALEFGLPPTAGWGMGIDRLVAILTGAKHIREVLAFPVLR. 1682
335 0.000e+00UniRef50_F2UFY8 Lysine--tRNA ligase n=1 Tax=Salpingoeca rosetta (strain ATCC 50818 / BSB-021) TaxID=946362 RepID=F2UFY8_SALR5  ali  28  151..LTDVNLQLSERPLHMLVNQNF---KNTLLVRSQVLQALRSFLVSRGFVEVETPILGSQP-GGASARPFWTK----SNALDRDYALRVAPELYLKKLVVGGLPRVFEIGKVFRNEGIDRTHNPEFTSCELYQAYAPFEELFDLTEHLLRHVVQAVPFQRLAFVDTIEKATGTRVVDAHTGNVLPLPALADLCEQHDAPLTAASLLDRLAAHFIEP--LCVQPTFVYGHPTCLSPLAKQSQTQAGISDRFELYIDGKEIVNAYNELNDPDEQRSRFREQEAERAAGDDEAQVPDEDFCRALEYGLPPTVGWGMGIDRLIMLLTDTGNIRDVIAFP-MKA 498
336 0.000e+00UniRef50_J9D9S2 Uncharacterized protein n=1 Tax=Edhazardia aedis (strain USNM 41457) TaxID=1003232 RepID=J9D9S2_EDHAE  ali  27  191FGIKEPELIYRKRYLDLILS---TDSKARFLIRSKVINYIRNFLNERDFLEVETPMMN-LIPGGAAAKPFVT----FHNELKLDLFMRISPELYLKQLVIGGLNRVYELGKNFRNEGIDLTHNPEFTACEFYADCTDLEDLLNGMVKSISQTEKISYWPRIKMWTNFLSNFNLLPSNLEEMQDFLLYFIKREDIKSSQPFTLPRILDKLIGEFIEPQ--CTNPTFLTNHPLVMSPLAKKHRDDPFVTERFELFINGKEICNAYTELNDPFDQQKRFEEQVKDSEKGDDEAMKMDKGFVTALEYGLPPTAGWGIGIDRLVMFLANAANIRDVILFPAMK. 580
337 0.000e+00UniRef50_A0A0G1GVF5 Lysine--tRNA ligase n=6 Tax=Parcubacteria group TaxID=1794811 RepID=A0A0G1GVF5_9BACT  ali  26  144.GLQDVEERFRKRYLDLLMS---EEVRARFKLRSKIITSLRTILNDADYMEVETPLL-QSLAGGALAEPFKTH----HNALDIDLNLRIAPELYLKKLLVGGFPRVYEIGRNFRNEGIDMTHNPEFTMLEFYASYETCASQMEFVEKLVKTLVKNVKFAVASFLDLFKRYASIESPEAMSREDWRLASERFG-VKVEAHDSIEKIMDNIYKKACRPK--MIQPTFIINYPAGFSPFAKKQEKDPSLIDRFQLVIAGIEVVNAFSELNDPLEQKARYEEQDIKKKGGEGDVSPSDEDYLEAIEYGLPPAGGVGIGIDRVAMILSDTRNIREVVLFPTMR. 486
338 0.000e+00UniRef50_A0LRD0 Lysine--tRNA ligase n=77 Tax=Bacteria TaxID=2 RepID=A0LRD0_ACIC1  ali  28  158.GLTDPEARIRRRYVDLIVNSR---ARSMVHIRAAVLRSLRDTLSRRGYLEVETPVL-QLVHGGAAARPFRTHL----NAFDLPLYLRIALELPLKRLVVGGLERVYEIGRVFRNEGVDSSHSPEFTELEAYEAYGDYDTMADLVRELVLDAAKAIPWRTVTVHQAVSEAVGEEI-TVDTPAAVLHQIAARYNVPVPPAAEHGEVVCELFEKVAQPAI--VQPTFVRDFPASVRPLARPHRTDPRLAEAWDLIINGIELAPAYSELVDPVEQRRRLTEQSVRAAGGDPEAMQLDEDFLQALEYGAPPMGGLGLGVDRLLMLLTGSG-IRDVILFPLVR. 499
339 0.000e+00UniRef50_R5XU61 Lysine--tRNA ligase n=6 Tax=Alphaproteobacteria TaxID=28211 RepID=R5XU61_9PROT  ali  25  145.GLTDVETRYRKRYVDLIIN---DEAKEILLTRCRIVSAVREFFNGEEFLEVETPTF-HPIMGGANAKPFITHY----NALDNDFYLRVATELYLKKLVVGGIDRVFEIGKNYRNEGIDKNHVPEFTGLEAYMAYGDYNDMADLIYRLVRFVVNKVFGTDKLVLEGHEIDFSKPFPKVSIIDLIKRALAKSVGVDADHCSNWGKVVQEVFDEKVEHTL--IEPIHVSDMPKDISPLAKTHRDNPRLVEHFDTYLLGMELGCAYSELSNPLEQLERFKAQMAERENGDDEAQMLDESFIDALSYGFVPTTGMGMGMDRLAKLLTGAATLRDVILFPTLK. 487
