current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 3p8t_A mol:protein length:294 AsnS-like asparaginyl-tRNA synthetase related protein, from PDB1018

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290
# E-value Template Links and tools%idFirst MNAVEIISRDIYKAIDIQTKILDYMTKFFTDRGFKWLLPIMLSPITDPLWPDPAGEGIRPAEVDVYGVRMRLTHSMILHKQLAIAMGLEKIFVLSPNIRLESRRKDDGRHSYEFTQLDFEIEGAKMKDVMRLIEELIYGLFRKAEEWTGREFPRARHFKVYDYKDILEEFGSDEKASMEMEEPFWIVNIPREFYDREENGVWKNYDLILPYGYGEVSSGGEREWEYEKIVAKIRAAGLKEDSFRPYLEIARAGKLKPSAGAGIGVERLVRFIVGAKHIAEVQPFPRVPGIPAVILast
1 0.000e+00UniRef50_A0A1V6K065 Asparagine--tRNA ligase n=2 Tax=Bacteria TaxID=2 RepID=A0A1V6K065_9BACT  ali  23  10...LRPRTNTFSAVFRMRHRLAMEVHSFFDGRGFSYVHPPILTSS----DCEGGGEIFQVTTLDFFRKKAYLTVSAQLEAEPL-ALALGGVYTFGPTFRAEP--SDTRVHAAEFWMIEPEAAFMDLDDDIRLIEDFVKHIASGVREKCGPEIDFLAKFARITYTEAADIIGERFLAEEVFSRPVFVTDYPASFKPFYMRMNDDACTDLLIPGVGELVGGSQREERPDVLARRAAELGLDPSTYGWYFDTRRWGTA-PHAGFGLGFERMLMYLTGIKNIRDVLPFPRTFG..... 344
2 0.000e+00UniRef50_A3MV91 Asparaginyl-tRNA synthetase n=9 Tax=TACK group TaxID=1783275 RepID=A3MV91_PYRCJ  ali  26  118VRHLWLRSRKMQAILKIRHTVFGAIHDYFRRRGFYEVHPPMFITA-------AVEGGATLFKVEYFDRTVYLTQSSQFYLEALIYS-LEKVYTVAPSFRAEP--SRTRRHLTEFWHAEMEIAWAHMDDAAKVGEEVIGHVVERVXXXXXXXXXXKPPFHWLSYDEAIEVLREERALTLEFDKPIILHGFPEKLKAFYHRNNPQSFDVLLPEGYGEVIGGGERIYDAKELVEKIIRFGLNPEDYQWYIDLRRYGSV-PHAGFGLGVDRLVMWIAGADHIRDVVPFPRDIRR.... 428
3 0.000e+00UniRef50_A0A256YUR3 Aspartate--tRNA(Asp/Asn) ligase n=2 Tax=unclassified Aenigmarchaeota TaxID=1046937 RepID=A0A256YUR3_9ARCH  ali  22  119.RFLDLRNHKTKKIFEIKSKFLYFARKFFYEKDFIEVHTP-------KIVCQGAEGGSELFPILYYNKEGYLTQSPQFYKQILQSAGFEKVYEIGPIYRAE--KSHTVRHLSEFFGIDCEISFINYEDLMKLIENFIKYSLIKLGESCKEEFKFLNPIPKITLKEIGKLINKEKIKEKYNTDFVFIIDYPFEARPFYTMKKNLTYSFDLLFKGLEIITGSQREHNLNTLKNQAKEKNISLDSISFYLDAFKYG-MPPHGGFGFGIERFIMQLLDLKNIRESSLFPRDVER--LM 424
4 0.000e+00UniRef50_A0A0G2K7D7 Asparaginyl-tRNA synthetase 2, mitochondrial n=14 Tax=Euteleostomi TaxID=117571 RepID=A0A0G2K7D7_RAT  ali  21  143.PHLRCRTNALGSILRVRSEATAAIHSYFKDNGFMHIHTPVLTS----NDCEGAGELFQVEPENFFDVPAFLTVSGQLHLEV-MSGAFTQVFTFGPTFRAENSQS--RRHLAEFYMVEAEVSFVSLQDLMQVMEGLFKATTEMVLSHCPEDVELCHQF--------IQKWGVDLQTEHEGNIPVFVINYPSELKPFYMRENEDDPQDLLVPGVGELFGGSLREERYHVLEQRLARSGLT-KAYQWYLDLRKFGSV-PHGGFGMGFERYLQCILGVDNIKDVIPFPRFTHSCLL. 442
5 0.000e+00UniRef50_D2VME1 Aspartyl-tRNA synthetase n=1 Tax=Naegleria gruberi TaxID=5762 RepID=D2VME1_NAEGR  ali  20  242.RVIDMRAPAQLAIFKIQSAMGRYFREFLYTLDFTEIHTPKLI-------ATASEGGADVFKVGYFNGAAYLAQSPQLYKQMAIIGDLERVFEIGPVFRAE--KSFTHRHLTEFVGLDLEMAISHYTEALEVIDKMFIYIFNRLETEFAKELEIIRPFERMPYSEAIALLNEEKYNTDFFMVDKFPMKLRPFYTMPCPEDPTLSNSYDIYLRGEEISSGAQRIHDPELLQKVANEKGVDLTPIQPYVDAFKYG-AWPHAGCGIGLERIVMLYLGLGNVRKTSMFPRDPNRV... 560
6 0.000e+00UniRef50_G3AI31 Uncharacterized protein n=3 Tax=Eukaryota TaxID=2759 RepID=G3AI31_SPAPN  ali  21  114.RVIDLRTPTNQAIFKIQSGVCQLFREFLSKKQFTEIHTPKIIAA-------ASEGGSNVFEINYFKGSAFLAQSPQLYKQQLIAGDFERVFEIAPVFRAEN--SNTHRHMTEFTGLDLEMAFEHYDEVLAVLEELFVFIFTELKTRFGKEIAPVEEFKILHFKEGIQMLRDDKYDTDFYILDKFPLAVRPFYTMPDAEDPRYSNSYDFFMRGEEILSGAQRIHDPELLKTRIQAHDVDPNGLREYVDAFTYG-CPPHAGGGIGLERVVMFFLDLKNIRRASLFPRDPKR.... 433
7 0.000e+00UniRef50_A0A1J4UJ22 Aspartate--tRNA ligase n=2 Tax=unclassified Candidatus Micrarchaeota TaxID=1801634 RepID=A0A1J4UJ22_9ARCH  ali  18  118.RALDLRRDEPQAVFKLRHSLCNAFREFLSGQGFLEIHTP-------KIIATGTEGGTSLFPVKYFEKQAFLAQSPQFYKQMLVGAGFERVFEIAPVFRAE--EHNTPYHLNEYVSLDLEMGFINEEDVMKVTQDFLVHAAKQVNLRNKAELEPKTPFPTVNYWDLPDVFKEKWAQEKHGSRFVFVNHYPSDHRPAYTMPFEFTRGYDLLFDGVEIVTGGQRIHDPALLAKRFRAKGFDPAKYEFYFEVFKYG-MPPHGGQAIGLERLTTKILGIQNVREAAFFPRDRTRV... 430
8 0.000e+00UniRef50_A0A024UIA3 Aspartate-tRNA(Asn) ligase n=9 Tax=Eukaryota TaxID=2759 RepID=A0A024UIA3_9STRA  ali  21  251.RVLDLRTPANQAIMRIQSGVGQLFREFLYSKGFVEIHTPKLL-------GGASEGGANCFSFGYFGESAVLAQSPQLHKQMACACGLEKVFEIGPVFRAEN--SLTARHLCEFTGLDLEMAIEHYSECLDVFSELFIYVFDNLNARFKRELDIINPFEVLKFDEAVAMLQEEKYGTDFYFLDKFPLAVRPFYTMPDPKDERWSNSYDFMIRGQEILSGAQRVHDPALLVKRMESLGVAEKDLQTYVDAFKFG-ALPHAGGGVGLERVVMLFLGLGNIRKASMFPRDPKR.... 567
9 0.000e+00UniRef50_A0A2R5G4F5 Asparagine--tRNA ligase n=1 Tax=Aurantiochytrium sp. FCC1311 TaxID=2023137 RepID=A0A2R5G4F5_9STRA  ali  24  393..HLRARTNLIACVARVRNACAFAIHDFFRLQGFQYVHTPIITAS----DCEGAGEGDVDYTKDFFSKPAFLTVSGQLNVETY-ACALSDVYTFGPTFRAEN--SHTSRHLAEFWMVEPELCFASLKDDIDLAEDFIKYCTQYVLKNCAADIDVDTPFKRLSYTEAIEIWGIDLGSEHEFKGPVVLTDYPADIKAFYMRQNELDKMDILVPRIGELVGGSAREERLGLLEKRITDMNLKPEDFSWYCDLRRFGTV-PHAGFGLGFDRFVMFVTGIANIRDVIPFPRYPGVCA.. 767
10 0.000e+00UniRef50_A0A2K5ANS9 Asparagine--tRNA ligase n=3 Tax=Thaumarchaeota TaxID=651137 RepID=A0A2K5ANS9_9ARCH  ali  27  128.RHLSIRGMKSSSIMKIRSELIKAAFDFFYDHGFTFITAPSI-------VGTAVEGGATLFELEYFGKKVYLTQSAQFYEEAAICS-FGKVFTMQPAFRAE--KSKTPKHLTEFIMIEAEVAFNTQEDNMRLQEELLTYIYNRVAERRKREFDILKPFQRIKYDEAMKEWGEDIPTERMFEQPFFITDYPLSARSFYHMRITLSSDLIAPEGFGEIATGGQRIHDYNTLLERIKSNNLPLESFRWYLDLRRYG-MPPHAGFGIGVERVIRWLCNLKHIRATSLFPRTITRV... 435
11 0.000e+00UniRef50_A0A078B8Q5 Aspartyl-trna synthetase n=5 Tax=Ciliophora TaxID=5878 RepID=A0A078B8Q5_STYLE  ali  19  250.RIIDLRVPANQALMRLQSAVGFLFREFLYSKDFIEIHSPKLIGGT-------SEGGANVFRLPYFDQEACLAQSPQLYKQMVLCGDMQRVFEIGPVFRAED--SNTNRHLCEFTGLDIEMVFEHYFEILDLLADLFVHIFQGLETRFGKELAIVEPFKRLNFKEAVQLLAEEKYDTDFYMLYGYPTNARPFYTMLDPTDPNYTNSYDFFMRGEEITSGAQRIHDPEFLAQRATAHNIPVNTIQEYIDSFKYG-APPHGGCGIGLERVVKLYCGIRNIRKCSLFPRDPKR.... 565
12 0.000e+00UniRef50_A0A2G9P9Q9 Aspartate--tRNA(Asp/Asn) ligase n=1 Tax=archaeon CG10_big_fil_rev_8_21_14_0_10_43_11 TaxID=1975556 RepID=A0A2G9P9Q9_9ARCH  ali  22  121.RFLDLRKPEQQAIFRIQSVMSNAFRQHFYNKGFTEIQPPCVIAA-------ASEGGAELFPVIYFDKEAFLAQSPQLYKQMVLASGFDKVFMTTPVWRAEP--HATPRHLNEARQYDIEVAWANDTEALDYLEEVLIHIIKTVKKECKNELKLLKKVPRITYTEALKEWGQDLTPEAERMLFVFIQEWPTNVRAFYSMPKEGNENVCLAYGGMELLSGATRVHKVDILEKQLRAKGLDPAKFKFYLDAFRYG-CPPHSGWSFGLERLTMTVLGLSNIREGTLFARDQNR.... 426
13 0.000e+00UniRef50_L1IEP1 Asparaginyl-tRNA synthetase n=1 Tax=Guillardia theta CCMP2712 TaxID=905079 RepID=L1IEP1_GUITH  ali  22  317IAHLRPRTNTLGSIARVRSALAQATHAFFQKQGFLYLQSPIITAS----DCEGAGEMFRVTTLDFFGKPAYLTVSGQLSGET-FACALGDIYTFGPTFRAEN--SQTSRHLAEFWMIEPEMAFADLQSVMENAEAYVKFVVKHALETCGEDLAFEKPFAKVSYSEAVELLQKDKSKWQYPDV-KFGTDLR------------VAATDLLVPGIGELVGGSQREERLDVLVDKLKEFGLSPEDYWWYLDLRRYGST-PHAGYGLGFERLVCYVTATENIRDAIAYPRYPGNA... 626
14 0.000e+00UniRef50_N6U1X7 Uncharacterized protein (Fragment) n=4 Tax=Bilateria TaxID=33213 RepID=N6U1X7_DENPD  ali  20  208.RVLDLRTSTNQAVFRLEAGVCKLFRDTLASRGFVEIHTP-------KIIPAASEGGANVFTVSYFKGSAYLAQSPQLYKQMAIAADFEKVFTVGAVFRAED--SNTHRHLTEFTGLDLEMAFYHYHEVMLTIGDLFTEIFKGLRDQYA------------------------KFHTDFYILDKYPLAVRPFYTMPDPQDPKTSNSYDMFMRGEEILSGAQRIHDPQFLTERAKHHGIDIPKIAAYIDAFKYG-CPPHAGGGIGLERVVMLYLGLDNVRKTSMFPRDPKRV... 464
15 0.000e+00UniRef50_A0A2E1BZ84 Aspartate--tRNA(Asp/Asn) ligase n=101 Tax=cellular organisms TaxID=131567 RepID=A0A2E1BZ84_9EURY  ali  23  146.RHLDLRREHVNAMFQLRSRVLQYGREHLISEGFQEINSPKIIAA-------AAEGGTNLFPMKYFDTDAYLSQSPQLYKQLAVLGGLERVFEIGPAFRAE--KHDTYRHLNEFISFDIEGAWMDDEDVMGVQERMIFHIWSEVKKNDQGLIDPSLPFPRIPYCEAIEIWGDDIESHHCFPGFHFIPRWPMAMKPFYIHHKEDSRGFDLNFGRDEMTSGGAREHRVDVLEGNLRDMGLDPADFTFYTDGFRYG-APPHAGWGLGVARLLMVLTGAGNVREVVLFPRDRSRV... 467
16 0.000e+00UniRef50_A3FPN1 Aspartate--tRNA ligase n=11 Tax=Eukaryota TaxID=2759 RepID=A3FPN1_CRYPI  ali  19  210.RVLDLRTYLSQAIFRIQSEVCRLLREFLIEREFIEIHTPKLL-------PGASESGATVFKVDYFSNTACLAQSPQLHKQMSICGDLERVFEIGPVFRAEN--SNTHRHLCEFVGVDIEMNIENYHELVDVFDAMFRHIFQGINTHCKNELNPFTPFPRLTFEEGCNLLKEEKYNSDFYMMLKYPLKVRPFYTMPDFDEPEWSNSFDFFMRGEEILSGAQRVHDYDLLVKRCQECGVSEHSLRDYLNSFKLG-APPHGGCGIGLERVIMLFLNLGNIRKSSMFPRDPKRLSP. 532
17 0.000e+00UniRef50_D3BEH3 Aspartyl-tRNA synthetase n=1 Tax=Polysphondylium pallidum (strain ATCC 26659 / Pp 5 / PN500) TaxID=670386 RepID=D3BEH3_POLPP  ali  18  249.RVLDLRVPSHQAIFRLQSAVGMLFREYLHSNNFVEIHTPKMISS-------ASESGASVFKLGYFDTNAYLAQSPQFYKQMAICSDMERVYEIGPVFRAEN--SFTHRHLTEFVGLDIEMSFEHYHEVLDVLDNLMCSIFEGLETRFAKELEFTRPSPRFTFDEAAAMLNEDINTTQYGVDFYIIDKFRPFYTMPDPNNELLANAYDLFMRGEEICSGAQRIHDAKMLEESAAKHGINIPSIQAYIDAFKYGAA-PHAGGGVGLERVVMLYLGIGNIRKTSMFPRDPKRIAP. 566
18 0.000e+00UniRef50_A0A1C7MNU3 Aspartate--tRNA ligase, cytoplasmic n=2 Tax=Agaricomycetes TaxID=155619 RepID=A0A1C7MNU3_GRIFR  ali  20  290.RVVDLRTQTNQAVFKLQDAIGHLFREYLDERGFIEIHSPKLQ-------GAATESGASVFQVGYFKGKAFLAQSPQLAKQMAIAADFERVYEIGPVFRAED--SNTHRHMTEFIGLDLEMAIEHYHEVMELLDGLFKHMFSSLRARHSNDIEAVRKFPRLTFREAVDLLREDKYDTDYFIIDKFPMSLRPFYTMPDPEDPTLSNSYDFFMRGEEILSGAQRIHDAALLAEKMRSKGVDPASMTSYLDAFKMG-CPPHGGGGIGLERVLMLFLKLNNIRRASLFPRDPKRLEP. 611