340 0.000e+00UniRef50_A0A0K0F1X2 Lysine--tRNA ligase (inferred by orthology to a human protein) n=5 Tax=Opisthokonta TaxID=33154 RepID=A0A0K0F1X2_9BILA  ali  26  202FGLKNQETRYRMRYLDLIMN---PEVKNKFVVRSKIITFLRRYLDNLGFLEVETPMMNQ-IAGGATAKPFITH----HNELDLDLYLRVAPELYLKMLVVGGGCTVQQI-----HGTHKITYRPNGPETE-----------------PVYEVDFTPPFKRIDMITGLEDILKVKFPPADTPEARNFFDDLCKKHKVDCPEPRTTARLLDKLVGEYLESKCISPTFICGHPQIMSPLAKWHRSIPGLTERFELFAVTKEIANAYTELNDPLTQRKRFEEQAAQKAAGDDEAQLIDENFCTALEYGLPPTAGWGMGIDRLSMLLTDSYNIKEILFFPAMR. 512
341 0.000e+00UniRef50_B4H7D2 Lysine--tRNA ligase n=11 Tax=Eukaryota TaxID=2759 RepID=B4H7D2_DROPE  ali  28  170...................................IISYVRQFLDRLGFLEIETPMMNM-VAGGATAKPFVTH----HNELKMDLFMRIAPELYHKMLVVGGLDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYADVMDITEQLIQELDFTPPFKRVSMIKTLEEKLKVQFPSAETFNTRAFLSQLCVKHQVECPAPRTTARLLDKLVGEFIEEECINPTFICEHPQIMSPLAKYHRSAPGLTERFELFVAKKEICNAYTELNDPVVQRERFEQQANDKAAGDDEAQMVDENFCTALEYGLPPTGGFGMGIDRLTMFLTDSNNIKEVLLFPAMK. 494
342 0.000e+00UniRef50_A0A0G1A976 Lysine--tRNA ligase n=23 Tax=root TaxID=1 RepID=A0A0G1A976_9BACT  ali  27  150.GLSDVEIRFRQRYLDLLSN---PEVKEKALKRIQIVKSTRDFFDMEGFAEVETPILQP-LYGGATAKPFITH----HNALNTDLYLRIAPELYLKRLIVGGFEKVFEIARCFRNEGIDYSHNPEFTQIEFYWAYATYEDLMKLMEKFFSYLLPRLGMGLKFVYQGQEIDMTPPYPRKTFRELLIEYAKMDIEEELNKKDGRGKMLDDIYKHFVRPKI--IQPLFMTDHPVELSPLAKRQEKSPAYVERMQLLVGGFELCNGFSELNDPLDQEERLREQEELRKKGDEEAQRYDEDFVTALKHGLPPTAGLGMGIDRLSALLSDSHNLKEIILFPTLK. 493
343 0.000e+00UniRef50_A0A1S8VXC3 Lysine--tRNA ligase n=1 Tax=Batrachochytrium salamandrivorans TaxID=1357716 RepID=A0A1S8VXC3_9FUNG  ali  27  237..LLDENVRFRQRYLDMLVH---PNTVQVFKKRSKIITEIRSFLDRRDFIEIETPVLS-ATSGGANAKPFKTR----MDAMKLDLEMRIAPELYLKQLVIGGIERVYEIGKQFRNEGIDKTHNPEFTTCEFYQAFGTVEGAMKLTEDLMVEIDMSPPFRKIAILPALEEALGQSLPDASISQLLEICKEKNITLRAP--FTVPRILDRLISHFIEPR--CVQPTFLTGHPICMSPLAKAGTQ-EGIADRFELFIGTKELANAYLELNDPVEQRRRFVAQRLQRDQGDMEAQSMNEEFCVALEYGLPPTVGWGLGIDRMCMLLTQSTRIREVIPFPILR. 586
344 0.000e+00UniRef50_A0A0L0HKA9 Lysine--tRNA ligase n=1 Tax=Spizellomyces punctatus DAOM BR117 TaxID=645134 RepID=A0A0L0HKA9_SPIPN  ali  29  173.GLLDPETRFRARYLDLIANN---ETIHIFRKRAEAVQYIRNYLVSRGFLEVETPILG-AQAGGANARPFKTT----SNALGLDMFLRVAPELYLKQLVIGGIDKVFEMGKQFRNEGIDTTHNPEFTTCEFYQAYTDLESVMDMTEDLTIEIDFEKPFKRVDVLEALERSFGKVPDLEDPASTAALLICKTHNIRVSQPHTVARILDKMISTSIEPN--CTQPTFLLNHPVALSPLAKRSSPTSPTTSRFELFIASKELVNAYEELNEPSEQRQRFMEQARDREVGDLEAQVADEGFCEALEYGLPPTTGWGLGVDRLCMLLVGVRRIREVIAFPIL.. 525
345 0.000e+00UniRef50_A0A1E1J1H2 Lysine--tRNA ligase n=19 Tax=Trypanosomatidae TaxID=5654 RepID=A0A1E1J1H2_LEIGU  ali  25  259..LTDTDIKYRYRFVDMMSN---PSVLQHFRKRHAITRALRDYLDARSFIEVETPVL-HSVASGASARPFITH----HNANGADLFLRVAPELHLKQCVVGGMERVYEIGRVFRNEDADRSHNPEFTTCEFYAAYHTYEDLMVMTEEIMRHIDFEQPFRRVSAYDAVQEAAGVELPPPTELNAYMSAIMLRYNIPLPSVRTAAKMFDKLIDYFITDRV--VEPTFVTGHPLFMSPLAMEQRARPGLSARFELFINGIEYCNAYSELNDPQEQYYRFQQQLLDRQTGDDEAMALDETFLKALQAGLPPTAGWGMGIDRVVTLLNGSATIRDGILFPLLR. 612
346 0.000e+00UniRef50_D3F8H3 Lysine--tRNA ligase n=1 Tax=Conexibacter woesei (strain DSM 14684 / JCM 11494 / NBRC 100937 / ID131577) TaxID=469383 RepID=D3F8H3_CON  ali  26  167.GLTDPEARYRRRYVDLVVN---PRARAVFAARSVAISAVRRVLTERGFREVETPVLL-GQAGGAAAKPFLTH----HNALDIEMSLRIALELPLKRLLVGGMDRVFEIGRVFRNEGLDTRHNPEFTLLEAYQAFGDYSDMMELTETLVREIDLRPPFRRARMTDLIKEHGGVEMHPSMPVEEARAIADRFGVV-WMDVWGSGKILAEVCDELCESKL--IEPTFVMDHPREISPLARAHRDDPTLTERFELVVAGRELANAYSELNDPVDQAARFAYEAQQQAGGDEEAEPVDDDYVQALEYGLPPTGGLGIGIDRLIMLITGVESIRDVILFPTLR. 509
347 0.000e+00UniRef50_A0A1C3KUR6 Lysine--tRNA ligase n=9 Tax=Apicomplexa TaxID=5794 RepID=A0A1C3KUR6_9APIC  ali  23  200YGLKDTEIRYRQRYLDLIINEN---TRNTFITRTKIINFLRNFLNNNGFIEVETPTMN-LVAGGANAKPFITH----HNDLDLDLYLRIATELPLKMLIVGGIDRVYEIGKVFRNEGIDNTHNPEFTSCEFYWAYADYNDLIKWSEDFFSSLVFHLFGTYKILYNPIEIDFTPPYPKVSLIEELEKLTKIRLEQPFDSPETVNKMINIIKENKIEENLYPNKPFFIIEHPQIMSPLAKYHRCKPGLTERLEMFICGKEVLNAYTELNDPFKQKECFISQQKDREKGDTEAFQFDAPFCTSLEYGLPPTGGLGLGIDRITMFLTNKNCIKDVIFFPTMR. 555
348 0.000e+00UniRef50_A0A1G2VJ62 Lysine--tRNA ligase n=2 Tax=unclassified Parcubacteria group TaxID=1794840 RepID=A0A1G2VJ62_9BACT  ali  30  141YGLKDAEERYRRRYLDFLLNAEAAAPIER---RSEIVLAIREVLDGEGFREFETPIL-QAVAGGATARPFETH----SNALDRKLFLRVAPELYLKRLLVAGWEKVYELGKDFRNEGVDREHNPEFTMLELYWAYQDYSSLMKFVEKALAALLMKAPWPRVSFADVIKKYSGIDIYAASSDDVRQFLSKNNI--AFDNRLAKYELADEIFKKVARPFIFD--PLLVINHPKEISPLAKARPENPEETERFQLVMCGMEIVNGFSELNDPIDQRMRMELQEKLYRAGHPEVSRLDEDFIEALEYGMPPAAGLGIGIDRLVAILTDSHSIKDVMAFPLMK. 482
349 0.000e+00UniRef50_A0A2H0LK91 Lysine--tRNA ligase n=1 Tax=Candidatus Omnitrophica bacterium CG11_big_fil_rev_8_21_14_0_20_63_9 TaxID=1974749 RepID=A0A2H0LK91_9  ali  31  7.GLKDVEIRYRQRYLDLIANEP---VRQVFLKRAQLVSSLRRTLEQRGFIEVETPMM-HPLAGGAAGEPFVTH----HHALDADFYLRLAPELYLKKLLVGGLERVYELNRSFRNEGLSTKHNPEFTMLEAYQAYGDCVTMMDLVETLIKQAAQDVLGTLTFTYQGQAIDLSVSPPDSSLERIKQVLQEKKGITLKDFTRSQ---LVRLVEELFEPK-AQRAPLFVVDFWTELSPLAKAKADNPLVADRFELFLGGMEVANAYSELNDPIEQLRRFKAQLEGQGAGGRPEPRIDQDFIQALEYGMPPAGGLGVGIDRLAMLLLDQPSIKDVILFPLLK. 364
350 0.000e+00UniRef50_A0A1G2FZI3 Lysine--tRNA ligase n=1 Tax=Candidatus Ryanbacteria bacterium RIFCSPHIGHO2_01_45_13 TaxID=1802112 RepID=A0A1G2FZI3_9BACT  ali  25  143.GIQNVEERFRKRALDLLMN---KESRERFLERTKIIKSLRDFLDGNGFYEVETPILQP-LYGGALARPFTTH----HHALDMDLYLRVAPELYLKRLMVGNLRRVYEIGKCFRNEGIDVLHSPEFTMLEGYMAFEHYESLKVLMEKMIMAAVKEVKKKNSIVFDGKTITFKKPFRTMTFSESIKRYASKQFGVEMNRVYSRGKILDEIFKKVVRKHL--IEPTFITNHPIDISPFAKMSGQFPETALRFQLIAGGIELINAYAEINDPIEQRSRLIKQEQMFKEGDEEVSRMDEDYIETLEYGMPPTAGFGLGVDRLVQLLTDTHNIRDVILFPTLK. 485