19 0.000e+00UniRef50_A0A2E6SDV9 Asparagine--tRNA ligase n=2 Tax=Bacteria TaxID=2 RepID=A0A2E6SDV9_9BACT  ali  27  119.RHLWLRSKRQNAIMRVRHQVVKAIRDFFDNNGFTLIDSPIFT-------GNAVEGTTNLFEVDYFGRSAYLTQSGQLY-QEAGAFALGKTYSFGPTFRAE--KSKTRRHLTEFWMVEPEMAYVDLDENMTWAENLVGAIITRVLEQCQNEFKLVPPFPRITYDKALKKYGSDFGAPDEFDKPIMIHRWPAGIKAFYMKRDEDNQDLIAPEGYGEIIGGGQREDDLDVLVNTIRHHDLPLEPFKWYLDLRKYGSV-PHSGFGLGLERTVAWICGTKHIRETIPFPRTMSRLEP. 431
20 0.000e+00UniRef50_I4YGS2 Putative asparaginyl-tRNA synthetase (Fragment) n=2 Tax=Wallemia TaxID=148959 RepID=I4YGS2_WALMC  ali  24  114..HLRVRSRQIASVIRLRDQLSYNFASWFKDFGFMNVQPPIITSS----DCEGAGEVFEVRHPKFFGRDAYLSVSTQLHLE-AISSGFSRVYTLSPTFRAEG--SQTNRHLAEFWMLEAELSFVDLETVMQVVENSIKSSVKNLTEHSEPSMSVDSDWPRLTYTEAIEILHERYLADTYYGRPLFVTDYPENIKPFYMRGKTVSCFDLLAPGIGELAGGSLREERLQVLEDKMSTAGLDRETYEWYVDLRRFGSV-PHGGFGIGYERLISALSGVSNLRDVVLFPRWAGRC... 427
21 0.000e+00UniRef50_A0A0D2K324 Uncharacterized protein n=20 Tax=Chaetothyriales TaxID=34395 RepID=A0A0D2K324_9EURO  ali  20  249.RILDLRTPSTQAIFRVQSAVSRTFRHYLEDRGFLEIHTPKLQ-------GGATEGGADVFKLDYFGRPAFLAQSPQLAKQMCISADFPRVFEIGPVFRAEN--SNTPRHMTEFTGLDLEMAIEHYHEAMWLIDATLKEIFKTLYDRNRKDIDLKTHFPRVTFAEGVKLLNEEKYHTDYYILDKFPAAARPFYTMPDPQDNNFTNSFDFMVRGQEILSGGQRIHEHTLLKERMEAQGMDPEDLKEYVQAFEW-VAPPHAGAGIGLERLVTLILDLGNLRYASLFPRDPK..... 569
22 0.000e+00UniRef50_A0A1D8S5N0 Aspartate--tRNA(Asp/Asn) ligase n=22 Tax=Euryarchaeota TaxID=28890 RepID=A0A1D8S5N0_9EURY  ali  23  108.RTLDLRRDEPRAIFEIRSEVLRAARETFRDLGSTEITTP-------KIVATGTEGGTELFPITYFGQEAFMNQSPQLFKQLLAASGLERVFEIGPIFRAE--EHNTPRHLNEATSIDFESAFIDADEAMDVAETFVRSVYEAVQENCQDELEPEAGFPRITYEEAIQRWGDDLPTEEEMDQHYFITNWPASVKPFYIDDPEVSTGFDLNHPRMELVSGGQREHRYEELVEGFEAQGLDPAAFEYYTKMFKYG-MPPHAGWGMGAERLLVTMLDLDNIREAVIFPRDRSRLSP. 421
23 0.000e+00UniRef50_A0A1S8W4K9 Aspartate-tRNA(Asn) ligase n=27 Tax=Eukaryota TaxID=2759 RepID=A0A1S8W4K9_9FUNG  ali  17  310.RVIDLRTTTNQAIFRIQAGVSRFFRDFLDNKDFVEIHTPKLIAA-------ASEGGANVFRVSYFKESGFLAQSPQLYKQMMVCADFERVYEIGPVFRAEN--SQTHRHMTEFMGLDMEMAFEHYHEVLDVLDGLFVRIFDGLKEKFQQELAPFDEFKRLEFPEAIQMLRDEKYNTDFFILDKFPLAVRPFYTMPDPQRPGYSNSYDFFIRGEEIMSGAQRIHDPSYLKERAEEHGVDISTIQPYIDAFKYG-APPHAGGGIGLERVVMLYLDLGNIRKTSLFPRDPKR.... 625
24 0.000e+00UniRef50_A0A0M3I5P1 Uncharacterized protein n=4 Tax=Ecdysozoa TaxID=1206794 RepID=A0A0M3I5P1_ASCLU  ali  18  368.RVLDLRTPTSQAIFRIQDGVCELFRNTLKKRGFTEIHTPKIISA-------ASEGGANVFEVSYFKGSAYLAQSPQLYKQMAIAADFDKVYTVGAVFRAED--SNTHRHLTEFVGLDLEMAFFHYHEVVETIGAMLIEIFKGLQANFQHEIEPCEPFQILKYPDAIKLLREEKYKTDFYILDKYPLAVRPFYTMPDPNNSKYSNSYDMFMRGEEILSGAQRIHDPTLLTQRAKFHNIDLEKIRAYVDAFRFG-CPPHAGGGIGLERVTMLFLGLGNVRLASLFPRDPKRI... 684
25 0.000e+00UniRef50_E8V0L8 Asparagine--tRNA ligase n=14 Tax=Acidobacteriales TaxID=204433 RepID=E8V0L8_TERSS  ali  24  128.RHLWMRTPRQSAILRVRATIMRAAAEYFDTNGFTRTDPPILT-------PNACEGTSELFEMEYFDQNAYLTQSGQLYIE-ATALALGKVYSFGPTFRAE--KSKTRRHLTEFWMIEPEVAFLELDGLMDLSEAFLTHIVTTVLAQHRAELKVIGPFPRLSYDQAHEMLGDDFGSPDEFDKPVLIHRYPTAIKAFYMQPDPVDPDVLAPEGYGEIIGGSQRIHDYDLLKSRIEQHGLPLDAFQWYLDLRRYGSV-PHAGFGMGIERAVAWICGLDHVRETIPFARTLNRI... 453
26 0.000e+00UniRef50_A0A1V4RCT7 Asparagine--tRNA ligase n=2 Tax=FCB group TaxID=1783270 RepID=A0A1V4RCT7_9BACT  ali  23  121MPHLRSRTNTLGSVFRVSHHISMAIHRFFDTNGFFNVHTPFITES----DCEGAGETFVEYEKDYFKKKAFLTVSGQLEAEP-FALSMGKVYTFGPTFRADP--SDTRIHGAEFWMLEPEMAFFDLEDNLKLIEKFVKFTASYLMEKCSDDIAFFTDFGKITYTQAIEIWGDDLATEHHFGKPVFVIDYPVSMKPFYMYGKTVGACDLLAPGVGELVGGSQREHRLPILEKRAVEQGLDMDTYRWYMELRRWGTA-PHAGFGLGFERLLMYLTGMDNIRDVVPFPRTFG..... 458
27 0.000e+00UniRef50_A0A2H9LD75 Asparagine--tRNA ligase n=1 Tax=Candidatus Diapherotrites archaeon CG08_land_8_20_14_0_20_30_16 TaxID=1974403 RepID=A0A2H9LD75_9A  ali  24  121.RHLWLRSRKMTASMKIRSTVLFALHEYMHKKGFTEIHAPSLSGAT-------SEGGSETFEVKYFDKKAYLTQSWQFYAENFI-GALEKAYAIAPSFRAE--KSKTPWHVTEFWHFEVEGAWMDLKDDMIIAEDCIKYVITKVLAENKKDLEIKTPFKRITYKEAIDKYGDDFKSAEYGNTFVFVTNYPLELLKFYHGEDPKTNFNLLAPDVGEMIDGSQREPDLNKIIVRLKKSGIDLGMSDWYLDSRRYGSV-PHAGFGLGVERFAAWICGFDNIRDSIPFPRTPNR.... 430
28 0.000e+00UniRef50_Q6LPQ6 Asparagine--tRNA ligase n=116 Tax=Bacteria TaxID=2 RepID=SYN_PHOPR  ali  24  124VAHLRPRTNIIGAVARVRNCLSQAIHRFYHEQGFFWMSAPLITAS----DCEGAGEMFRVSTLDFFGKETFLTVSGQLNAETY-ACALSKVYTFGPTFRAEN--SNTSRHLAEFWMVEPEVAFADLDDAAKLAEDMLKYVFKAVLEERRDDLEFTSDFAQVDYTDAIQILHERYLAEEHFKAPVVVKNYPKDIKAFYMRGKTVAAMDVLAPGIGEIIGGSQREERLEHLDKRIAEMGIDASHIEWYRDLRRYGTV-PHSGFGLGFERLVTYVTGMQNIRDVIPFPRAPRSA... 464
29 0.000e+00UniRef50_H3ANZ0 Aspartyl-tRNA synthetase n=79 Tax=Opisthokonta TaxID=33154 RepID=H3ANZ0_LATCH  ali  18  211.RIIDLRTTTSQAVFCLQSGVCQLFREALIQKGFIEIQTPKIISA-------ASEGGANVFTVSYFKTSAYLAQSPQLYKQMCICADFEKVFCIGPVFRAED--SNTHRHLTEFVGLDIEMAFYHYHEVMKNIGDTMVQIFKGLGDRYQTEIQPCEPFKILEFPEAVAMLRKEKYDTDFFILDKYPLAVRPFYTMPDPNNPKYSNSYDMFMRGEEILSGAQRVHDPQLLIERAKHHGIDLEKIKSYIDSFRYG-APPHAGGGIGLERVTMLYLGLHNIRQTSMFPRDPKR.... 526
30 0.000e+00UniRef50_A0A2D4BHZ9 Cyclin-dependent kinases regulatory subunit n=3 Tax=Pythium insidiosum TaxID=114742 RepID=A0A2D4BHZ9_PYTIN  ali  24  133..HLRPRSNIHGAAMRVRNAMTFATHQFFQTRGFLYIHTPIITES----DCEGAGEMFIDFKQDFFDRPSFLSVSGQLNVETH-CCALSDVYTFGPTFRAEN--SNTSRHLAEFWMIEPEIAFADLTDNINLAEDYLKYCVQYALDHCKEDLDFFNPFERISYTDAVNLWGIDLGSEHEFKKPVVIFNYPKEFKSFYMRLNEDGRCDVLVPNVGEIIGGSQREERLDVLRDRIIESGANPEDYQWYLDLRKYGTV-PHSGFGLGXERLVRFVTGIENIRDVIPFPRWPGNAA.. 480
31 0.000e+00UniRef50_B0EN72 Aspartyl-tRNA synthetase, cytoplasmic, putative n=9 Tax=Entamoeba TaxID=5758 RepID=B0EN72_ENTDS  ali  21  227.RMLDLRTVTNIAIFRIQSACCGLFREFLTSQKFVEIHTPKLIGCS-------SEGGSNIFEVKYFDRKAYLAQSPQLYKQMAIMGDFRKVFEVGPVFRAEN--SNTRRHLTEFEGLDIEMEIVNYHECIDVMEKLFTFIFDEIPKRFPDELKVIRPFLRLTYKEAIEMLRKAKYNTDFYILDKFPAAIRPFYTMPDIDDPNYSNSYDVFVRGQEITSGAQRIHDPEFLMKRCIEKGVDPATLKDYIESFRFGSW-PHAGCGIGLERITMLYLGIPNIRKVTLFPRDPIRLNP. 544
32 0.000e+00UniRef50_A0A256YL71 Aspartate--tRNA ligase n=5 Tax=Archaea TaxID=2157 RepID=A0A256YL71_9ARCH  ali  24  122.RTLDIRKPKINAIFKIQSTIAHAFREFFYNQGFTEIQTPGIISS-------ASEGGTELFPLQYFEKKAYLAQSPQLYKQ-LIAISLEKVFLTIPVWRAE--KHNTTRHLNEVLQLDIEVAFADEFVVMKYLEEVVRYIVKKVLQENKKELEILPKAKYLTYKEAIKKYGDDKKLCKIYKGIVFVYEWPQTLKPFYIWPKKVSGGFDALYEGIEIASGGQRIHIPEILIKQLKSKGLNPKDFKWYIDAFRYG-APKHAGWSIGLERLTMAICKLDNIREACLFPRDRERI... 422
33 0.000e+00UniRef50_A0A1F8KNR3 Asparagine--tRNA ligase n=5 Tax=Bacteria TaxID=2 RepID=A0A1F8KNR3_9CHLR  ali  21  123.RHLWLRMPSQWAVLRIRATVISAMREWLDNNGFINMDTPILT-------PAACEGTTTLFETPYFDEMAYLAQSGQLYNE-ADIFAFGKVYSFGPTFRAE--KSKTRRHLTEFWMVEPEIAFCDLDQLMEIEEQFITHIVKRVLRDRQPELKIEAPFPRISYDQATEMLGKELLQFEWGMKPVFVYGYPTKVKAFYMEPWPGRPEVCKPEGYGEIIGGSERMSNHDLLLQRIHEHNLPEESFKWYLDLRKYGSV-PHSGFGIGLERTVSWICGIEHIREAIAFPRTIKRV... 445
34 0.000e+00UniRef50_A0A109UVS7 Aspartate--tRNA(Asp/Asn) ligase n=10 Tax=Archaea TaxID=2157 RepID=A0A109UVS7_9EURY  ali  23  131.RFLDIRKENVSAIFKIKGQMFHTIRDFFYDNGFYEINTPKLVAS-------ATEGGTELFPITYFEKEAFLGQSPQLYKQMMMGAGMDKVFEIGQIFRAE--EHDTLRHLNEAVSIDAEASFMEDVDVMKILNDMLIQVLKDINENCADELDILGDFPVVTYDEAVDIWGEDLSREDTMGGFYFLTEWPTEIKPFYVMPKEYSHAFDLMYNNLELSSGATRVHQYDLLVKQIEERGLNPAGFGSYLKAFEYG-MPPHAGWGLGADRLTMVLTGSENIRECVLFPRDRHR.... 436
35 0.000e+00UniRef50_A0A1V4U2B5 Aspartate--tRNA(Asp) ligase n=6 Tax=root TaxID=1 RepID=A0A1V4U2B5_9EURY  ali  24  122.RYMDLRKPEVRAVFEIKSLTMRLIDEYLADNGFVEVFTPKLVAS-------GAEGGSTLFKVDYFGKQAYLAQSPQLYKQMLMSTGLDRVFEIGPAFRAEP--SDTARHVSEFISFDGEMAHIDSQDVMAMIEGCTQYVISEVKERGGEVVVPKAPYPIVSYEKAIGMLGEDLGMTQDGHEMYWIAEYPEAAKPFYIMEKPYSFSFDLDYKGQEISSGGQREHRYDRLVQRMEKMQLDPKSFEFYLNAFAYG-MPSHGGWGLGVERMVQKMLGLSNIRETILFPRDRNR.... 431
36 0.000e+00UniRef50_G0V6R0 Uncharacterized protein n=29 Tax=Fungi TaxID=4751 RepID=G0V6R0_NAUCC  ali  21  230.RVIDLRTVTNQAIFKIQSGVCQLFREYLSGLKFTEVHTPKLL-------GAPSEGGASVFEVSYFKGKAYLAQSPQFNKQQLIVADFEKVFEIGPVFRAEN--SNTHRHMTEFTGLDMEMAFEHYHEVLDVLSDLFVFIFTELKKRFSKEIEIVRKFKRIQYKEGIQMLKDEKYDTDFYILDKFPLAIRPFYTMPDAEDPRYSNSYDFFMRGEEILSGAQRIHDHALLQERMKVHGLSSEDLKDYCDGFSYG-CPPHAGGGIGLERVVMFFLDLKNIRRASLFPRDPKR.... 549
37 0.000e+00UniRef50_B6AAM0 Asparaginyl-tRNA synthetase family protein n=22 Tax=Apicomplexa TaxID=5794 RepID=B6AAM0_CRYMR  ali  23  152IPHLRPRTQFFSSVTRIRNTLSIAIHDYFQYLGFYYIQTPIITSA----DCEGAGEMFQVTTLDFFEVPTYLTVSGQLNVEN-FSCSMSDVYTFGPTFRAEN--SHTGRHLAEFWMIEPEMAFADLLDDMNLGEGLLKYCVEAVLKNNEVDLQVSEEFARISYTEAIEMWGMDLGSEHELKKPCILYNYPKDIKAFYMKQNDDAAMDILVPKIGEVIGGSQREDDIEKLKSAIIEKGMELEPYWWYNELRLYGSV-PHAGFGLGFERLVMMVTGIDNVRDVIPFPRYPGHC... 516
38 0.000e+00UniRef50_A0A2J0MJ13 Aspartate--tRNA(Asp/Asn) ligase n=8 Tax=unclassified Candidatus Omnitrophica TaxID=1047005 RepID=A0A2J0MJ13_9BACT  ali  20  131.RYLDLRRPKMFNYLKTRHQLNHLIRNFLEVGGFIEVDTPILT----KSTPEGARDYLVPSRVN-QGKFFALPQSPQLFKQLLMVSGFDKYFQIAKCFRDEDLRAD---RQPEFTQLDMEMSFIDEEDIFAISEQLFVKILKDLKG-----IDIKAPFRRISYKEAMAAYGNDKPDIRADKNFLWVIDFPLFKYDTDEKRWDSEHHYDLVLNGNEIASGSIRIHDQNIQHKIFQILRISEEEFGFLLQAFKYG-APPHGGIAFGLDRLLSILFGTESIRDIIAFPKNQKAVCPL 444