351 0.000e+00UniRef50_A0A1F8JU92 Lysine--tRNA ligase n=2 Tax=unclassified Chlamydiae TaxID=1704234 RepID=A0A1F8JU92_9BACT  ali  28  171.GLQDLGVKYRKRWLNLITDQN---AVNTFILRNKIFKIIRNYLDENNFLEVETPIL-QNLYGGAEAKPFKTHI----NALHQDMYLRISIEISLKKLLVGGFQRVYEIGKVFRNEGIDRTHNPEFTLLEAYSAYWDYNDLMKFTENLFERVAIELTGSTKINFQDQEIDLKAPWKRLSMKEAIKDIGKFDVXXXXXXXXTRGNLISYLFEELCEEKL--IQPHHIYDHPLETTPLCKLHRNNEKFVERFESFILGSEFLNAYSELNDPVLQRELLLEQAKKREEGXXXAHPLDEEFIEAIAQGMPPAAGFGMGIDRLVMLFTNSPSIRDVIFFPIMK. 518
352 0.000e+00UniRef50_A0A2H0RQL1 Lysine--tRNA ligase n=1 Tax=Candidatus Peregrinibacteria bacterium CG10_big_fil_rev_8_21_14_0_10_55_24 TaxID=1974791 RepID=A0A2H0  ali  26  165....DVETQYRQRYLDLVVN---PEATKRFVLRSRCISAIRRFMEENSFMEVETPI-VDSLATGALAKPFGTH----HNALDIDCQLRIAPEIPLKKLIIGGFERVFEIGKQFRNEGMSPEHMQEFTTMEFYWAYTNYRQLMDFTEEWFRQVVGRTPWARKTFQELILDHVGIDVDMYPEQAALEVAANAKTGGDYTGKSTRGGTIDLLYKKHVRGNL--VQPTFILGHTADESPLARRNDDNPTLVDRFQVVMGGTEVVNAYSELVDPIDQRIRFEEQARAKAAGDEEAHAIDREYLRAMEHGMPPIAGWGVGVDRLIMMMTQQQNIRDVVLFPIMR. 505
353 0.000e+00UniRef50_A0A249DZZ7 Lysine--tRNA ligase n=5 Tax=Candidatus Portiera aleyrodidarum TaxID=91844 RepID=A0A249DZZ7_9GAMM  ali  28  148.GIKDQEIRYRHRYLDFIMN---KEVRKSFKIRTRIISALRNFFYELYFLEAETPIL-HSMPGGAIAKPFET----YNYSLNIKLYLRIAPELYLKRLVVGGFERVFEINKNFRNEGLSTWHNPEFTMLEFYWAFATYKDLMEITEHMIRFVANEALGTTIINIGKINIDLSEPFDCLSMRDSLIKY-GKTFSINNSDFYDLENLLFKLFEVIVERKL--IKPTFVTDYPVEVSPLARSKDSNLNITERFELFIGGREIANGFSELNDYIEQSNRFYLQLRNKYTYDLSN--FDMDYIRALEYGMPPTAGEGVGIDRLVMILTNKDSIRDVLLFPLLRS 493
354 0.000e+00UniRef50_A0A1V5FVF0 Lysine--tRNA ligase n=1 Tax=Alphaproteobacteria bacterium ADurb.BinA280 TaxID=1852793 RepID=A0A1V5FVF0_9PROT  ali  25  158.GMTDVEQRYRQRYVDLIVN---PEAREVFVQRSRIIRAIRNWLDERRF-------------------------DFHHNALDLQLYLRVAPELYLKRLVVGGLERVYEINRNFRNEGVSTRHNPEFTMLELYEAYASYHEIMDLTEAVIRHSSESVFGTTIRRWEGAEIDLGPAFRRWRMDEAVRHAHCARLNIKVKADYGWGRLLLEIFEKTVEAHL--VQPTFITHHPVEVSPLARESDSEPGITERFELFICGREIANGFSELNDAEDQAARFQAQVAQKEGGDDEAMHFDADYIRALEYGLAPTGGLGIGIDRLVMLLTNSTSIRDVLLFPYMR. 481
355 0.000e+00UniRef50_A0A1W9QLC0 Lysine--tRNA ligase n=1 Tax=Candidatus Parcubacteria bacterium 4484_255 TaxID=1970769 RepID=A0A1W9QLC0_9BACT  ali  32  102...................................FIKAIRQFFDKRGFFEVETPIL-QSLAGGATAKPFVTH----HKALNTDLYLRIAPELYLKRLIIGGFEKVYEVARCFRNEGIDRTHNPEFTQIEFYQAYADYNDLMALTEELMVFLLFKPPYPKLDFRQALIDNAGIDIDEYKFDDLVKQAKKLGL--KIDKTWGKGKILDGLYKEFVLSKI--IQPTFIVDYPIELSPLAKKILNRPNYVERFQLLINGTELCNAFSELNDPIDQELRFKEQQKLLEKGDKEAQRADKDFITALKYGMPPTAGQGIGIDRLVNVLTNTQNIREVILFPILR. 414
356 0.000e+00UniRef50_Q4Q7U2 Lysine--tRNA ligase n=12 Tax=Trypanosomatidae TaxID=5654 RepID=Q4Q7U2_LEIMA  ali  26  88..LADTGIKYRYRFVDMMSN---PSVVQHFRKRHAITRALRDFLDARSFVEVETPVL-HSVASGANAKPFVTH----HNANDADLFLRVAPELHLKQCVVGGMERVYEIGRVFRNEDADRSHNPEFTTCEFYAAYHTYEDLMTMTEEILRHIDLAQPFRRVNAYDAVQEAAGVPPTELSTPRGLAYMSAIMLRYNIPLPSVRTAAKMFDKLIDYFITDCVVEPTFVTDHPLFMSPLAMEQRARPGLSARFELFINGTEYCNAYSELNDPQEQYYRFQQQLLDRQTGDDEAMALDETFLKALQVGLPPTAGWGMGIDRVVMLLNGSSTIREDILFPLLR. 441