39 0.000e+00UniRef50_A1RXV2 Aspartate--tRNA(Asp) ligase n=17 Tax=Thermoprotei TaxID=183924 RepID=A1RXV2_THEPD  ali  27  111.RYLALRLPRVRAAFLARSLIVNEIRSFFSERGFLEVHTPKIVKA-------GAEGGATLFEVDYFGVKAYLAQSPQLYKQMLMC-GVPRVFEIGPFFRAEKFS--TTRHLNESWGLDVEMGFIKMEDVLEVLSQLVVHLSHKLNERLGDAIKPVTSVRVLTYDEALEKWGEDFDPEEKGVQAYFIVDYPWESKPFYIMKKKRGYAFDLDIRGIEVASGGQREHRYEVLRQNLLEKGLNPEDFSFYLEAFKYG-MPPHGGFGLGIDRLVMTFLGVQNIRETVLFPRDRFR.... 418
40 0.000e+00UniRef50_A0A2R7Y9A3 Asparagine--tRNA ligase n=1 Tax=Aigarchaeota archaeon NZ13_MG1 TaxID=1980982 RepID=A0A2R7Y9A3_9ARCH  ali  27  124.RHLHIRSPKVTAIMKIRSLLTGILHEWFRKNGFTEVHCPTFITA-------AVEGGATLFKVDYFGKEVYLTQSVQFYQEAAI-FGLEKVYTIQPSFRAE--LSRTRRHLTEFWHVEAEMANATLEDVMAVVERLVGDVVKALAESAGPYLKVLPPYPRLRYADALEILREERELSKEFDKPFFVTHYPREAKAFYHMPDPSDPRVTLPGGYGEIVGGGQRIHDYDLLVQRIKEAGLNPSDYEWYLDLRRYGSV-PHSGFGLGLERMLWWLLGMNHIRSVTLFPRTPTRV... 433
41 0.000e+00UniRef50_E7RHG1 Asparagine--tRNA ligase n=117 Tax=cellular organisms TaxID=131567 RepID=E7RHG1_9BACL  ali  25  118.RHLWLRSRKQHAIMKIRNEIIRSTYEFFNDNGFVKVDPPILTGSSP-------EGTSELFATKYFDEDAYLSQSGQLYMEAA-AMALGKVFSFGPTFRAE--KSKTRRHLIEFWMIEPEMAFIEHVESLEVQEQYVSYIVQSVXXXXXXXXXXKAPFPRVSYDDAIKKWGEDFGAPHEYDMPIFITHYPIGIKPFYMQPHPERDDVVLPEGYGEIIGGSERIHDYELMKQRIQEHNLDEDAYAWYLDLSKYGSV-PHSGFGLGLERTVAWISGVEHIRESIPFPRLLNR.... 428
42 0.000e+00UniRef50_C1FIQ0 Uncharacterized protein n=2 Tax=Eukaryota TaxID=2759 RepID=C1FIQ0_MICCC  ali  18  86.RVIDLRTPANQAIFRIQSAVCELFRDALRAQDFVEIHTPKLI-------GGASEGGASVFKLDYMGQPACLAQSPQLYKQMAVESDLERVFEIGPVFRAEN--SNTHRHLCEFTGLDMEMAIEHYFEVLDVLDNLFLHMFDGLNERFKHELQVLRPTLRLEFPQGIAMLKEEKYDTDFYMLTKYPAAARPFYTMPDPADPDYSNSYDIFIRGEEIISGAQRIHDPALLTKRAVECGIEVDTIQAYIDAFKYG-ALPHGGCGVGLERVVMLFLNLGNIRKTSMFPRDPRRLAP. 405
43 0.000e+00UniRef50_A0A067MYZ7 Uncharacterized protein (Fragment) n=1 Tax=Botryobasidium botryosum FD-172 SS1 TaxID=930990 RepID=A0A067MYZ7_9HOMO  ali  23  119..HLRSRTNTMSAMLRLRDRLGRSFHDYFQSQDFYNVNTPIFTSS----DCEGAGEAFTTSELEFFGRPAFLTVSSQLHLE-ALSSSLARVYTLSPAFRAE--RGVTHRHLSEFWMLEAELSFCNMEDVMGVVEGLIKHSLNDVRKTCEAELELLGAWQRMTYTQAVKELHEKWLAGSLVGGPVFVTDYPIDLKPFYMRLNNNACFDLLIPRVGELVGGSLREERLAHLEHAMKKHGLPVEEYEWYLDLRRFGSV-PHGGFGLGFERLVSWVAGIDNIRECIPFPRWPGKMAL. 494
44 0.000e+00UniRef50_P04802 Aspartate--tRNA ligase, cytoplasmic n=183 Tax=Fungi TaxID=4751 RepID=SYDC_YEAST  ali  21  235.RVIDLRTVTNQAIFRIQAGVCELFREYLATKKFTEVHTPKLL-------GAPSEGGSSVFEVTYFKGKAYLAQSPQFNKQQLIVADFERVYEIGPVFRAEN--SNTHRHMTEFTGLDMEMAFEHYHEVLDTLSELFVFIFSELPKRFAHEIELVRKFKRLTYKEGIEMLRRDKYDTDFYILDKFPLEIRPFYTMPDPANPKYSNSYDFFMRGEEILSGAQRIHDHALLQERMKAHGLSPEDLKDYCDGFSYG-CPPHAGGGIGLERVVMFYLDLKNIRRASLFPRDPKR.... 554
45 0.000e+00UniRef50_A0A0W8F1A5 Aspartyl-trna synthetase n=1 Tax=hydrocarbon metagenome TaxID=938273 RepID=A0A0W8F1A5_9ZZZZ  ali  23  27.RFLDARRPRVTAVFQVRSQATKAVCDYLFSRGFLTITTP-------KVVAAATEGGTELFPIAYFEKEAFLNQSPQLYKQMMMGAGFEKVFEIGPIFRAE--EHNTTKHLNEATSIDVEVSFADHHEVMRLLEDLVVHVYRSVQETCAGPLDPEAPFDRLPYADAIGIYGDDKAIGEHMGAHYFITDWPTAIKPYYAMDPSVCKAFDLMHPRMELSSGSQRVHQHDLLVHQIQSKGLSPESFAFYLTPFLYG-MPPHAGWGLGAERLIMTMLGLGNIREAVLFPRDRHR.... 334
46 0.000e+00UniRef50_A0A2V7RWM6 Asparagine--tRNA ligase n=1 Tax=Gemmatimonadetes bacterium TaxID=2026742 RepID=A0A2V7RWM6_9BACT  ali  26  253.RHFWLRSNRQRAIFLVRNEIEQAIHDFFYERGFLRIDTPILTAAI--------GERSGLFETDYFEEKAYLAQTGQLYGEAA-AAAFGKIYTFGPTFRAE--KSKTRRHLTEFWMIEPEVAWYDSAANMRLQEDFVSYLVRRALDRCADSLKVKPPFVRLDYSEAVEIWGEDLGAEDEYDKPVFVMNYPKQAKAFYMKENPADPRTVLPEGYGEIIGGSQREDDYDRLVRRIKEERLPVDAYDWYLDLRRYGTFV-HSGFGLGLERTVAWICGLQHIREAIAFPRMMHRLKP. 565
47 0.000e+00UniRef50_A0A1X6MWJ4 Uncharacterized protein n=1 Tax=Postia placenta MAD-698-R-SB12 TaxID=670580 RepID=A0A1X6MWJ4_9APHY  ali  24  130..HLRPRTDAVASMLWLRHIVSNSIRGFFENNGFCYVHTPIITA----NDCEGAGETFRIAPDEFFGHPAYLTVSSQLHLE-ALAASISRVYTLSPCFRAE--RSQTNRHLAEFWMLEAEWAFTTVHDVCNVVEAAIKQVLDDAADKSEGSNPWSRDWPRITYANAVEELHERWLAENLAKGPVFVTDYPAELKPFYMRGKTVACFDLLMPGLGELVGGSLREEREDHLSNAMRKHGLQTDQYDWYLDLRRYGSA-PHGGFGLGFERLISWVGGIENIRECIAMPRWAGRMLL. 468
48 0.000e+00UniRef50_Q5ZJQ6 Aspartate--tRNA ligase, cytoplasmic n=119 Tax=Eukaryota TaxID=2759 RepID=Q5ZJQ6_CHICK  ali  17  185.RVIDLRTSTSQAVFCLQSGICQLFRETLIRKGFVEIQTPKIISA-------ASEGGANVFTVSYFKSSAYLAQSPQLYKQMCICADFEKVFCVGPVFRAED--SNTHRHLTEFVGLDIEMAFYHYHEVVDEIADTLVQIFKGLQERFQAEIKFLEPTLRLEYREAVAMLREEKYDTDFYILDKYPLAVRPFYTMPDPVNPKNSNSYDMFMRGEEILSGAQRIHDPQLLTERAKHHGIDLEKIKAYIDSFRFG-APPHAGGGIGLERVTMLYLGLHNVRQTSMFPRDPKR.... 500
49 0.000e+00UniRef50_A0A1V4ZH70 Asparagine--tRNA ligase n=3 Tax=Euryarchaeota TaxID=28890 RepID=A0A1V4ZH70_9EURY  ali  23  128.RHLWIRSREQQAVMKVKASLIKGARDWLDDNGFTEVTPPIFTQ-------NACEGGVTLFKLKYFDREAYLSQSAQMYLE-AMIFSLEKVYAMTPSFRAE--KSRTTRHLTEFWHLELEEAWVDNKGNMEIQENLVSAMVQKVVRERKDELEIVPPFKRVTYAEMIDRLKEERAVTEEEKLPTFVTNFPKECKAFYMKEDPEDPRTVKPEGYGEIIGGSERETDMDVLVAKLQRQDIPIEAYQWYLDLRRFGSV-PHSGFGLGVERVVRWVCKLEHIRDAVPFPRTVSRA... 438
50 0.000e+00UniRef50_A0A1I5VZC3 Asparagine--tRNA ligase n=1 Tax=Lachnospiraceae bacterium XBB1006 TaxID=1520827 RepID=A0A1I5VZC3_9FIRM  ali  24  118IPHLRPRTNLYAAVFRTYSVMMRGITKFLDEEGFVQIHTPIMTAC----DGEGAGEVFRLKTEKFYGQEAYLAVTGQLHLE-AMALSLRKVYDFCPSFRAED--SNTPRHLAEFWQVEPEIAFCTLEDLIPFIESFCKSVISYCMKEASEELAFFSKFARISYEEAIELLHERYLADEVFRCPVFVTDYPKEQKAFYMHQNDDAATDLLFPQIGEIVGGSQREDRLEQLLTRIRECGLSEEDYGWYCDLRRFGSA-PHSGFGLGTERLMRYITGMDNIRDVVPYPRTPGGIA.. 442
51 0.000e+00UniRef50_A0A074TRH0 Aspartate-tRNA ligase n=18 Tax=Alveolata TaxID=33630 RepID=A0A074TRH0_HAMHA  ali  21  459.RILDLRTPVNQAIFRIQSETLQLFREFLLSRNFVELHSPKLI-------GGASEGGASCFTLKYFNRDACLAQSPQLYKQMAMCADFERVFEIGPVFRAEN--SNTHRHLCEFTGLDLEMTFEHYSEVLDLLDDLFKFIFKGLSERCRKEVDPAEPFPRLSFEEGVQMLREEKYHTDFYMLLQYPLKVRPFYTMPDPHNKMYSNSYDFFMRNEEITSGAQRVHDADLLTQRCLECGVPPTSIQTYIDSFRLGTA-PHGGAGIGLERVVMLFLGAKNIRQVSLFPRDPKR.... 778
52 0.000e+00UniRef50_Q2FRU5 Aspartate--tRNA(Asp/Asn) ligase n=30 Tax=root TaxID=1 RepID=SYDND_METHJ  ali  22  120.RFLDARRPRVSAIFKIRNAVQHATRNFFFENGFIEINT-------SKIVAAATEGGTELFPIAYFEKEAFLNQSPQLYKQMMMAAGFEKVYEIGPIFRAE--EHNTTKHLNEATSIDIEVSFTDHLGVMQTLEDLIRDIYQFVDKTCSDAIAPEKGFPRLPYSEAIEIYGDDRAIGEEMGRLYFIVDWPSSIRPYYAMDPEICKAFDMMHPRMELSSGAQRVHQHDLLVEQIAKKGLNPENFEFYLNPFRFG-MPPHAGWGLGAERLVTTMLGLPNVREAVLFPRDRHRV... 428
53 0.000e+00UniRef50_A0A2K2V3W9 Asparagine--tRNA ligase n=1 Tax=Candidatus Korarchaeota archaeon TaxID=2056630 RepID=A0A2K2V3W9_9ARCH  ali  22  125.RHLHVRGRRVQAFLRIRSELIKAFEEWYNSHGFTRVEAPTF-------VGTAVEGGATLFEVNYFGKKAYLTQSSQFYLE-AMIFSFDNVYTIQPSFRAE--KSRTKRHLTEFWHLEAEMAWADLNSMMDIVEDSLKYAVEKVCERAADQLNILKRFPRITYDEAVEIWGDDKAISLEFDLPVFVTHYPKAAKAFYHKICPEDPRKVVPEGIGEIVGGGQRIDDLNELLTRIKEENLDPESYKWYIDLRRYGTV-PHAGFGLGIERTARWISGADSVRDVVPFPRTPTRINP. 434
54 0.000e+00UniRef50_Q9KSF9 Asparagine--tRNA ligase n=2889 Tax=root TaxID=1 RepID=SYN_VIBCH  ali  22  124VAHLRPRTNVIGAVARVRNCLAQAIHRFYHEQGYFWVSAPLITAS----DAEGAGEMFRVSTLDFFGKETFLTVSGQLNAEAY-ACAISKVYTFGPTFRAEN--SNTSRHLAEFWMVEPEVAFADLNTVAKLAEDMLKYVFKAVLAERRDDLEFESDFAQVDYTDAIEILHERFLAEEHFKAPVIVKNYPKDIKAFYMRMNEDAAMDVLAPGIGEIIGGSQREERLDILDARMREFGIDPEHMDWYRDLRRYGTV-PHAGFGLGFERLVSYVTGMGNVRDVIPFPRTPRSAS.. 465
55 0.000e+00UniRef50_M7MMS7 Asparagine--tRNA ligase n=53 Tax=root TaxID=1 RepID=M7MMS7_9FLAO  ali  21  119..HLRTRTSTFSAVMRLRSALSFAIHKYFNENGFYYMHTPIITGS----DAEGAGEMFVNFKEDFFGKETNLTVSGQLEAETY-AMSLGKVYTFGPTFRAEN--SNTSRHLAEFWMIEPEVAFMDLAGNMDLAEDFMKSVLSYILKHNREDLEFLENFKRVSYTEAIDILHERYLVEKHFNCPVILFDYPANIKAFYMRLNEDGKMDILFPGIGEMVGGSQREERLDVLKEKMKALDIDEEELWWYLDLRKYGTAV-HSGFGLGFERLVMFATGMGNIRDVIPFPRTPQNA... 475
56 0.000e+00UniRef50_UPI0009FACAD0 aspartate--tRNA(Asn) ligase n=1 Tax=Methanofollis ethanolicus TaxID=488124 RepID=UPI0009FACAD0  ali  25  507.RFLDVRKPRVAAIFKIRSAVTAATYEFFSKRGYYNITSP-------KVVAAATEGGTELFPIAYFEKEAFLNQSPQLYKQMMMAAGFEKVFEVGPIFRAE--EHNTVRHLNEATSIDVEVSFADHNDVMKVLEDLVSHQYATVAETCSDALAPKAPFPRIPYADAIDIYGDDLSTPEEMGEHYFIVDWPSAIRPYYAMDPSICKAFDMMHPRMELSSGAQRVHQYDLLVEQIKAKGLSPESFEFYLQPFRYG-MPPHAGWGMGMERLIMTMLGLQNIREAVLFPRDRHRV... 814
57 0.000e+00UniRef50_A0A2J6N7Z9 Aspartate--tRNA(Asp/Asn) ligase n=2 Tax=Archaea TaxID=2157 RepID=A0A2J6N7Z9_9ARCH  ali  21  123.RIVDLRRTEPQAIFRIQSTVSSAIRSYLRENGFIEIFTP-------KIIATATEGGASLFSVFYYDRIAYLSQSPQLYKEQL-TSAFERVFEIAPAFRAE--ESDTQRHLSEITMVDAEAAFMDYQDIMSLLDGLVEHVVKTVNKENQKELEVKLPIPRITYDEAVSVLERKKALSEELSDFYFITDWPTAARPFYAKRPERCESFDLMYGWIELASGATRINDGKLLRERMSSQGLNPDSFKTHLKWFNYG-MPPHAGFGLGLARLLMVLTGKDNIREVVMFPRDKRRLEP. 430
58 0.000e+00UniRef50_F2NW56 Asparagine--tRNA ligase n=8 Tax=cellular organisms TaxID=131567 RepID=F2NW56_TRES6  ali  24  130..HLRARTNTFGAVYRVRNQMAFAVHSFFQERGFQYINAPEIT----CSDCEGAGEMFQVTTLDFFGKKASLTVSGQLEAET-MATALSRVYTFGPTFRAEN--SNTPRHLAEFWMIEPEMAFFDLDDDMDIQEDFVKYLLNWALTKCRSDLEFKAKFVRISYTDAIAKWGCDIATEHEFGCPVMVFNYPKEIKSFYMKQNDDGKTDVLVPGIGELIGGSEREENYEKLLKACEERKMDMSNYQWYLDLRRFGTV-PHSGFGLGFERLIRYITGMENIRDVIPYPRAPKLAD.. 485
59 0.000e+00UniRef50_Q976I3 Aspartate--tRNA(Asp/Asn) ligase n=35 Tax=Thermoprotei TaxID=183924 RepID=SYDND_SULTO  ali  23  121.RVLDLRRQEMQAVIKIQSLALKAFRETLYKEGFIEIFTPKIIAS-------ATEGGAQLFPVIYFGKEAFLAQSPQLYKE-LMAGVVERVFEVAPAWRAE--ESDTPFHLAEFISMDVEMAFADYNDVMQLLEKILHNIVKTIKEEGKEELKILNPIKRLKYTEAIEILRSKGYNIKFGDDIYFIVDWPSDARPFYTKNPELSESFDLIYKFLEIVSGSTRNHKREVLEEALKKKGLKPESFEFFLKWFDYG-MPPHAGFGMGLARLMVMLTGIQSVKEIVPFPRDKKR.... 426
60 0.000e+00UniRef50_A0A2G9NLV0 Asparagine--tRNA ligase n=4 Tax=Candidatus Pacearchaeota TaxID=1801617 RepID=A0A2G9NLV0_9ARCH  ali  24  119.RHLWLRSRKMTAIMKIRSTVFGAIHEYFRSKGFYEYQSPIFQSVQ-------CEGGSTLFHVDYFGKKVFLAQTWQLYAEPEI-FALEKIYTIAPSFRAEA--SKTSRHLTEYWHAEMEVAWANFDEIIKYGEELIKHVVKKVLENNKSDLEIKKKFPRITYAEVLKLWGKDLRTIEEFDTPVAVTRYPKQVKAFYMKEPDDSKDFIAPENYGEIIGGSERESDIEKIKKRLKEEGEKIEQYDFYLDTRRYGSV-PHGGFGLGVERFISWICGLENIKDAIPFPRTMNR.... 434
61 0.000e+00UniRef50_Q8BGV0 Probable asparagine--tRNA ligase, mitochondrial n=132 Tax=Gnathostomata TaxID=35060 RepID=SYNM_MOUSE  ali  21  143.PHLRCRTNALGSILRVRSEATAAIHSYFKDNGFVHIHTPVLTS----NDCEGAGELFQVEPESFFDVPAFLTVSGQLHLEV-MSGAFTQVFTFGPTFRAENSQS--RRHLAEFYMVEAEISFVSLQDLMQVMEELFKATTEMVLSHCPEDVELKNNFLIISYTEAIEILHEKYLVRHCGNIPVFVINYPSELKPFYMRENEDGPQDLLVPGVGELFGGSLREERYHVLEQRLARSGLT-KAYQWYLDLRKFGSV-PHGGFGMGFERYLQCILGVDNIKDVIPFPRFTHSCLL. 477
62 0.000e+00UniRef50_D2EF81 Aspartate--tRNA ligase n=1 Tax=Candidatus Parvarchaeum acidiphilum ARMAN-4 TaxID=662760 RepID=D2EF81_PARA4  ali  22  115.RFLSLRKPKTAAIFKIQSTVSNAITKFFEDQGFYQIH-------SSKIISQATEGGANVFQVLYFDKTAFLAQSPQFYKQMMMAAGFEKVFEIGPVFRAEP--HHTSRHLTEYTSVDLEMSFISYEDVMSVMEKLILRIFKEVRERNKNDLEPQVPFPRITIKEALKKYGNKYVKEKYNSDFFFLTEFPWSIAQFYHMKKEDNKEVDLIYKGLEITTLAQREHRYDVLISQLKEKNLDPEKFKFYTDFFRYG-VPPHGGSGTGLERIVKQMLNLENVAEATLLPRTPDR--LM 428
63 0.000e+00UniRef50_A0A218NMF4 Asparaginyl-tRNA synthetase n=2 Tax=unclassified Candidatus Micrarchaeota TaxID=1801634 RepID=A0A218NMF4_9ARCH  ali  22  140MRHLWIRSPKMIDILKLKASVINDIRGFLDEKGFLEVQPPLITGS-------AAEGGATLFEVNYFDRKAYLSQSGQLYLE-AVINGYPLVYGFAPSFRAEP--SRTPRHLAEFWQLEAEMAFYNQDMNMKLQEQILEHILKRFGRDPQDLLDIQTPFERMKYEKALDILKEEKALMQDRKQPVFLTNQPKEIRAFYMRINPDDPRTVLPEGIGEIFGGSERVSDYDELMGRIKEQNLKEEDYQWYIDLRKYGSI-PHSGFGIGSERVVRWILKLDSIRDAIPFPRTMNRISP. 453
64 0.000e+00UniRef50_Q922B2 Aspartate--tRNA ligase, cytoplasmic n=624 Tax=Eukaryota TaxID=2759 RepID=SYDC_MOUSE  ali  18  183.RVIDLRTSTSQAIFRLQSGICHLFRETLINKGFVEIQTPKIISA-------ASEGGANVFTVSYFKNNAYLAQSPQLYKQMCICADFEKVFCIGPVFRAED--SNTHRHLTEFVGLDIEMAFYHYHEVVEEIADTLVQIFKGLQERFQTEIKFLEPTLRLEYCEALAMLREEKYDTDFYVLDKYPLAVRPFYTMPDPRNPKQSNSYDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFG-APPHAGGGIGLERVTMLFLGLHNVRQTSMFPRDPKR.... 498
65 0.000e+00UniRef50_A0A2A3SZX0 Aspartate--tRNA(Asp/Asn) ligase n=9 Tax=Euryarchaeota TaxID=28890 RepID=A0A2A3SZX0_9EURY  ali  23  124.RYMDLRKKDIAAHFQIRAAISGAVHRHLRREKFLEVQTPKIIAS-------ATEGGTSLFEMKYFDRTAYLAQSPQLYKQILMGGGLERVYEVGPAFRAE--EHNTPRHLNEFISIDIEMSFADDDVVMGVMERLVDTVARAVVKETEKPIELELPLPRITYDEAXEMWGDDLSMEEEMNGFYFITKWPLSLKPFYIQDPKYSKGFDFMYNEVEMTSGGQRVHNVDLLRKRLKEQGLDPDGFNHYLDPFRYG-MPPHAGWGLGLDRLTMIFSGAKNVRECVLFPRDRNR.... 424
66 0.000e+00UniRef50_A0A2A9MJ74 Asparaginyl-tRNA synthetase (NOB+tRNA synthase) n=1 Tax=Besnoitia besnoiti TaxID=94643 RepID=A0A2A9MJ74_9APIC  ali  23  304IAHLRPRSYLIGAVTRVRSNLAMATHRFFQDRGFLYIHTPLITAS----DCEGAGEMFQVTTVDFFGRPAFLTVSGQLAVEPY-CCALSDVYTFGPTFRAEN--SHTSRHLAEFWMVEPEIAFATLEDNMVVAEAYVRFCVQWVLDNCRADIELAEPFARVSYTEAIELLHERYLTEQIFKKPCIVYNYPKDIKAFYMKLNDDGKMDVLVPKIGELVGGSQREDDRDRLDKMIKEKNLDIESYWWYRELREYGTM-PHAGFGLGFERLVMLVTGIENIRDTIPYPRYPGHA... 670
67 0.000e+00UniRef50_A0A1F6LLA6 Asparagine--tRNA ligase n=8 Tax=Bacteria TaxID=2 RepID=A0A1F6LLA6_9BACT  ali  22  115.RHLWLRSKKQWAIQRVRDEVIQAIYDYFHEQDFVKIDTPIITP----NACEGS---TTLFGIEYFDEEVFLSQSGQLYLEAAIMS-VGRGFDFGPTFRAE--KSKTKRHLTEFWMMDAEAAYVEHDENMDIQEAMVKFIARRCLENVKEELVILEPFARLTYKEAIEKLGEDLGNDDEGMLPVFIHKWPKTIKPFYMKVDPTDPEIVLIEGAGELIGGSQREDDYEVLKAEIQKEGLSGPEYQWYLDLRKYGSV-PHSGFGLGLERMVGWICGVHHIRETIPFPRMINRV... 427
68 0.000e+00UniRef50_Q0W3J1 Asparaginyl-tRNA synthetase n=6 Tax=Euryarchaeota TaxID=28890 RepID=Q0W3J1_METAR  ali  24  119LRHLHIRSKELVAIMKVKDSVLSSCREWFRASGFYEVTPPIIMSSS-------CEGGSTLFELKYFDEKAYLSQSAQLYLESLI-FGLEKVYSVTPSFRAE--KSRTTRHLAEYWHIEGEMAWVGLYEMIDMLEQLVSYVCNKTAEERHEELNLKPPFPRITYDEAVKILHEERQLSMHYDKPLFITEYPLEVKAFYMKDKVLNVDMIAPRGFGEIIGGSERETDLALLEERIRKQGEDPAKYGWYLDLRRYGSV-PHSGFGMGAERLVRWICNQEHIRDTIPYPRTISR.... 427
69 0.000e+00UniRef50_A0A1S3NUU7 probable asparagine--tRNA ligase, mitochondrial n=44 Tax=Deuterostomia TaxID=33511 RepID=A0A1S3NUU7_SALSA  ali  21  145.PHLRCRTNAFSSLLRIRSEATAAIQQYFKEKGFIQIHTPVLTS----NDCEGAGELFQVEPQHFFSVPAYLTVSGQLHLEV-MAGAFPGVYTFGPTFRAENSQS--RRHLAEFYMVEAEISFTSLEDLMKVMEDLFRSTTEHLLTQCPEDVALKKSFNVITYTEAINIWGCDLQTEHEGDFPLFVTDYPYALKPFYARDNQDQPVDLLVPGVGEMCGGSLREDRLDLLKTRLAQAGLD-ETYGWYLDLRRFGSV-PHGGFGMGFERYLQCVLGVDNIKDVIPFPRYSRSCLL. 483
70 0.000e+00UniRef50_A0A0G4IRN2 Uncharacterized protein n=1 Tax=Plasmodiophora brassicae TaxID=37360 RepID=A0A0G4IRN2_PLABS  ali  23  124..HFRGRTAAFSSVLRIRNTCSMAIHEFFQNRDFQLVHTPIITGC----DCEGAGEQFRLAETDFFGQPAFLTVSGQLHAEM-FACSIGPVYTFGPTFRREN--SHTRRHLSEFWMVEPEIPYATLNDIMDTAEGLVKYCVNQVQGRNGGDVEVIRKFARVSYTRAIEIWGHDLQTEHHFNSPVFVTDFPAKIKPFYMDKKTCASVDLLVPNIGELVGGSERIDDPALLMKSMGDHGVDPSELQWYLDLRRFGSV-PHGGFGLGFDRLVQAITGTKNIRDVMPVPRIPSAIS.. 457
71 0.000e+00UniRef50_A4WKI8 Asparaginyl-tRNA synthetase n=3 Tax=Pyrobaculum TaxID=2276 RepID=A4WKI8_PYRAR  ali  27  118VRHLWIRSRKMQAVLKIRHTVFGAIHEYFRKNGFYEVHPPMFITA-------AVEGGATLFKVQYFDKIVYLTQSSQFYLEALI-YGLEKVYTIAPSFRAEP--SRTRRHLTEFWHAEMEIAWAGMEDAVLVGEGVISHVVEKVLDERQEELRLKPPFYRVSYDEAVDIWGDDIGADEEFDKPIVLYGFPEKVKAFYHRNNPRSFDVLLPEGYGEVIGGGERIYQAEELIEKIKRFGLNPQDYWWYIDLRRYGSV-PHSGFGLGVDRLTMWIVGADHIRDVVPFPRDVRRTAP. 431
72 0.000e+00UniRef50_A3WQV3 Asparaginyl-tRNA synthetase n=7 Tax=cellular organisms TaxID=131567 RepID=A3WQV3_9GAMM  ali  24  9..HLRPRTNVTGAVMRVRNTLSQAIHRFFHEHGYLWVSTPIITTS----DCEGAGEMFVDFSQDFFGKEAFLTVSGQLNVESY-ACSLSKVYTFGPTFRAEN--SNTSRHLSEFWMVEPEVAFADLDDVAHLAEDMLKYVFKAVLEERPDDMAFFEDFVHMDYTDAIEILHERYLAEEHVGAPVILKNYPRDIKAFYMRQNKDAAMDVLAPGIGEIIGGSAREERLDVLDQRIAEMDLPAEEYEFYRDLRRYGTV-PHAGFGLGFERLVSYVTGMQNIRDVIPFPRAPKSA... 347
73 0.000e+00UniRef50_D7FLN1 Asparaginyl-tRNA Synthetase n=2 Tax=Stramenopiles TaxID=33634 RepID=D7FLN1_ECTSI  ali  26  442IAHLRPRTKMHSAAMRVRHAMAFATHKFFNDRGFLYIHTPIVTGA----DCEGAGEGAVDYSKDFFARRTCLTVSGQLNVETH-ACSLGDVYTFGPTFRAEN--SHTSRHLAEFWMIEPEVAFADLKDDMDLAEDYLKYLVAYALGHCQGDLEFQNDFVRMTYTELVDLWGDDLGSEHEYNAPCIVTDYPKDIKAFYMKLNPDAAMDILVPKIGEIIGGSQREEDLGKLTKRAKEMNLPEDSISWYLDLRRYGTI-QHAGFGLGFERLVMFATGIENIRDVIPFPRYPGHAS.. 804
74 0.000e+00UniRef50_P14868 Aspartate--tRNA ligase, cytoplasmic n=70 Tax=Eukaryota TaxID=2759 RepID=SYDC_HUMAN  ali  18  183.RVIDLRTSTSQAVFRLQSGICHLFRETLINKGFVEIQTPKIISA-------ASEGGANVFTVSYFKNNAYLAQSPQLYKQMCICADFEKVFSIGPVFRAED--SNTHRHLTEFVGLDIEMAFYHYHEVMEEIADTMVQIFKGLQERFQTEIKFLEPTLRLEYCEALAMLREEKYDTDFYILDKYPLAVRPFYTMPDPRNPKQSNSYDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFG-APPHAGGGIGLERVTMLFLGLHNVRQTSMFPRDPKR.... 498
75 0.000e+00UniRef50_D2H3U0 Asparaginyl-tRNA synthetase 2, mitochondrial (Fragment) n=166 Tax=Amniota TaxID=32524 RepID=D2H3U0_AILME  ali  21  143.PHLRCRTNTLGSILRVRSEATAAIHSFFKDSGFVHIHTPIITS----NDCEGAGELFQVEPENFFNVPAFLTVSGQLHLEV-MSGAFTRVFTFGPTFRAENSQS--RRHLAEFYMVEAEISFVSLQDLMQVMEGLFKTATTIVLSNCPEDVELKNNFVIISYTEAIEILHEKYLVKHCGNIPVFVINYPLALKPFYMRDNEDGPQDLLVPGVGELFGGSLREERYHFLEQRLARLGLT-EAYQWYLDLRRFGSV-PHGGFGMGFERYLQCILGIDNIKDVIPFPRFTHSCVL. 477
76 0.000e+00UniRef50_A0A1V0KWE2 Asparagine--tRNA ligase n=12 Tax=cellular organisms TaxID=131567 RepID=A0A1V0KWE2_9GAMM  ali  22  126..HLRPRTNIGGAVTRVRNTLAQAVHRFLHSKGYFWISTPLITGS----DCEGAGEMFRVSTLDFFGKETFLTVSGQLNVETY-CCALSKVYTFGPTFRAEN--SNTTRHLAEFWMIEPEIAFADLSDAADLAEEMLKYVFQAVLDERADDMAFNNDFVRLDYTDAITILHERYLAEEHFNGPVVLQNYPKDIKSFYMRGKTVAAMDILAPGIGEIIGGSQREERLDVLDKRLAEMNLDPADYSWYRDLRRYGTV-PHSGFGLGFERLVAYATGMQNVRDVIPFPRTPNNAS.. 465
77 0.000e+00UniRef50_A0A0S7I249 SYNM (Fragment) n=5 Tax=Euteleostomi TaxID=117571 RepID=A0A0S7I249_9TELE  ali  21  7VPHLRCRTNAFSSLLRIRSEATAAIHSYFKNNGFVQIDTPIITS----NDCEGAGELFQIEPDNFFSVPAFLTVSGQLHLEV-MSGAFSRVYTFGPTFRAENSQS--RRHLAEFFMVEAEISFTSLEDLTKVMEDVFRSATQRVLASCAADVDLNKSFPVISYTEAIDIWGCDLMTEHEGNVPVFITDYPYDLKPFYARDNQDRPKDLLVPGVGELCGGSLREERLNLLMARLKRVGL-EDTYNWYLDLRRFGSV-PHGGFGLGFERYLQCILGVDNIKDVIPFPRFSHSCLL. 342