357 0.000e+00UniRef50_A0A2H0SWK1 Lysine--tRNA ligase n=1 Tax=Candidatus Pacebacteria bacterium CG10_big_fil_rev_8_21_14_0_10_40_26 TaxID=1974767 RepID=A0A2H0SWK1_  ali  29  163....NKEVRFRKRYVDMLIN---PDTKRILDARWLIEKEIRRFLDQHDFIEVETPILQP-LYGGTNATPFTTH----MDALDSDFYLRIAPELYLKRLIVGGYDRVFEIARNFRNEGIDQTHQPEFTMIEWYETYADYTRMMNVAEALVKHLTFKLYWPRVRMDEALKQHANIDFDSLSDEEVKALMKTHRI--ELKSEFTRGKALFELFDELVTPHL--IAPIWIVDYPRDISPLAKQHRTQPEFAERFEAYIGGKELADGWSEIVDAVDQRNIWENEQANMLHGDTEAHPLDEDFLEAMEHGMPPLGGIGMGIDRLVMFLTNTWSIKEVIAFPTLR. 502
358 0.000e+00UniRef50_A0A2H0B565 Lysine--tRNA ligase (Fragment) n=1 Tax=Candidatus Beckwithbacteria bacterium CG23_combo_of_CG06-09_8_20_14_all_34_8 TaxID=1974497  ali  27  77YGLKDVEERYRHRYIDMILN---QEVREKIINRSKVVQKIREFLLQEGFLEVETPIL-EITASGALANPFLTHIK----AYDMDLYLRICGELWQKKLMVAGFEKTFEIGRAFRNEGVDREHNPEFTMMEYYYGYADYLKNMEMQERLMGFVVKEVTGDYKVKIDDQEINFQPPYSRKTFAQLIKEATNIDIDSKIDPKWGRGHLVDEFYKEYVRPNL--IQPVFVTHHPRDLKPLAKADPNNPEYTQSFQLLANGFELSNNYSELNDPIDQAERFAKQSELDQAGDDETMTSDSEFVEALEYGMPPVSGTGIGIDRFVALITNSHHIREVIAFPLMK. 421
359 0.000e+00UniRef50_M2NJW0 Uncharacterized protein n=1 Tax=Baudoinia panamericana (strain UAMH 10762) TaxID=717646 RepID=M2NJW0_BAUPA  ali  23 1106YGFRDQEERHRNRHLDLIMNKR---TVDTFIKRTKIIRYVRNYLDSNGFLEMETPILMKN-AGGATAKPFMTH----HNDLNMMLALRIATELPLKMLIVGGFRKVYEVGRLFRNEGIDLTHNPEFTTCEFYERGADLYDTMNRTEELVEGMVKEICWKRIEMMPALEEACGEAFPQLHTEETNAFLKRMLAKTGVDCTPPLTNSRMIDKLVGEFIEEKCVNPTFITGHPQMMSPLAKYHRSLPGICERAEAFVCKKEIANMYTELNDPFDQRLRFEEQARQKAQGDDEAQVLDEGFLTAMEYGLPPTGGWGMGIDRMVMFLTNNYSIKEVLTFPFMK. 1460
360 0.000e+00UniRef50_A0A1Q5PWS3 Lysine--tRNA ligase n=3 Tax=Actinobacteria TaxID=201174 RepID=A0A1Q5PWS3_9ACTO  ali  28  705YGLKDPEARVRQRYLDLVLN---PEARDRLQARSRALQAVREQLLERDYLEVETPIL-QAVHGGANARPFITHI----NAYDMRLYMRIAPELYLKRLLVGGAPRVFEMGRNFRNEGADATHNPEFTMLEAYHAYADYHVMAATAQDLVHEVDLAEPWRRVSVHDAIGQAVGQEITPDTPQAELERLADR-LGISLDPRWSRGAVLTELYEHLCEAT--TVAPTFFYDFPAETSPLTRPHRQDARLAERWDLVVFGSELGTAYSELVDPVLQRQRLTEQSLLAARGDAEAMELDDAFLTALEYGMPPAGGLGMGLDRLVMLLTNT-SIRDTIAFPLVK. 1051
361 0.000e+00UniRef50_A0A2D5XZH7 Lysine--tRNA ligase n=10 Tax=cellular organisms TaxID=131567 RepID=A0A2D5XZH7_9ARCH  ali  25  147.GLQDEEERYRKRYLDTTIN---KEVKTVFETRAKMLSIMRTFMDEKGFIEIETPLL-QTVYGGALAEPFITHI----NAYDTDVFLSIAPELPLKKALVGGFNKVYEITKKFRNEGADRSHNPEHMTIEWYQSYADYNDGMDLVEELIKKLAKEVKWKRITLADAIQEHLGEDVSKIRTDDDAKKIAEKYNINPEE--ITKSNIQDELMKLFREK---LIQPTFLIDYPLESSPLAKPKESDPTKAEVFQPFIGGLEIARAYSELNDPKLQEEHFKEQEEEREKGTKETMPTDSDFVTALQQGMPPACGVGIGIERLVMLFTDNASIRDVILFPFMR. 486