78 0.000e+00UniRef50_A3CXH4 Aspartate--tRNA(Asp/Asn) ligase n=37 Tax=root TaxID=1 RepID=SYDND_METMJ  ali  24  120.RFLDARKPRVRAIFFIRSAVTCAATAFLASRGCINIATP-------KIVAAATEGGTELFPIAYFEKEAFMNQSPQLYKQMMMAAGFEAVFEIGPIFRAE--EHNTVRHLNEATSLDVEVSFADHNDVMELLEDLIVHVYDHVAKDCSEEIDLKKPFPRIPYAEAIEIFGDDLSPADTVGQHYFIVDWPTDIRMPYPDRPEFCKAFDLMHPRMELSSGAQRIHDHDLLVERISAKGLSPESFEFYLKPFRYG-MPPHAGWGLGIERLVMTMLDLPNIREAVLFPRDRHR--LM 428
79 0.000e+00UniRef50_A0A1G1Q925 Aspartate--tRNA(Asp/Asn) ligase n=18 Tax=root TaxID=1 RepID=A0A1G1Q925_9BACT  ali  22  129.RYLDLRRKKVMQALQVRHKLCATIREFLNKYNFMEIETPVLT----KSTPEGARDFLVPARMSP-GKFFALPQSPQLFKQILMVSGIDRYYQIVKCFRDEDLRAD---RQPEFTQLDMEMSFVEEEDIFALTENLFKEIFKKIKG-----IDLPIPFPRLSHADAMKKYNSDKPDIRKEGEFVWVVDFPMFKYNEQEKRWDSEHHYDLVLNGNEIGSGSIRIHKKEMQKNIFDIIGLEKEDFGFLLRAFEYG-APPHAGVAYGIDRIVAILTGLESIRDTIAFPKTQKGNCLI 439
80 0.000e+00UniRef50_D7G2B1 Asparaginyl-tRNA Synthetase n=14 Tax=Eukaryota TaxID=2759 RepID=D7G2B1_ECTSI  ali  23  162IAHLRPRTNTIAAVARVRSALAQATHDFFREEGFLYLQSPIITAS----DCEGAGEMFRVTTLDFFGKPAFLTVSGQLSGETH-ACALGDVYTFGPTFRAEN--SQTTRHLAEFWMIEPEMSFADLRDDMDNAEAFVKHVVSHAMEVCGSDLEFFNKFQRIKDKPFVRTEHERWLAETRYDTAVFVYDYPRDIKAFYMRDNEDAAMDLLVPGVGELIGGSQREERLEQLEAKMVEFNLSPEDYWWYNDLRRYGSV-PHAGYGLGFERLVCYVTGVENIRDAIAFPRSPGSA... 476
81 0.000e+00UniRef50_A0A2N3HPL0 Asparagine--tRNA ligase n=23 Tax=Bacteria TaxID=2 RepID=A0A2N3HPL0_9FLAO  ali  22  119..HLRTRTSTFSAVMRLRSALSFAIHSYFNENGFYYVNTPIITGS----DAEGAGEMFRVSSLDFFGKETNLTVSGQLEAETY-AMSLGKVYTFGPTFRAEN--SNTSRHLAEFWMIEPEVAFMDLAGNMDLAESFLKYIIKYILDNNREDLDFLNNFTRLSYTEAIDEWGTDLQSEHHFKCPVILYDYPANIKAFYMRLNEDGKMDILFPGIGEIVGGAQREERLDVLKKKMAALNIPEEDLWWYLDLRKYGTAV-HSGFGLGFERLVMFATGMSNIRDVIPFPRTPQNA... 475
82 0.000e+00UniRef50_B0VGZ6 Asparagine--tRNA ligase n=12 Tax=Bacteria TaxID=2 RepID=B0VGZ6_CLOAI  ali  23  118.RHLWIRSQKQWAILRIRHTVYYAICNYLNEHNFIRFDSPILT-------PNACEGTTTLFELDYFDEKAYLSQSGQLYLETGIMS-FGRVYDFGPVFRAE--RSKTRKHLTEFWMMDAEAAFVEHDENMQIQEDLIRYVIRTVLSECALELQILEPFKRMTHYEAVELLGSDITHTEDSEVPVFVERWPKEIKAFYMKRDPLNPNLVLPEGFGELIGGSQREDDYELLLSRMQAENMPIDDYQWFLDLRKYGSV-PHSGFGVGLERLVAWLSGTPHIRETIPFPRMIYRI... 429
83 0.000e+00UniRef50_A0A0M0BUJ2 Uncharacterized protein n=5 Tax=Candidatus Bathyarchaeota TaxID=928852 RepID=A0A0M0BUJ2_9ARCH  ali  24  115VRHLWLRSRRMNLIMKIRDAVLQFARDFFESQDFTEVSPPMFISA-------AVEGGSTLFGVKYFDQNLYLTQSSQLYLEILIYS-LEKVYCIAPSFRAE--KSRTIRHLTEYWHIEGEWPFAEMNDLMCFEEELMAHICQQTAEKCKLELEVKTPFSRITYAEAVELLHKEKTLAEEFGKPFFVYDYPAFYCKTYRDRPEVAMSVDLVPRIGEISTGGAREDDKGVLIKRIENMGLKAEDYEWYLDLRRYGTV-PHIGFGMGVERLLAWMLDLENIIDAIPFPRTTRR.... 424
84 0.000e+00UniRef50_Q7N622 Asparagine--tRNA ligase n=267 Tax=cellular organisms TaxID=131567 RepID=SYN_PHOLL  ali  23  124VAHLRPRTNLIGAVARMRHTLAQALHRFFHENGYFWVSTPLITAA----DTEGAGEMFVDFNQDFFGREAFLTVSGQLNGEAY-ACALSKVYTFGPTFRAEN--SNTSRHLAEFWMLEPEIAFANLNDAATLAENMLKYVFKAALAERADDLQFNSDFAQIDYTSAIEILHERYLAEKHFQAPVVVKNYPKDIKAFYMRMNDDGKTDVLAPGIGEIIGGSQREERLDMLDKRLEEMGLNKEDYWWYRDLRRYGTV-PHSGFGLGFERLVAYVTGVPNVRDVIPFPRTPRSA... 464
85 0.000e+00UniRef50_A0A2R6B1A9 Aspartate--tRNA(Asp/Asn) ligase n=8 Tax=Archaea TaxID=2157 RepID=A0A2R6B1A9_9ARCH  ali  22  117.RFLDLRRPEVAAVFKIQSKLGKAIREFFDKKGFYEIHT-------SKIVSQATEGGANVFPIFYFKRTAYLAQSPQFYKQMMIAAGFEKVWEIGPVFRAEP--HHTPRHLCEYTSIDLEMGYIKNHDVIDVVEELMVYSLDYLRREAQEELDLLRPFPRVTMREAYSIYGSDLDPEKFGHDFVFLTEFPWFYHMRKSEEPEWTNRADLLFKGLEICTLAQREHRYDVLLSQAREKGLNPKDFEFYLNFFRYG-VPPHGGGALGIERIVMQLLDLKNVREAVLLPRTPER.... 428
86 0.000e+00UniRef50_P58694 Asparagine--tRNA ligase n=1098 Tax=root TaxID=1 RepID=SYN_ECO57  ali  22  124VAHLRPRTNLIGAVARVRHTLAQALHRFFNEQGFFWVSTPLITAS----DTEGAGEMFVDFDKDFFGKESFLTVSGQLNGETY-ACALSKIYTFGPTFRAEN--SNTSRHLAEFWMLEPEVAFANLNDIAGLAEAMLKYVFKAVLEERADDMKFEADFAQVDYTEAVTILHERYLAEEHFKAPVVVKNYPKDIKAFYMRLNEDAAMDVLAPGIGEIIGGSQREERLDVLDERMLEMGLNKEDYWWYRDLRRYGTV-PHSGFGLGFERLIAYVTGVQNVRDVIPFPRTPRNAS.. 465
87 0.000e+00UniRef50_A0A1C5PUV2 Asparagine--tRNA ligase n=3 Tax=Firmicutes TaxID=1239 RepID=A0A1C5PUV2_9FIRM  ali  25  513ISHLRPRTNAFQAVFRVRSLTAYAIHKFFQERDFVYVHTPLITGS----DCEGAGEMFVDFSQDFFGKQTNLTVSGQLNGET-FAQAFRNIYTFGPTFRAEN--SNTTRHAAEFWMIEPEIAFSDLKDDMILAESMLKYVIRYVMENAPEEMQFESEFAHVTYTEAIELWGCDLQTEHEFKRPVFVTDYPKEIKAFYMKLNEDAAMDCLVPGIGEIIGGSQREDDYEKLLARMNELGLKEEDYGFYLDLRKYGSTR-HAGFGLGFERCVMYLTGMSNIRDVIPFPRTVGNCEL. 855
88 0.000e+00UniRef50_A0A2A5AHK0 Asparagine--tRNA ligase n=1 Tax=Candidatus Cloacimonetes bacterium TaxID=2030808 RepID=A0A2A5AHK0_9BACT  ali  25  118.RHLWLRSRLQRSIMQVRHEIIASLHNFFYERGFTHMDSPILTGTI-------GEEGSTLFSTEYFDKNAYLAQTGQLYLE-ASCAALGKVYCFGPTFRAE--KSKTRRHLTEFWMLEAEVAFNNNEDNMDLQEEMFKHVVQHVIDKCPLQLKFLQPFARISYDDAVDRLGKDLGAEDEFDMPVFIYNYPKSCKAFYMKKDPTNCSDLLVPGYGEVIGASQREDDLETLKQGIIDFGLDPAAFDWYLDLRRYGTFE-HSGFGIGLERTISVLTGVKHIRETIPFPRMMTHLEP. 430
89 0.000e+00UniRef50_C5KPS6 Asparaginyl-tRNA synthetase, putative n=2 Tax=Perkinsus marinus (strain ATCC 50983 / TXsc) TaxID=423536 RepID=C5KPS6_PERM5  ali  23  388IAHLRPRTNLIGAVARVRSSLSGAVHAFFMSRDFKYVHTPLITSA----DCEGAGEMFQVTSLDFFGRPTYLTVSGQLNVENY-ACALSDVYTFGPCFRAEN--SHTSRHLAEFWMIEPELCFADIHDNMKCAEEFIQHCARHVLAHCREDIAFAEPFARVSYTEAIDKLHERYLTEKIYKKPVIVYNYPAAIKAFYMRANEADEMDILAPLVGEVCGGSVREERLDVLDKKLSDLNMDVEDYWWYRDLRRFGSV-PHAGFGIGFERLIMMMTGVENIRDVIPYPRYPGRC... 745
90 0.000e+00UniRef50_E6N8T9 Asparaginyl-tRNA synthetase n=10 Tax=Archaea TaxID=2157 RepID=E6N8T9_9ARCH  ali  25  118.RHLAIRSPKAAAILRFRSNLLKSIRNWFEREGFVEVHCPTFITA-------AVEGGATLFEVNYFGKKVYLTQSVQFYQEAAIYS-LGKVYSIQPSFRAE--RSKTRRHLTEFWHVEGEMAFAGLDDLMKVVERLVGEASAETLENSRDVLKLLPPYHRVKYSEALDIWGSDKILTMEFDKPFFLTHFPKKAKAFYHMPDPANPELTLPEGYGEIVGSGQRIHDYQQLLTRIVEEGLEPSDYKWYLDLRKYGSV-PHSGFGLGVERLVQWLLGLKNIRSAVMFPRTMTR.... 426
91 0.000e+00UniRef50_UPI000B8FE7AC probable asparagine--tRNA ligase, mitochondrial n=3 Tax=Pomacentridae TaxID=30863 RepID=UPI000B8FE7AC  ali  21  150.PHLRCRTNAFSSLLRIRSEATTAIHSYFKENDFVQIHTPIITS----NDCEGAGELFQVEPEYFFSVPTFLTVSGQLHLEV-ISGAFSRVYTFGPTFRAENSQS--RRHLAEFYMVEAEISFTSIEDLTKVMEDMFKSATEHVLAHCVEDVDLKSSFPVITYTEAVDIWGCDLKTEHEGNTPVFVTDYPYDLKPFYARDNQDHPEDLLVPGVGELCGGSLREERLDLLSARLEEAGL-EDIYSWYLDLRRFGSV-PHGGFGLGFERYLQCILGVDNIKDVIPFPRFSHSCLL. 484
92 0.000e+00UniRef50_A0A257A4K4 Aspartate--tRNA ligase n=2 Tax=Euryarchaeota TaxID=28890 RepID=A0A257A4K4_9EURY  ali  20  123.RFIDLRREETRAIFLVRHTFIKAAMSFLSSEGFIQVHTPKITISSP-------EGGTEVFKINYFGKDAYLVQSPQLYKQILMATGFDRVYEIAWYFRAE--EHDTTRHLNESTAVDIEMAFISEEDVMHICEKMVQHSLKKIAEEREEELKILNPFKRIPYDEVVDIWGDDLGIKHINEDFYFITKFPLETKPFYMPEGKYARAFDLEYRGVEISSGAQRIHDKELLEKRLKELNMNVDNFKDYLKAFQYG-MPPHGGFGFGIERFLMKMLNLGNVRECIFFPRDKKRISP. 429
93 0.000e+00UniRef50_A0A0B3A9H8 Aspartate--tRNA(Asp) ligase n=7 Tax=Archaea TaxID=2157 RepID=A0A0B3A9H8_9ARCH  ali  24  152.RFLDTRNPKRLAIFKIRSKIVKILTNFLDAQGFTNINTPKLTTI-------GVESGAELFKVDYFGTPVYLAQSPQVYKQMFVAGGFERVYEIAPVFRAE--KSHTMRHLTEFTGVDFEMGFIDHNDVMDLIESMFFDLVRNLEKEARAELELLTKIPRLTLDEAKKLLGEKLICEKYNSEFVFITLFPPFYQMKDEKNKKVTKSFDLLLNGVEICSGSQREHRVEVWKAQAKEKGLDPEAMKEYLELFQYG-MPLHGGAGFGLDRITQRLLGLDNVREAVLLPRDPER.... 462
94 0.000e+00UniRef50_UPI000852AF19 asparagine--tRNA ligase n=1 Tax=Vulcanisaeta thermophila TaxID=867917 RepID=UPI000852AF19  ali  23  120VRHLWLRSRRMWAVLRVRHTVFGAIHEFFRSRGYFEVQGPMFVSA-------AVEGGATLFPVEYFDKNVYLTQSSQFYLEVLIYS-LEKVYTVAPSFRAE--KSRTRRHLTEFWHAEAEEAWLQFDGLMNFLEDLITYIVKRVLDERQEELNVKPPFHRIDYDEAIRILQEERVLTMQFDKPILLHHFPAFYHRNDPSRPETTLSVDLPEGYGEVIGGGERIYDYEELLSKIKKFGLNPEDYYWYLDLRKYGSV-PHSGFGLGIDRLVMWICGLDHIRDAVPFPRDVRRVKP. 434
95 0.000e+00UniRef50_O48593 Asparagine--tRNA ligase, chloroplastic/mitochondrial n=84 Tax=Embryophyta TaxID=3193 RepID=SYNO_ARATH  ali  24  216..HLRPRTNTFGAVARVRNTLAYATHKFFQESGFVWVASPIITAS----DCEGAGEQFCVTTLDFFGKPAFLTVSGQLNGETY-ATALSDVYTFGPTFRAEN--SNTSRHLAEFWMIEPELAFADLDDDMACATAYLQYVVKYVLDNCKEDMEFEKEFLQLGYTDAIEIWGLDLQSEHFGGRPVIIRDYPKEIKAFYMRENDDAAMDMLVPRIGELIGGSQREERLEVLEARLDELKLNKESYWWYLDLRRYGSV-PHAGFGLGFERLVQFVTGIDNIRDVIPFPRTP...... 562
96 0.000e+00UniRef50_A0A2T5CEP9 Asparagine--tRNA ligase n=15 Tax=cellular organisms TaxID=131567 RepID=A0A2T5CEP9_9DELT  ali  25  119IAHLRPRTNKYGAMARIRSEAAFAVHDFFRGRGFWYLHAPILTGS----DCEGAGEMFRVTSLDFFGRQANLTVSGQLEAELY-ACALGKVYTFGPTFRAEN--SNTPRHAAEFWMIEPEFAFGDLAEDMQLAEDLTKAMVRHVMDTRADDLELAKPFARISYAQAIDILGSDLQTEHHFKQPVIVYDYPRTIKPFYMRLNDDAAMDLLVPRVGELVGGSQREERLNILSDRMDEQGLNKDAYWWYLDTRRFGSA-PHAGFGMGFERFLMMITGATNIRDVIPFPRTPGH.... 456
97 0.000e+00UniRef50_A0A2Y9S8G4 uncharacterized protein LOC112062883 n=1 Tax=Physeter catodon TaxID=9755 RepID=A0A2Y9S8G4_PHYCD  ali  24  33IAHLRPRSQLMGALTRVRSQLAMATHQFFQDRGFLYIHTPIITAS----DCEGAGEMFQVTTIDFFGRRAFLTVSGQLNVEPY-CCALGDVYTFGPTFRAEN--SHTSRHLAEFWMVEPEIAFATLEDNMRVAEAYVKYCVRWVLDNCRDDIELAEPFARVTYTDAVELWGMDLGSEHEYKKPCIVYDYPKEIKAFYMKLNEDGRMDVLVPKIGELIGGSQREDNLQLLDKMIISKGLDPTNYWWYRELRSYGSV-PHAGFGLGFERLVMLVTGVENIRDTVAYPRYPGHAD.. 406
98 0.000e+00UniRef50_A0A1V2YEX8 Asparagine--tRNA ligase n=4 Tax=Bacteria TaxID=2 RepID=A0A1V2YEX8_9FIRM  ali  24  121IAYLRPRTNTFAAVFRVRSLASYAIHSFFQDRSFVNVHTPVITTS----DCEGAGELFRVTTLDFFGKMAYLTVSGQLSAEV-FALAFRDVYTFGPTFRAEN--SNTPRHAAEFWMIEPEIAFADLEDCMKLAEDMLKYVIWAILENASSEVEFSSEFAKVTYTAAIEIWGCDLQTEHHFQKPVFIINYPKEIKAFYMRDKTVAAMDLIVPGIGELIGGSQREERLDILSQRIDEAGLNQEDYWWYLNLRKFGGTR-HSGYGLGFERLIMYLTGMTNIRDVIPFPRTPGNA... 454
99 0.000e+00UniRef50_A0A2D6P9Y7 Aspartate--tRNA(Asp) ligase n=1 Tax=Candidatus Woesearchaeota archaeon TaxID=2026803 RepID=A0A2D6P9Y7_9ARCH  ali  24  124.RYIDLRNPKNLAIFRVRSKITSAIHEFFEKNDFIEMHTSKLS-------GAGAEGGAELFELPYFGKKVALNQSQQLYKQLIMLSGFEKAYEIGTSYRAE--KSHTYRHLTEFWQLDVEMSFIDIDDIMKIEERLLVHILKKIKKDCKKELEPKLPFPRITYSDACKLLGTELIKKKHNTEAFFLINFPKHTKFYAMHDKKIGRYIDLIYKNNEISSGGQREHRYDILIEQIKERKLNPKELEFYTEPFKYG-VPPHGGFGMGIDRLTAFILNLSNIREGVLFPRDVDRI... 428
100 0.000e+00UniRef50_A0A2P5G150 Aspartyl-tRNA synthetase, archaeal-type n=1 Tax=Trema orientalis TaxID=63057 RepID=A0A2P5G150_9ROSA  ali  21  391.RVIDIRTPANQGIFRIQCQVGTVFRQFLLSEDFVEIHTPKLI-------AGSSEGGASVFKLDYKGQPACLAQSPQLHKQMAICGDFGRVFEIGPVFRAEN--SFTHRHLCEFTGLDVEMEIKHYFEVMDIVDRLFVAMFDSLNKNCVKELKRQYPFERLTFEEGVQMLKDKLVLEKYGTEFYILHHYPPFYTMPCYDNPAYSNSFDVFIRGEEIISGAQRVHVPELLAERAQACGIDVNTISTYIDSFRYG-APPHGGFGVGLERVVMLFCGLNNIRKTSLFPRDPNRIAP. 709
101 0.000e+00UniRef50_A0A257AFH6 Asparagine--tRNA ligase n=1 Tax=Candidatus Bathyarchaeota archaeon ex4484_205 TaxID=2012510 RepID=A0A257AFH6_9ARCH  ali  27  118MRHLHIRSIKVSAVMRVRSEVCNVAREWLRKEGFVEIHAPSIITM-------AVEGGATLFPIDYFGERAYLTQSSQFYEEAAI-TGLGKVYTLQPSFRAEM--SRTRRHLTEFWHLECEMAFSTHEDVMNLEERLISHIAESISELNRKFEPPQRPFERISYDEAIEILKEEGYEIEWGED----------------------------EGYGEITTGGQRIHDYESLLKRIEEEGLNPEDYSWYLELRKYG-MPPHSGFGLGIERLIAWICGLEHVRDACLFPRTPSRV... 375
102 0.000e+00UniRef50_I1MX58 Uncharacterized protein n=52 Tax=Mesangiospermae TaxID=1437183 RepID=I1MX58_SOYBN  ali  20  226.RVLDVRTPANQGIFRIQSQVGNAFRQFLVSQGFCEIHTPKLI-------AGSSEGGAAVFRLDYKGQPACLAQSPQLHKQMSICGDFGRVFEIGPVFRAED--SYTHRHLCEFTGLDVEMEIKHYFEVMDLVDRLFVAMFDSLNQNCKKDLESQYPFERLTYEEGIQMLKDEKYGTEFYILHRYPLAIRPFYTMPCYDNPAYSNSFDVFIRGEEIISGAQRVHVPEFLEQRAAACGIDVKTISSYIDSFRYG-APPHGGFGVGLERVVMLFCGLNNIRKTSLFPRDPLRIAP. 544
103 0.000e+00UniRef50_A0A257A596 Aspartate--tRNA(Asp) ligase n=2 Tax=Euryarchaeota TaxID=28890 RepID=A0A257A596_9EURY  ali  27  123.RFIDMRKRDVLAIFEIRSSLLQGIREALLEENFIEVHTP-------KIVATATEGGTELFPVKYFEKDAYLNQSPQLYKQMLMAAGLDRVFEVAPVFRAE--EHNTTRHLNEFISIDIEMSFANEEDAMQMLEKSIVKAIKKIEENNREEMELLGPFKRITYDEALEIWGEDFSAESELQEFYFITRWPMRIKPFYVLPDDYSHAFDLMYGEREITSGAQRNHIYESLVKIMRSKGLNPENFEYYLRTFRYG-MPPHAGWGLGLERLTMIITGVKNIRECVIFPRDRTR.... 425
104 0.000e+00UniRef50_Q9HKS7 Asparagine--tRNA ligase n=26 Tax=Archaea TaxID=2157 RepID=SYN_THEAC  ali  23  117.RHLWLRSREFTSVLKIRSTIFRSFADFFYENGYYQVQTPFMVS-------TAVEGGSTLFKVDFFGEPIYLNQSAQFYLET-MIYSLEKVFTIAPSFRAE--KSRTRRHLTEYWHAEAEVAWIDNNEMMDIEERMIYYIVSRVTEDNEDELKMKPPFPRIRYSEIIKKYGDDRQITMKYDRPIFVTNYPKDLKPFYMPVDPENPGEVLPEGYGEIIGGSQRIWNYDELMQRIREANLDESAYYWYVDLRKYGSV-PHSGFGLGLDRLAMWIMHLDNIREAIPYPRTIRR.... 426
105 0.000e+00UniRef50_Q8H104 Aspartate--tRNA ligase 1, cytoplasmic n=28 Tax=Eukaryota TaxID=2759 RepID=SYDC1_ARATH  ali  21  214.RVLDIRTPANQAIFRIQCQVQIAFREYLQSKGFLEIHTPKLI-------AGSSEGGSAVFRLDYKGQPACLAQSPQLHKQMAICGDMRRVFEVGPVFRAED--SFTHRHLCEFVGLDVEMEIMHYSEIMDLVGELFPFIFTKIEERCPKELESVRPFQRLTFAEGIQMLKEEKYKTEFYMLHRYPSAVRPFYTMPYENDSNYSNSFDVFIRGEEIMSGAQRIHDPELLEKRARECGIDVKTISTYIDAFRYG-APPHGGFGVGLERVVMLLCALNNIRKTSLFPRDSQR.... 529
106 0.000e+00UniRef50_Q55FI3 Probable asparagine--tRNA ligase, mitochondrial n=8 Tax=cellular organisms TaxID=131567 RepID=SYNM_DICDI  ali  21  127IAHIRSRGNSIGALLRVRNKSTQLIHQYFNDNGFINVHTPIITAS----DCEGGGEQFQKSSLDFFGQPSFLTVSGQLEAEIY-ACSHSRVYTFGPTFRAE--KSNTPRHLSEFWMIEPEMAFIDLNDNLDIAEDFCKYLIRNLLDSCKEDIEFSTPFIRLEYKDAIQKWGDDFITTHFGEIPVFVINWPKSIKPFYMRENEQSNMDLLVPTVGELIGGSIREERYDKLLNTINEMGMDKDQYSWYLDLRKYGTV-PHGGFGLGFERFLQFVTGLQNIKDVIPIPRHQNYC... 458
107 0.000e+00UniRef50_Q8U4D3 Asparagine--tRNA ligase n=27 Tax=Archaea TaxID=2157 RepID=SYN_PYRFU  ali  23  122.RHLHIRTPKASAIMKVKETLIMAAREWLLKDGWHEVFPPILVT-------GAVEGGATLFKLKYFDKYAYLSQSAQLYLEAAI-FGLEKVWSLTPSFRAE--KSRTRRHLTEFWHLELEAAWMDLWDIMKVEEELVSYMVQRTLELRKKEIETEPPFPRISYDEAIDILQEERVLTEEFDRPFFVYGYPKQIKAFYMKEDPNDPRKVLPEGYGEIIGGSQREDDYEKLLNRILEEGMDPKDYEWYLDLRKYGSV-PHSGFGLGVERLVAWVLKLDHIRWASLFPRTPAR.... 431
108 0.000e+00UniRef50_Q979Y4 Asparagine--tRNA ligase n=14 Tax=root TaxID=1 RepID=SYN_THEVO  ali  24  117.RHLWLRSREFTSILKVRSTIFRSFADFFYDQGYYQVHTPFMVS-------TAVEGGSTLFKVDFFGEPIFLNQSAQFYLET-MIYSLEKVFTIAPSFRAE--KSRTRRHLTEYWHAEAEVAWIDNREMMDVEENMIYYIIQRVIEENYDDLKLKPPFPRVKYSDIIKKYGDDLGADEEYCKPVFVTNYPKELKPFYMPQDPDNPSEVLPEGYGEIIGGSQRIWDYKELMQRIREAGLDESAYYWYIDLRKYGSV-PHSGFGLGMDRLAMWIMHLDNIREAIPYPRTIRR.... 426
109 0.000e+00UniRef50_Q4L6F8 Asparagine--tRNA ligase n=496 Tax=root TaxID=1 RepID=SYN_STAHJ  ali  24  117.RHLWLRSKKQHAVMKIRNEIIRATYEFFNENGFTKIDPPILTASAP-------EGTSELFHTKYFDEDAFLSQSGQLYMEAA-AMAHGRVFSFGPTFRAE--KSKTRRHLIEFWMIEPEMAFTNHVESLEVQEQYVSHVVKSVLKNCQLELKVSAPFPRISYDDAIKEWGEDFGAPHHYDLPVFITNYPTKIKPFYMQPNPENEETVLPEGYGEIIGGSERINDLELLEQRIDEHQLDAESYNYYLDLRRYGSV-PHSGFGLGLERTVAWISGVEHVRETAPFPRLLNR.... 427
110 0.000e+00UniRef50_A0A1S3CR09 aspartate--tRNA ligase 2, cytoplasmic n=38 Tax=Eukaryota TaxID=2759 RepID=A0A1S3CR09_CUCME  ali  20  227.RVLDMRTPANQGIFRIQCQVSTMFRQFLLDEDFVEIHTPKLI-------GGSSEGGASVFRLDYKGQPACLAQSPQLHKQMAICGDFGRVFEIGPVFRAED--SYTHRHLCEFTGLDVEMEITHYSEVMDIVDRLFVAMFDSLNERCKKALEKQYPFERLTFEEGIQMLKDEKYGTEFYILHRYPLAVRPFYTMPCYDNPTYSNSFDVFIRGEEIISGAQRVHVPEFLAERAQACGIDVKTIETYIDSFRYG-APPHGGFGVGLERVVMLFCGLNNIRKTSLFPRDPQRIAP. 545
111 0.000e+00UniRef50_R9T6A7 Aspartate--tRNA(Asp) ligase n=17 Tax=Euryarchaeota TaxID=28890 RepID=R9T6A7_METII  ali  26  127.RFMDLRKPEARAVFEIKSKVLRLIDEYLLGEDFVEVFSPKIVAS-------GAEGGATLFKLDYFGKPAYLAQSPQLYKQMIMSTGLDRVFEIGPAFRAEP--SDTVRHVSEFISFDGEMAYIDMNDVLQMLEGCIQHVIKGVAETSSAQLEIKAPYPIIEYKDAVEILGDDLVMEEKGYEMYWIVEYPEEAKPFYIMEKPYSYSFDLDYKGQEISSGGQREHRYNVLVDRISKKGLNPDDFNFYLDAFKYG-MPPHGGWGIGVERLVQKMLSLPNVREAILFPRDRVR.... 436
112 0.000e+00UniRef50_A0A075GFN8 Aspartate--tRNA(Asp/Asn) ligase n=5 Tax=cellular organisms TaxID=131567 RepID=A0A075GFN8_9EURY  ali  20  124.RYLDLRRPEVAAFFRIRAAISGAVHNHLRREGFLEVQTPKIIAS-------ATEGGTALFPVQYFDREAYLAQSPQLYKQVLMSGGLDRVYEVGPAFRAE--EHNTPRHLNEFISIDIEMSWADDDDVMGVMERLVATCAESVSQEAEALLEVELPLPRITYDEAIVIWGDDLSMEEQYGGFYFITKWPLSLKPFYIQPEKHSRSFDFMFREVEMTSGGQRVHDVALLEQRLREQGLDPTEFGHYLEPFRYG-MPPHGGWGLGLDRLAMVFSGAQNVRECVLFPRDRNR.... 425
113 0.000e+00UniRef50_A0A256ZYX4 Asparagine--tRNA ligase n=6 Tax=Archaea TaxID=2157 RepID=A0A256ZYX4_9ARCH  ali  25  118.RHLHIRSVKMQAIMRIKDAVMTAARDWFHKEGFVEVTPPIILKQ-------ACEGGSTLFKLDYFGHEAYLSQSAQLHLE-AMIFGLEKVYSVTPSFRAE--KSRTRRHLTEYWHIEAEAAWADFEENLRIQEELVSYICQRVADERAEDLKFLTPFPRITYDEAIEMLKKDRQLSTHFDKPFFIMFFPKQIKAFYMKKTVLGADLIAPQGFGEIIGGSERETDHRTLVERLKEEGEKIENYQWYLDLRKYGSV-PHSGFGLGTERLVRWICKTEHIRDVIPFPRTPNR.... 425
114 0.000e+00UniRef50_A0A1X2GU73 Asparaginyl-tRNA synthetase n=8 Tax=Fungi TaxID=4751 RepID=A0A1X2GU73_9FUNG  ali  21  120INHLRARGNTGSAVLRMRNAASEGIQRFFASEEFIQVHTPLLTSS----DCEGAGEVFGITPSDFFKQPVYLTVSGQLHAEI-MATAMGRVYTFGPVFRAEP--SLTSRHLAEFWMVEAEMTFLDLDQLLDVTEANVQETTRHVLDRCADDMAFQQPFVRMSYTEAVDTWGSSLQSEHECDRPVFVTDYPAELKPFYMRANDADCFDLLMPGIGELVGGSMREERHDVLLGKMKHAGMKMDDYQWYLDLRKYGSA-PHGGYGIGFERLMLWLTGLDNVREVVPVPRWVGHC... 447
115 0.000e+00UniRef50_A0A1X2IJH1 Asparaginyl-tRNA synthetase n=5 Tax=Fungi incertae sedis TaxID=112252 RepID=A0A1X2IJH1_9FUNG  ali  21  131INHLRSRANTGSAVLRMRHAAGEGLQKFFADQEFIQVNTPLLTSS----DCEGGGEVFSVAPSDFFKKPVYLTVSGQLHAEI-MATSMGRVYTFGPVFRAE--ESMTSRHLAEFWMAEAEIAFIDLDQLLDVTEANIQQTTQHVMDKCYDDVAFDKPFVRMTYTEAIDILERYLASDECCGRPVFVTDYPKELKPFYMRANPDGCFDLLLPGIGELVGGSMREDRYDILQHKMEVAGMNCEDYQWYLDLRKYGSA-PHGGYGIGFERLMLWLTGLDNVREVVPIPRWAGHC... 456
116 0.000e+00UniRef50_A0A1X7EXS9 Asparagine--tRNA ligase n=7 Tax=Bacteria TaxID=2 RepID=A0A1X7EXS9_9DELT  ali  23  120IAHLRPRTNKFGAMFRIRAELSFAVHQFFRDKGFFYVHTPIITGS----DCEGAGEMFRVTSLDFFGKESHLTVSGQLSAEMY-ALALGSVYTFGPTFRAE--KSNTPRHAAEFWMIEPEVAFADLEDNMDLSEEMVKYLINHILDKCADDIELFAKFERVAYTDAIELLHERYLTEEHFKKPVIVYDYPVEIKPFYMRGKTVAAMDLLVPRIGELIGGSQREERLDVLERRITEMGMETEDYWWYLDSRRFGTA-PHAGFGMGFERMLMMITGVTNIRDVIPFPRTPK..... 459