362 0.000e+00UniRef50_A0A2E9CZM7 Lysine--tRNA ligase n=15 Tax=Bacteria TaxID=2 RepID=A0A2E9CZM7_9ACTN  ali  27  150.GLKDKETRFRQRYLDFVVN---EDAKNTISTRFXILXLIREFMTSEGFTEVETPTLQPK-AGGAIARPFSTH----HNAMNIDMYLRIAPELYLKRLIIGGFEKVFELGKVFRNEGVDQTHSPEFTMMESYEAYTDVNGVMDMVENMCQYVLENLKVDKSIEFNEKVADFSFPWDRKSMFELVNDKFEINVSHDSNESTTVGELVFDIFENYIEHDI--VDPVFVTDYPKEVSPFARESDEKEGITERFELFAFGSELANGFSELIDPVDQENRLKSQAEKKAEGDEEAHVEDSDYIEALEFGLPPTGGLGFGVXRFVMMITNNDSIREVIAFPHLK. 492
363 0.000e+00UniRef50_A0A1Q3MPU7 Lysine--tRNA ligase n=1 Tax=Armatimonadetes bacterium 55-13 TaxID=1895717 RepID=A0A1Q3MPU7_9BACT  ali  29  149.GLSDTELRYRHRHLDLIAN---PDARRMLLNRSRIVTAVRHYFDQAGYLEVETPLL-QLEAGGAAARPFLTHY----NAYDIDVKLRISLELYLKRIICGDVPRVYEIGRVFRNEGVSNRHNPEFTLLEFYESYANLEDMMVRVEELFKHIDFSKPWRRVSLLGEIERHTGLTAEDLSLENAKSALSDKNVVNPPDDEHNLGGLIEKLLEVFVEPTLQ--EPTFVIGYPIETSPLAKKDPNNPKMTRRFEGYIRGREVCNAFSEINDPIDQRERFEQQLGEREKGDDEAHPMDEEFIYALECGMPPTGGCGIGIDRMAMMLTGADHLREVLLFPTMR. 516
364 0.000e+00UniRef50_A0A1V6H1L1 Lysine--tRNA ligase n=1 Tax=Verrucomicrobia bacterium ADurb.Bin070 TaxID=1852927 RepID=A0A1V6H1L1_9BACT  ali  29  143.GLQDVEERYRKRYLDLMMN---PESRDRFNKRSAILAEIRNFLHARGFTEVETPMMQP-QAGGAAAKPFYTH----HNALDTEMVMRIAPELYLKRLIVGGFDKIFELGKDFRNEGIDRTHNPEFTVLEVYEAYGDRTSMKAIIEGLLPHLCFTPPYREIAYRDAVKQVMGDDWFELTVEQARAKAEAQGV--AIDPAWNHLLVTHEVYGKLVEKTLR--QPTFVTRIPRQFVPLAKACPDDPELVDVFEFVVAGKELCPGYTEQNDPLAQRKAFADQA------GDDPEKIDEDFITALEHGMPPTGGLGMGIDRLVMMLTGTEVIRDVILFPQMK. 480
365 0.000e+00UniRef50_A0A1G2PFF8 Lysine--tRNA ligase n=5 Tax=Parcubacteria group TaxID=1794811 RepID=A0A1G2PFF8_9BACT  ali  29  143.GLTDVEERFRRRYLDLLMSQG---NKNRFILRAKISNIIREQFIKDGFLEVETPTLQSVPA-GAAARPFKTHLA----ALDIPLYLRIAPELYLKELLVGGFDKVFEMGRMFRNEGMDATHNPEFTALEGYWAYQDAQGLMDYLEKFIIKVLDKSGVGRKMIFRDHKIEWNLSIPKKSFNEIVKTYAKIDLAHDIPKIKTESEFCEAVFKKMCLPHL--IQPIFVTEHPLALSPLAKKKAG-SDVADRFQLVVGGFELINGYSELNDPDEQRERFEKSEADIGKGAQEAQLGDEDFVEALEYGMPPAAGFGIGMDRLVMLLTDSANIREVILFPTMR. 483
366 0.000e+00UniRef50_A0A2D5YXI0 Lysine--tRNA ligase n=2 Tax=Planctomycetes TaxID=203682 RepID=A0A2D5YXI0_9PLAN  ali  30  165.GLQDAELRYRRRYVDLYVN---PEVRETFELRSRIVKRIRDFLTDPGFLEVETPMMQP-QAGGAAARPFVTH----HNALDMQLYLRIAPELYLKRLLVGGLHRVFEINRNFRNEGIDRNHLPEFTMLELYQAFGDYHSMMALSEQLIHTLAMELVGSAIVRFDEQDIDCSLPFRRARYHELFAEHAGAREAGVETEGKDHELILKDVWEHVVEPHL--VQPTFVMDYPAEMCPLTKRKADDPSVAERVQLYFAHMELVNAYTELNDPDVQATNFSSQIGGLDDEEQTFRATDEDFLEALRVGMPPAGGLGIGIDRLVMLLTGQRSIRDVILFPLMRA 510
367 0.000e+00UniRef50_A0A0G0H216 Lysine--tRNA ligase n=1 Tax=candidate division WS6 bacterium GW2011_GWA2_37_6 TaxID=1619087 RepID=A0A0G0H216_9BACT  ali  29  152.GIKDKELLIRQRYLDMIMS---PEKRQRFETAAKILFSIREFLNSKGFLEIKTPIIQP-VYGGSTARPFKTYI----NALGEDLYLAISHEIYLKRLVIAGFENVYNIVGYFRNEGIDRTHNPEFTMLETMTAFANYEDNMVLTEQLYNHIAKKVFWLKITMSDAVKKYAGVDFEKITLAEAHKVLDKAGVDDKEGKPKSIGECLFKLFEAKVENQL--IEPTFVYGHPIEISPLAKAMEQDKRFAERFEVYIGGIEAGDNWTELNDPVELFNRFKQQVDRRKSGDEEAHPMDVEFVEAMEYGMPPTTGLGPGIERLTMMFTETEYIDDVLFFPMQR. 496