117 0.000e+00UniRef50_T0LLT1 Aspartate--tRNA(Asp) ligase n=1 Tax=Thermoplasmatales archaeon I-plasma TaxID=667138 RepID=T0LLT1_9EURY  ali  24  119.RFLDLRRPEILSIFKVQSTISNAIRNYFVQHGFIEIHSP-------KIVAAATEGGTELFPVKYFERNAYLSQSPQLYKEIMMAAGFDKVFEVAPAFRAE--EHNTPRHINEFTSIDMEMSFVNDEDVMNVLEDVIKAAGKSVAESNKRELEILGDFKRITYSDYVKRANEKGFEIRDGKEFYFITRWPRELKPFYPFDDKYSRGFDLQFGEMEITSGAQRVHLPEVLISNLKSKGLNPDSFNFYVNAFRYG-MPPHAGWAIGLERLTMVMLDIANIRETTLFPRDRTRI... 423
118 0.000e+00UniRef50_A0A286RAF0 Asparagine--tRNA ligase n=19 Tax=cellular organisms TaxID=131567 RepID=A0A286RAF0_9PLAN  ali  23  123IAHLRPRTNSFGAVARVRSAMSFSIHRFFQEEGFLYIHTPIITAS----DCEGAGAMFRVTTLDFFGKPTYLTVSGQLEAEAY-ACALGKVYTFGPTFRAEN--SNTTRHLAEFWMVEPEAAFFELSDNMDLAERFLKRIFRDVLEQCAEDMEFDSEFVRLTYTEAIDIWGRDLQAEHHFRRPVILIDYPRQIKPFYMRGKTVRAMDVLLPRVGEIIGGSQREERLDVLEQRMEELGLNKENYWWYLDLRRFGTV-PHSGFGLGLERALQFVTGMGNIRDVIPFPRFPGNA... 458
119 0.000e+00UniRef50_A0A1N6QYM5 Asparagine--tRNA ligase n=12 Tax=cellular organisms TaxID=131567 RepID=A0A1N6QYM5_9SPIO  ali  23  188IAHLRGRTNTFGAVMRVRNRLSIAVHQFFQEREFLYLNTPIITAS----DAEGAGALFQVTTLDFFGKPAYLTVSGQLNAEAY-ATALDRVYTFGPTFRAEN--SNTTRHLAEFWMIEPEMAFCDLEGNMSLAEDFVRFLLKDILDRCPEDMAFESDFRRMTYTEAIDVLHEKFLTEDYAQGPVIVTDYPREIKAFYMKQNPDGKMDVLVPRLGEIIGGSQREEGLEPLEKAIRRCGLETESYQWYLDLRRFGTV-PHAGFGLGFERLVRYVTGMQNIRDVIPFPRAVGSA... 528
120 0.000e+00UniRef50_A0A135VR62 Aspartate--tRNA ligase n=2 Tax=Candidatus Thorarchaeota TaxID=1706441 RepID=A0A135VR62_9ARCH  ali  21  138.RVLDLRKPSINAIFKVQHNLVRFARAFLESNDFIEIHTPKL-------VAEATEGGANLFEVKYFDRKAYLAQSPQFYKQLMLLAGFGRVYEIAPVFRAE--KHNTRRHVNEYTSFDYEMAWISVEDVMKMEENMLHHSFKMTKKHAAAELEILGPFKRIKYSEAIELVNEEIFPKKYGTDMVYITHYPLELRPAYMTDEGMTESFDLTYKGMEITTGSQRIHLYDLLVERFKAKGFNPDDFAFYLDPFKYG-APPHGGLGLGVERMTMQLLGIENIREATLLPRDRDR.... 449
121 0.000e+00UniRef50_A0A2R6AKN4 Aspartate--tRNA(Asp/Asn) ligase n=3 Tax=Candidatus Marsarchaeota group 1 TaxID=2203770 RepID=A0A2R6AKN4_9ARCH  ali  23  117.RFLDLRRPETAAIFKIQSKVGRAVRDFFDEKGFYEIHT-------SKIVSQATEGGANVFPIIYFKKPAYLAQSPQFYKQMMIAAGFEKVWEIGPVFRAEP--HHTPRHICEYISIDLEMGYIDHQDVMNVIEELMTYVLQRISKEAAEELNILRPFPRVTMKEAYEILGKDLDAERFGHEFVFLTEFPWSVAQFYHMDPNYTNRADLIYKGMEICTLAQREHRYEILRSQIKEKGLNPEDFKFYLDFFRFG-VPPHGGGALGLERIVMQMLDLKNIREAVLLPRTPER.... 428
122 0.000e+00UniRef50_A0A2V5Z3Q6 Asparagine--tRNA ligase n=17 Tax=unclassified Verrucomicrobia (miscellaneous) TaxID=417295 RepID=A0A2V5Z3Q6_9BACT  ali  25  123IAHLRPRSNLFSSIFRARSRLAFAVHQFFQERGFVYVHTPIITGS----DCEGAGELFRDFAQDFFARPTYLTVSGQLEAE-AFALALSKVYTFGPTFRAEN--SNTSRHASEFWMIEPEIAFCDLNGNMDLAEEFVKYLIADAREHCPEEMELERPFQRITYTDAVDLLHERWLTEKHFKCPVTVFDFPKEIKPFYMRGKTVAAIDLLVPGIGEIVGGSQREERLEMLEANMQRHNMDPADYKWYLDLRRYGTV-PHSGFGLGFERMLMFITGISNIRDVIPFARTPGSA... 462
123 0.000e+00UniRef50_Q5JHC1 Asparagine--tRNA ligase n=45 Tax=Archaea TaxID=2157 RepID=SYN_THEKO  ali  24  117VRHLHLRSPKVAAIMKVKGTLMQAAREWLLQDGWYEVFPPILVT-------GAVEGGATLFKLKYFDRYAYLSQSAQLYLEAAI-FGLEKVWSLTPSFRAE--KSRTRRHLTEFWHLELEAAWMDLWDIMKVEEELVSYMVQRTLELRKKEIELVPPFPRISYDEAIDIWGEDRVLTEEFESPFFVYGYPKHIKAFYMKEDPEDPRKVLPEGYGEIIGGSQREDDYDKLVQRILEEGMKPEDYEWYLDLRKYGSV-PHSGFGLGLERLVAWVLKLDHVRWATLFPRTPSR.... 428
124 0.000e+00UniRef50_B8J4N8 Asparagine--tRNA ligase n=16 Tax=Bacteria TaxID=2 RepID=B8J4N8_DESDA  ali  25  120IAHLRPRTNKYGAVFRIRSEAGFAVHDFFRSRRFAWVHTPVLTGA----DCEGAGEMFRVTTLDFFSRQCNLTVSGQLEAE-ALATGLGRVYSFGPTFRAEN--SNTPRHAAEFWMIEPEMAFADLEDLMELGEGLTRHVVDHVLTRCESDVNLAAPFGRVSYTEAVEILHERYLAEEHFKKPVIVYDYPKDIKAFYMRQNEDAAMDMLVPRIGELIGGSQREERLPTLEARIREMGHNPEDYWWYLELRRFGTV-PHAGFGLGFERLLMLLTGITNIRDVIPFPRTPG..... 450
125 0.000e+00UniRef50_Q6KZQ3 Aspartate--tRNA(Asp) ligase n=15 Tax=Archaea TaxID=2157 RepID=SYD_PICTO  ali  23  117.RYIDLRKDENLIIFKAQSTLLWGIREYLNRLGFIEVHTP-------KIVAAATEGGADLFPVKYFERDAYLNQSPQLYKEILMAAGFEKVFEVGPAFRAE--KENTLRHLNEFTSIDIEMSFADHNDVMDVLENTVKNAINTLKNNLGDELNINGRIPRITYREAIDYLGDDFSPEERYKSFYFITEWPVSLRPFYTMDDETTKSFDLQLRELEICSGAQRIHRYDDLVNNIKNKGLNPESFTFYLSAFRYG-MPPHAGWAIGLERLTMNLLGIKNVRETTLFPRDRTR.... 420
126 0.000e+00UniRef50_Q81L32 Asparagine--tRNA ligase n=475 Tax=Bacteria TaxID=2 RepID=SYN_BACAN  ali  24  121IAHLRPRTNAFSATFRVRSIAAFAIHQFFQERGFVHVHTPIITGSDTEGAGEMGEDGQVDESKDFFGKETNLTVSGQLNAEAY-ALAFRDVYTFGPTFRAEN--SNTTRHAAEFWMVEPEIAFAELGDVMNLTEDMLKYAMKYVLEHAPEEMEFFNSFVRITYTEAIKEWGIDLQTEHEFKRPVFVTDYPKDIKAFYMRGKTVAATDLLVPGIGELIGGSQREERMDVLVDRIKELGMNEEDYWWYLELRKYGGTK-HAGFGLGFERFLMYITGMANIRDVIPFPRTPG..... 459
127 0.000e+00UniRef50_A0A0C1CB62 Asparagine--tRNA ligase n=4 Tax=cellular organisms TaxID=131567 RepID=A0A0C1CB62_9BACT  ali  23  127IAHLRPRTNTLGAVARIRNALSFATHLFFQKKGFLYIHTPIITSS----DCEGAGKMFRVSTLDFFEKPTYLTVSGQLEGEIY-ASALSDIYTFGPTFRAEN--SNTSRHLAEFWMIEPEMAFADINDDMDCAEEYLKYTVKYVLEHCEEDIDFNTPFERASYSYAVRIWGSDLQSEHYFSKPVIITDYPKEIKSFYMREKTVAAMDVLVPRIGEIIGGSQREDRLDYLKQRLIENNLKEEDYWWYLDLRKYGSV-PHAGFGLGFERLVQFVTGIENIRDAIPFPRFPG..... 465
128 0.000e+00UniRef50_B1ZXK4 Asparagine--tRNA ligase n=37 Tax=cellular organisms TaxID=131567 RepID=B1ZXK4_OPITP  ali  25  120IAHLRPRSNLFGAVFRTRSRLAFAIHRFFQERGFVYVHTPIITGS----DCEGAGELFRVTTHDFFARRTYLTVSGQLEAE-AFACALGKVYTFGPTFRAEN--SNTSRHANEFWMIEPEVAFCDLQGNMDLAEEFVKALIREVRTNCAEDLELERPFQRVSYTEAIELYGTNLQSEHEFKCPTTVYNYPKEIKPFYMRDKTVTAMDVLVPGIGEIVGGSQREERLDVLEANMRRHGVDPKDYGWYLDLRRYGTV-PHAGFGLGFERMLMFVTGVPNIRDVIPFARTPGNAA.. 461
129 0.000e+00UniRef50_A0A0G4ER15 Uncharacterized protein n=2 Tax=Alveolata TaxID=33630 RepID=A0A0G4ER15_VITBC  ali  24  437..HLRPRSNLIGAVARVRSALAMATHRFFQDRGFLYIHTPLIT----CCDCEGAGEMFQVTTVDFFGKPAFLTVSGQLAVENY-ACALSDVYTFGPTFRAEN--SNTSRHLAEFWMIEPEMAFADLQQDMDCAEAYVKYCVQWVLDNCMADLEFNSPFVRITYTEAFEIWGMDLGSEHEYKQPVTVYNYPKEIKAFYMRLNNDDRMDVLLPKIGEVIGGSQREERLDVLDRRIKDMGLPLESYWWYRDLRKYGSV-PHAGFGLGFERLIMLVTGVDNIRDVIPFPRYPGHAD.. 782
130 0.000e+00UniRef50_K2FP50 Asparagine--tRNA ligase n=50 Tax=cellular organisms TaxID=131567 RepID=K2FP50_9BACI  ali  24  118.RHLWLRSKKQHAVMKVRNEIIRATYEFFNDNGYVKIDPPILTGSS-------AEGTTELFHTKYFDEEAYLSQSGQLYLEAA-AMAFNKVFSFGPTFRAE--KSKTRRHLIEFWMIEPEMAFMDHEDSLEVQEEYVSYIAQSVLRNCKMELEVLEPFPRITYDDAIQLWGDDFGAPHEYEKPVFITHFPTEIKAFYMKPDPECADLIAPEGYGEIIGGSQRIDDLELMKQRYEEHNLTGDAYQWYLQLRQYGSV-PHSGFGLGLERTVAWIAGVEHVRETIPFPRLLNR.... 428
131 0.000e+00UniRef50_P52276 Asparagine--tRNA ligase n=4301 Tax=root TaxID=1 RepID=SYN_SYNY3  ali  23  123..HLRPRTNTIGAVMRVRNACATAIHQFFQERGFLWVHTPIITAS----DCEGAGDLFKVTTLDFFGKQAYLTVSGQLEAEV-MALAFQNVYTFGPTFRAEN--SNTSRHLAEFWMVEPEMAFCDLEGDRQWAEEFLKYIFKFVLEKCPEDMEFNNEFAWLTYSEAIKLWGVDLQSEHEFKRPTIVTDYPKDIKAFYMRGKTVAAMDILAPKIGEIIGGSQREERLDILTQRMQEQGVPEEDLWWYLDLRRYGSV-PHAGFGLGFERIVQFMTGMANIRDVIPFPRTP...... 457
132 0.000e+00UniRef50_A0A136NKX5 Asparagine--tRNA ligase n=6 Tax=Bacteria TaxID=2 RepID=A0A136NKX5_9BACT  ali  24  120IAHLRPRTNTFGAVFRIRHAMAYAIHHYFNKNGFYYIHTPIITGS----DAEGAGEMFRNFKEDFFGKETNLTVSGQLEGELA-ALALGKIYTFGPTFRAEN--SNTPRHLAEFWMIEPEMAFYEAKENMDLAEDMLKFLINYALENCYDDIEFLKPFTRLTYTEAIEEWGSDLQKEHHFKGPVILTDYPKQIKAFYMKQNDDGKMDVLFPWIGEIIGGSQREENFEKLSSRMKEMHIPEKEMWWYLDTRKFGTC-PHSGFGLGFERLILFVTGMNNIRDVIPFPRTPKNA... 459
133 0.000e+00UniRef50_Q52428 Aspartate--tRNA(Asp) ligase n=467 Tax=root TaxID=1 RepID=SYD_THEKO  ali  23  124.RFMDLRRPEVMAIFKIRSSVFKAVRDFFHENGFIEIHTP-------KIIATATEGGTELFPMKYFEEDAFLAQSPQLYKQIMMASGLDRVYEIAPIFRAE--EHNTTRHLNEAWSIDSEMAFIDEEEVMSFLERLVAHAINYVREHNAKELEPKLPFPRVSYDKALEIWGEDKYMMENENAPYFLYQYPPFYIMKYDNKPEICRAFDLEYRGVEISSGGQREHRHDILVEQIKEKGLNPESFEFYLKAFRYG-MPPHGGFGLGAERLIKQMLDLPNIREVILFPRDRRR.... 435
134 0.000e+00UniRef50_D9TTC6 Asparagine--tRNA ligase n=26 Tax=Bacteria TaxID=2 RepID=D9TTC6_THETC  ali  20  121.RHLWIRTPKQHAILSIRHEVIKAIQEFLNNNGFVRIDSPIITPST-------CEGTSDLFQIDYFGENAYLSQTGQLYQEAA-AMALGKVYSFGPTFRAE--KSKTRRHLNEFWMVEPEMSFVDHYENMEIQEKLVEYIVQSVLENRSKELKIKTPFPRLTYDEAIEILKKNGYEIEWGNKPVFITEYPAKCKAFYMQPKEDRPEVVMPEGYGEIIGGSQRIHDYDLLIKRLKEENLPLEMYDWYIDLRKYGSV-PHSGFGLGIERTVAWITNTEHVRECIPFPRTLSRI... 431
135 2.000e-98UniRef50_A0A0D2VG36 Asparaginyl-tRNA synthetase n=2 Tax=Capsaspora owczarzaki (strain ATCC 30864) TaxID=595528 RepID=A0A0D2VG36_CAPO3  ali  20  213IAHLRARTNSGGAILRVRNALTMAIHRHFQDKDFLNVNTPIITSS----DCEGAGSLFRAPHESFFGHPAYLTCSGQLHAE-AVASGMSRVYVLGPTFRAEN--SHTKRHMAEFYMLEAEQFFIDQDELLDLTSDCVKDLTATIVSKCSDDLAIEQPFARLTYTEAVEILHERFLCEQYCKRPVFITDYPAAIKPFYMRRNMDNKMDLLVPGIGELVGGSLREERASVLMQIMRSHQMLP-QMQWYLDLRRYGTA-PHGGFGMGFERLMMYLTGTENVRDTIPFPRTAGQC... 556
136 2.000e-98UniRef50_D7LUN9 Predicted protein n=22 Tax=Magnoliophyta TaxID=3398 RepID=D7LUN9_ARALL  ali  18  232.RVIDLRTPANQAIVALKSQLVNFFSENLLSKDFVNIFTPKLL-------AGSSEGGSAVFRLEYQGQPACLAQSPQLHKQMAICGDLRRVFEIGPVFRAE--KSFSHRHLCEFVGLDVEMEIKHYSEIMDLVDELFVAIFTSLNSKCKKELEFLEKTLRLTFEEGVQMLKEEKYNTEFYILHRFPTAVRPFYTMTCVDNPLYSNSFDVFIRGEEIISGAQRIHTPELLEQRAREHGIDVKTISTYIDSFRYG-APPHGGFGAGLERVVMLFCGLNNIRKTSLFPRDPQRLAP. 550