368 0.000e+00UniRef50_A0A0G0MBN6 Lysine--tRNA ligase n=1 Tax=Candidatus Woesebacteria bacterium GW2011_GWB1_39_12 TaxID=1618574 RepID=A0A0G0MBN6_9BACT  ali  29  147..LEDVEEQQRKRHLHLMVN---PEEMETFRARSVIIRALRTFMEQEDFLEVETPVLQP-LRGGAIAKPFATH----HNALEQDMFLRIAPELYLKRLLVAGFNRVYEIGKNFRNEGIDTTHNPEFTMLEGYSIGMDYQQGMLLVESLLCYFDPEKPFKRIKFFDALTGI--GLPPDALPEESKQFAKRHGLDVDGCHY---AQVLDQIFKKLVVRK--TDEPTFFFDYPAETSPLAKQKTDDPLLVERFQFVWKRMELVNGYSEQNDPFLQRKAFEEQAKNSMAGDQEAMPIDEDYIEALEYGMPCACGFGIGVDRLCQLLLEKDNIRDVILFPTLR. 476
369 0.000e+00UniRef50_A0A1V0SAC0 Lysyl-tRNA synthetase n=1 Tax=Catovirus CTV1 TaxID=1977631 RepID=A0A1V0SAC0_9VIRU  ali  22  150..IVDVDVRYRKRYLDMIIN---DETMNIFIKRGKIIKFVRNYLDSLGFLEVETPILHQS-YGGANAKPFVT----YHNDLKQEMFMRIAPELNLKQLAIGGMDKIYEIGKQFRNEQNDATHLCEFLSLELYQNYANYTDMITLTENLMSELVKNINGDYQLKYNNETIDFTPPFNKIDTDITQYLQQKCVELKVKCHPMTIPKMLDKIIGHFLEP--LCKNPTFLMNHPSTMSPLSRRCDSNTHIAERFELFISGMEYANAYSELNDPKIQKSNFENQLKDKSNGDDEAQIPDLDFVTALEYGLPPCAGLGIGLERLIMLLTNCLNIKEVSTFPPVR. 495
370 0.000e+00UniRef50_A0A094PGY2 Lysine--tRNA ligase n=2 Tax=Actinobacteria TaxID=201174 RepID=A0A094PGY2_9ACTN  ali  27  150.GLSDPEARVRQRYLDLIV---RPESKNLVQLRSNAVASVREALRKRGFTEVETPML-QVMHGGANARPFVTHI----NAYDMKMFMRIAPELYLKRLLVGGIEKIFEINRNFRNEGADSSHNPEFTMLEMYEAYGDYTTMRNLTKELVLNAATAVYWESISVTEAISKAAGEQISIEMNPDQLKKIADQH-SISLKPNWDVGQIILEMYEHLVEDK--TVLPTFYTDFPQSVSPLTKAHRSNPLLAERWDLVTFGFELATGYSELNDPQDQRNRFLAQAKLAAHGDDEAMTMDEDFIRALEYGMPPAGGQGMGIERLLMTLTGKG-IRDTILFPLVK. 496
371 0.000e+00UniRef50_A0A1F4WQ27 Lysine--tRNA ligase n=2 Tax=candidate division WWE3 TaxID=422282 RepID=A0A1F4WQ27_9BACT  ali  24  138.GLDNIEERYRKRYLDLIVN---PEIRERFDRVSAILQSMRGFLLKEGYLEVVTPSLQP-LYGGTLARPFVTHF----NALDADFYLRIANELYLKRLIVGGYEKIFEFSVDFRNEGIDTTHNPEFLQMETMWAYANYRDNMAFAERMVSSIAKEVLGKTKIIYQGQTIDLTPPWKRVRIVEAVAQEAAKKVGVNAAGKKLKGEILEEIFDQRVKDKLF--QPTIIHDYPRDISPLAKPVKDNPDYTERFEVFIGGGELANSYSEANDPLLLRENFEEQTKLREAGTEGAHPVDEDFLEAMEYGMPPTSGFGIGMERLFMLLTDTTSIREVMFFPALR. 480
372 0.000e+00UniRef50_A0A1V5R544 Lysine--tRNA ligase n=1 Tax=Parcubacteria group bacterium ADurb.Bin326 TaxID=1852943 RepID=A0A1V5R544_9BACT  ali  27  123.GLSDVETRYRQRYLDLIVN---AETRNVFRKRSHIIKLMRKHLESNGFMEVETPIFQKNP-CGASANPFVTH----HDAKDIDLYLRISPETFLKQLIVGGMDRIYEIGKNFRNEGVDASHLQEFTMLEFYASYWNYCDNIEFVKWLIQQVLLGVMWQTVEYRDLVLNDCGIDILNFETVDLAEITKQGVALGEIDPGISLGSLIDKLYKRVSRPRL--IQPTVLLHHPAVLIPLARPNDQDPRVIDAFQILVNGWEIAKGYSELGDPILQRRLLEDQLALRHQGDSEAMFVDTDFLTSLEYGMPPVSGVGIGIDRLTAIATNQRNLADVVLFPLM.. 466
373 0.000e+00UniRef50_E6PHG8 Lysyl-tRNA synthetase n=3 Tax=mine drainage metagenome TaxID=410659 RepID=E6PHG8_9ZZZZ  ali  28  181.GLQDVEKRYRQRYVDLVVN---PEVRATFLARSRILSEMRRFIDAQGFHEVETATLLH-VAGGAAARPFLTHV----NALDAQMQLRIATELNLKRLIVGGMERVYEIGRIFRNEGIDTSHNPEFTMLELYAAYWDVNDMLAFNEALMEHLARVVPFDRIGYLEGIARYSHGRFTRERLLD-PEGAAAILNELGMPPSPTHGHALDKIFERVLEPHL--VAPTFVTEYPLALSPLAKRVPGDPEMTQRYELFCAQMEISNAFSELNDPDDQRTRFESQIAQRAQGDEEIPEPDWDFVRALETGMPPTAGIGIGVDRLVMLLTGASSIRDVILFPLQR. 523
374 0.000e+00UniRef50_A0A2H0BFV6 Lysine--tRNA ligase n=2 Tax=candidate division WWE3 TaxID=422282 RepID=A0A2H0BFV6_9BACT  ali  25  210.GIKDKEVRYRKRYLDLMIN---PETRRIFSIRHKIVKGIRTFLDEKGLTEVETPVLQP-LYGGANAKPFTTHI----NALDTDAYLRIASELYLKRLVVGGIEGVYDIAKDFRNEGIDQTHYPEFSMLETYIPYIDYHGMMDVMEEMMRYLAFDVVWKRVVMTDLIQQKLNLDPLTKTQKELEVFARENHL--EFANTITKGELIFLIFDKLCADSL--IDPTWVIDYPQEMSPLSKQHREKEGFVERFELYIGGVEIMDGWSEINDPIEQRARFEAEAYRNLGDGEQAQPIDEDFLEAMEHGLPPFAGIGTGIERLTMFFTNNWSIQEVILFPFKK. 551
375 0.000e+00UniRef50_A0A1Y1YVT2 Lysine--tRNA ligase n=2 Tax=Fungi incertae sedis TaxID=112252 RepID=A0A1Y1YVT2_9FUNG  ali  25  102.GLKDPEKRFRNRHLDFLVNR---EAVDILRNRAKIIQFIRQYFDSRSFLEVETPILSPK-AGGAIARPFTTKANALG---DLDMHLRIAPELYLKQLVIGGIDRVYEIGKQFRNEGIDADHNPEFTTCEFYQAYTNMEGLFKTTEDILSGIVFNPPYRRIYIVDELENQLGTKLPPFRDESIEMYLDCHKHNVPLSKPYTIPRILDKLVSHFIEP--MCVQPTFLCGHPMIMSPLAKAIDKGSEITGRFELFVAGKEVVNAYEELNDPEDQRSRFSQQLKDRNSGDVESQLPDDAFCDALEYGLPPTGGWGMGIDRVCAMITGASHIRETLAFPTMK. 452
376 0.000e+00UniRef50_A0A1R4H4G9 Lysine--tRNA ligase n=74 Tax=root TaxID=1 RepID=A0A1R4H4G9_9GAMM  ali  30  152.GIADQEIKYRQRYLDLIMS---QESRNTFLIRSKVVAYIRQFLIDRQFLEVETPMM-QVIPGGATARPFTTH----HNALDMNMFLRIAPELYLKRLVVGGFERVFEINRNFRNEGLSTRHNPEFTMLEFYQAYAEYHDLMNLTEAMLRGIAEEVVGHSVITYQGEQYDFGQPFQRMTVVDEAAVMVAEKLRLPVKDSYGLGKIQIEIFEKTVESKLM--QPTFITAYPVEVSPLARRNDNDPHVTDRFEFFVGGREIANGFTEXXXXXXXXXXXXXXXXXXXXXDDEAMHFDADYIIALEHGMPPTAGEGIGIDRLVMLFTDSPSIRDVLLFPHMR. 495
377 0.000e+00UniRef50_A0A1J4VEU7 Lysine--tRNA ligase n=2 Tax=unclassified Candidatus Hydrogenedentes TaxID=1046981 RepID=A0A1J4VEU7_9BACT  ali  30  147YGLENKEIRYRKRYLDLISN---PEVREVFKKRAVIVSSIRQFLIERGFMEVETPMM-QALAGGAAAKPFMTH----HNALDIDLYLRIAPELYLKRLIVGGFEKVFELNRNFRNEGMDRNHNPEFTMLEIYQAYADYNSMMDLTEELVRYAAEKANAYRLHFMEVISDDLDGPWQRIPFFEAIRAEAAVKECGIETESREYADHLDSLFERFAEPHLA--GPVFITDYPTALSPLAKRKPGEPELVERFEAYVRGMEIANAFSELNDPDDQEARFRAQSDR----------IDEDYVSALRAGMPPAGGLGIGIDRLVMILTGAHSIRDVILFPTMR. 516
378 0.000e+00UniRef50_Q7MZY6 Elongation factor P--(R)-beta-lysine ligase n=1221 Tax=cellular organisms TaxID=131567 RepID=EPMA_PHOLL  ali  80  4.................TANWQPSAAIANLLKRATILAEIRRFFADRGVLEVETPAMGQFTVTDIQLFSFQTEFVGPGAADGMTLYLMTSPEYHMKRLLAAGSGPIYQLGRCFRNEEAGRYHNPEFTMLEWYRPHYDMYRLMNEVD