137 2.000e-98UniRef50_A0A0M0JEH5 Asparaginyl-tRNA synthetase n=1 Tax=Chrysochromulina sp. CCMP291 TaxID=1460289 RepID=A0A0M0JEH5_9EUKA  ali  24  314..HMRPRTGVMGAVMRIRNSLAYATHNFFQQSGFMYVHAPLITGA----DCEGAGEMFQVTTLDFFGKPAFLTVSGQLNGEYY-ACAFGSIYTFGPTFRAEN--SNTTRHLAEFWMIEPEIAFCDLPKNMDCAESYLRHCFRHVLENNADDLAFLEEFERLPYTEAIEIWGQELQTEHEYKKPVIVYNYPKGCKAFYMRMNEGCAMDVLFPRVGEMVGGSQREERLDILLAKMAEMGLKEEDYSGYLDTRRFGS-QPHAGFGVGFERLVLYATGMGNIRDAIPFPRTVG..... 671
138 2.000e-98UniRef50_UPI0004F4EA8C probable asparagine--tRNA ligase, mitochondrial n=3 Tax=Amniota TaxID=32524 RepID=UPI0004F4EA8C  ali  22  129.PHLRCRNNTLGSLLRIRSEATAAIHSFFQDNGYVHIHTPIITS----NDCEGAGELFQIEKTHFFNVPAFLTVSGQLHLEV-MAGAFTHVFTFGPTFRAENSQS--RRHLAEFYMVEAELSFTSLQDVMQVMEDLFKTATNTVLSKCPRDVELKNKFVTISYNEAVEIWGCDLQTEHEGETPVFVINYPYNLKPFYMRDNEDGPQDLLVPGIGELYGGSLREERLPFLESRLQRLGLT-DAYQWYLDLRKFGSV-PHGGFGMGFERYLQCILGVDNIRDVIPFPRFSHSCLL. 465
139 2.000e-98UniRef50_A0A1Z7M6F3 Asparagine--tRNA ligase n=2 Tax=Firmicutes TaxID=1239 RepID=A0A1Z7M6F3_9FIRM  ali  23  118IPHLRVRTRYFEALFAVRDQLSYAVHDYFHKNGYKYVHTPIITGS----DCEGAGEMFSYFKDDFFGTKAGLTVSAQLEGEMA-AMGLGRIYTFGPTFRAE--HSNTTRHAAEFWQVEPEVCFADIDDIIEIGEDFIKSIIRDVMEHCPDEIQFESDFGRMTYTEAVEIWGCDLQTEHYLKKPVFVVDYPADIKAFYMKQNPDAATDLLVPGIGEIIGCSEREADMGKLVAAMEKRGMPLEEYQAYLDTRKYGSV-PHSGFGLGFDRMLMYVTGVSNIRDTLLFPRTVG..... 460
140 2.000e-98UniRef50_H3HDW5 Uncharacterized protein n=23 Tax=Oomycetes TaxID=4762 RepID=H3HDW5_PHYRM  ali  23  151..HLRARTNTFGAVTRVRNALSQGLHSYFQENDFLHLHSPILTS----NDCEGAGEMFRIAKIEFFGTPTYLTVSGQLHGEMY-ACALSKIYTFGPTFRAEN--SNTTRHLAEFWMVEPEMAFAGLEECVASAQGAVQRSVSHALDTCAEDIAFEKNFARLTYTEAIDEWGMDLQTEHYVGGPVFVTDYPADIKAFYMRKNTVAGMDLLVPKIGELVGGSVREERFEVLEEKMRQLGLLPEDLDWYLDLRRFGSV-PHAGWGLGFERLVLFATGMDNIRDVIPLPRFPGQC... 500
141 2.000e-98UniRef50_L7W7M0 Asparagine--tRNA ligase n=89 Tax=Bacteria TaxID=2 RepID=L7W7M0_NONDD  ali  23  120..HLRVRTNTFGAVMRVRAALSYAVHKYFNENGFYQAHTPIITGS----DAEGAGEMFRISTLDFFEKESNLTVSGQLEAETY-AMGLGQVYTFGPTFRAEN--SNTSRHLAEFWMIEPEVAFNDLDANMDLAEDFIKYVVQYALDNCADDIEFLEKFKRVSYTEAIDILHERYLVEKHFECPVILFDYPAKIKAFYMRLNDKDAMDILFPGIGEIAGGSQREERYDVLKQKMDTMGIPEEELWWYLEMRKFGSAV-HSGFGLGFERLVMFVTGMGNVRDVIPYPRTPGNAA.. 481
142 2.000e-98UniRef50_A0A087S9W2 Aspartate-tRNA ligase, cytoplasmic n=1 Tax=Auxenochlorella protothecoides TaxID=3075 RepID=A0A087S9W2_AUXPR  ali  19  193.RIIDLRTPANHSIFRVQSAVTQLFREFLLKEDFVEIHTPKLL-------GGASEGGASVFKLDYMGQPACLAQSPQFYKQMAICSDLPRVFEVGPVFRAEN--SYTHRHLCEFTGLDMEMTIESYHEVLDVVDRLFHTMFE------------VDPFGDLN-TELERVLGKEKYNTDFYILHRYPSAIRPFYTMPCKDDERYSCSYDIFIRGEEIISGAQRIHDPSLLERRAKECGIPVETIQAYVDSFKYG-AWPHGGIGVGMERVVMLFCGLDNVRKTSMFPRDPKRLAP. 465
143 2.000e-98UniRef50_K7G0C3 Asparaginyl-tRNA synthetase n=37 Tax=Opisthokonta TaxID=33154 RepID=K7G0C3_PELSI  ali  19  237.RYMMIRGENMSKIFKVRSVVIQCFRDHFFDNGYYEITPPTL-------VQTQVEGGSTLFKLDYFGEEAFLTQSSQLYLETCIP-ALGDTFCIAQSYRAE--QSRTRRHLAEYTHIEAECPFMTFEDLLTRLEDLVCDVVDRVLKSNPNFQLPKRPFKRMNYTDAITWLREERLMTDTINEPILLCRFPAEIKSFYMQRCPEDSRDVLMPNVGEIVGGSMRIWDSDELLAGYKREGIDPTPYYWYTDQRKYGTC-PHGGYGLGLERFLTWILNRHHIRDVCLYPRFVQRCKP. 552
144 3.000e-98UniRef50_A0A0V0TPV2 Aspartate--tRNA ligase, cytoplasmic n=26 Tax=Eukaryota TaxID=2759 RepID=A0A0V0TPV2_9BILA  ali  19  223.RVLDLRTVTSQAIFRLQAVVCDQFRKYLMSNGFVEIHTPKIISA-------ASEGGANVFEVSYFKRSAYLAQSPQLYKQMAIAGDFGRVFTIGSVFRAED--SNTHRHLTEFIGLDLEMAFFHYHEVVQLIGQMFIEMFKGLEEICSSEIAPAEPFEILEYSQAIAILREEKYQTDFYILDKFPLCIRPFYTMPNPREKEYSNSYDMYMRGEEILSGAQRIHNPDLLIERAKHHNIDLEKIEAYIDSFRYG-CPPHAGGGIGLERVTMLYLGLSNVRLASMFPRDPRR.... 538
145 3.000e-98UniRef50_A0A0H5R442 Uncharacterized protein (Fragment) n=4 Tax=Eukaryota TaxID=2759 RepID=A0A0H5R442_9EUKA  ali  21  202.RYLDMRSSRFGSILKIRSMVTQCLREHFFSKDFFEVTPPTL-------VQTEVEGGSDLFTVDYFGEPAYLTQSSQLYLETAIPS-LGSVFCILPSYRAE--QSRTRRHLSEFTHVEGEMAFYNFEQMLCFLEDMVVSVSENIIAKNPSFTAPSRPFLRMSYADAIVWLNEERHMTDTINRPILLHGFPVEQKPFYMPPAEDDSRDLLMPGVGEIVGGSMRVWDLELLMKNYEAKGLDPKPYFWYNDLRKYGSC-PHGGFGLGLERFLCWVMGLHHIREAVMYPRFIGRCAP. 517
146 4.000e-98UniRef50_A0A2G2XEX5 Asparagine--tRNA ligase n=1 Tax=Capsicum baccatum TaxID=33114 RepID=A0A2G2XEX5_CAPBA  ali  21  180..HFRSRTNTISAIARIRSALAYATHTFFQNHGFLYIHTPIITTS----DCEGAGEMFQVTSLQLAKEKVFLTVSGQLQGETY-ACALSKVYTFGPTFRAE--KSHTSRHLAEFWMVEPEIAFVDIQENMNYAEAYVKFLCQWLLYRCLDDVEFITNFQRITYTDTIKILEENKLTEEHFKAPVIVYNYPKGIKAFYMDKKTVAAMDLLVPKVGELIGGSQREEDYEVLRSRMLDLGLPLEPYEWYLDLRRHGTVK-HCGFGLGFERMILFATGIENIWDVIPFPRYPDRADL. 517
147 4.000e-98UniRef50_A0A0V1NR06 Aspartate--tRNA ligase, cytoplasmic n=12 Tax=Metazoa TaxID=33208 RepID=A0A0V1NR06_9BILA  ali  20  223.RVLDLRTVTNQAIFRLQAVICDQFRKYLMSNDFVEIHTPKIISA-------ASEGGANVFEVSYFKRSAYLAQSPQLYKQMAIAGDFGRVFTIGSVFRAED--SNTHRHLTEFIGLDLEMAFFHYHEVVQLIGQMFIEMFKELEKICSSEIAPAEPFEILEYSQAIAILREDLSTPQEKLLDKFPLCIRPFYTMPNPREKEYSNSYDMYMRGEEILSGAQRIHNPDLLIERAKHHNIDLEKIEAYIDSFRYG-CPPHAGGGIGLERVTMLYLGLSNVRLASMFPRDPRR.... 523
148 5.000e-98UniRef50_K0BD92 Aspartate--tRNA ligase n=8 Tax=Thaumarchaeota TaxID=651137 RepID=K0BD92_9ARCH  ali  22  121.RALDMRNQKTASIFKLRHHVLQSLRKTLAEKKFIEITTP-------KIIGSASEGGADLFSLDYFGKTAYLAQSPQLYKEQ-MTIGLERVFEISNFYRAEN--SHTGRHLTEFTSIDIEAAFMDYEDVMNVLESLVLAVYKDVSEKCKKEQEPSSPFERITYTQCIEELKKEGEKVEFGDDFYFLTDWPMKLKPFYIRDATLSRSFDLQYGFLELSSGGTRLHNPEMLKDRLKEQGLDPTQFADHLKTFDWG-MPPHSGWGMGLDRLMTTLIGIDNVREVVLYPRDPDRLSP. 428
149 5.000e-98UniRef50_A0A2V9BPY0 Uncharacterized protein n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V9BPY0_9BACT  ali  25  131.RHLWIRTPRQAAILRIRAEAIRAAREFMDSQGYTLTDAPMFT-------PAACEGTSTLFEVNYIDQKAYLTQSGQLYGE-ALAMALGKIYTFGPTFRAE--KSKTRRHLTEFWMLEPEAAYVELDEVMALGEGLVCAIVQGVLKNKPRELEVKPPFPRISYEEAVAKFGDDFGGDEEFDRPVLVHRYPTSLKAFYMQPDPQRPELALPEGYGEIIGGSQRIHDYDLLVKRLHEHNLPEEAFQWYLDLRRYGSV-PHSGFGLGLERTIAWICGTEHIRE.............. 431
150 5.000e-98UniRef50_A8BPC2 Aspartyl-tRNA synthetase n=8 Tax=Hexamitidae TaxID=5739 RepID=A8BPC2_GIAIC  ali  19  234.RVIDLRTPTNQAIMRVRSAIAHEFRSFLDKAGFIEINTPKIVAGT-------SEGGAAVFNVNYFNTKACLAQSPQLYKQMCISSGFGRVYEVGPVFRAE--HSHTHRHLCEFIGLDLEMEYESYTEILVLLGDLMKHIFKAVEARCSKEMSIVRETVIVTFCDGIKMLQEEKYNTDFYILDKFPLNARPFYTMPDPHDGRYSNSYDMFIRGEEICSGAQRVHDPELLEKQCRERNVDPESLRSYIDAFRYG-CAPHGGAGLGLERIVMLMLGIENCRQTCLFPRTQER.... 552
151 6.000e-98UniRef50_A0A2P6VT44 Asparagine--tRNA ligase n=1 Tax=Thermoplasmatales archaeon SW_10_69_26 TaxID=1919232 RepID=A0A2P6VT44_9EURY  ali  22  122.RHLWLRSQELTDVAKVRHTAMDAVREWFTEEDFWQVWPSILTK-------NAAEGGANVFELEYFEEPAYLTQSSQMYLE-AMIYSLERVWCLAPSFRAE--KSRTPRHLTEYWHLEAEQAWCDNEENIEIQEQLVAHACNAVAERAGEQVEVAPPFDRVTYDETVELWGEDFGAPDEFDGFVFVTHFPAKMKAFYMAQDEDEVYLLGPEGYGELIGGSERSTDLDLVERRLEAEGEDVEDYEWFLDLREYGSV-PHSGFGLGVERFVAYLCNLDHVRDAVPFPRTPNRIQP. 433
152 6.000e-98UniRef50_A0A1G9T0I7 Aspartate--tRNA(Asp/Asn) ligase n=2 Tax=Halobacteria TaxID=183963 RepID=A0A1G9T0I7_9EURY  ali  24  121.RTLDLRKPDVKAVFEIRAEVLRAVREQFRDEGCTEINTP-------KIVATGTEGGTELFPISYFGEEAFMNQSPQLFKQLMAGSGLEKVFEIGPIFRAE--EHNTPRHLNEATSIDFEGAFHDHTEAMDVVEGIVKAAYEAVAQNCQAELEPSGEFPRLTYEEALDRYGDDLSTEEEVGEHYFIVDWPSEIKPFYIDDAETSTGFDLMHPRMELVSGGQREHRYDHLVEGFEQQGLDPDEFEYYTKMFKYG-MPPHAGWGLGGERLVMTMLGLDNIREAVLFPRDRQRLSP. 434
153 6.000e-98UniRef50_A0A2H5TV13 Asparagine--tRNA ligase slm5 n=1 Tax=Rhizophagus irregularis (strain DAOM 181602 / DAOM 197198 / MUCL 43194) TaxID=747089 RepID=A  ali  20  90..HLRFRSNIFSSMLRIRNSTMLGLQRFFQRNEFIQIHTPIITTS----DCEGGGEVFKTSKQEFFGKPVYLTVSGQLHAES-ISSYIPRVYSIGPIFRAEN--SFTSKHLSEFWMLESEISFITLNDLYNFVENSIKYIIQFLLDNSYQDIDLKNPFITMSYNDAIDILHEKFLSTTYCNSPLFVINYPKEIKPFYMRNKTVACTDLLFPKIGELVGGSLREERYSILENNIITKGLSLEDYKWYLDLRKFGSV-PHGGFGMGIERFLLYITGLENIKDVIPFPRSAENC... 414
154 7.000e-98UniRef50_A0A075G0F6 Aspartate--tRNA(Asp/Asn) ligase n=88 Tax=cellular organisms TaxID=131567 RepID=A0A075G0F6_9EURY  ali  24  165.RHLDLRRAHVNAMFQLRGNVLQYGRDHLISEGFQEINTP-------KIIAAAAEGGTNLFPMKYFETDAYLSQSPQLYKQLAVLGGLERVFEIGPAFRAE--KHDTYRHLNEFISFDIEGAWMDDEDVMGVQERMLHHIWSEVVANDQGLIDVVNPFPRIPYCDAIEIWGNDIESHHCDIGFHFIPRWPMSMKPFYIHHKKESRGFDLNYGRDEMTSGGQREHRVDVLEENLRNMGLEPADFTFYTDGFRYG-APPHAGWGLGVARLLMVLTGAGNVREVVLFPRDRSRV... 486
155 7.000e-98UniRef50_D7FT77 Aspartyl-tRNA Synthetase n=2 Tax=Stramenopiles TaxID=33634 RepID=D7FT77_ECTSI  ali  21  295.RWIDLRTPANQAIFKIQSAVCQYFRANLASKGFVEIHSPKLL-------AGASEGGSEVFTTNYFGTEACLAQSPQLYKQMAAAGGFGRVMEVGPVFRAE--KSRTHRHLCEFTGLDFEMVIEHYFEVLEVFSDLFINIFDEVNRNCKEELEAVRPFERLTFQEGIKKLGDEKYGTDFFMMDKYPLDVRPFYTMPCPSNPKHSNSFDIFIRGEEIVSGAQRIHDLEFLKERAREHDIPLDSIMSYLDAFKHG-AEPHGGGGIGLERVVMLFLGLKNIRKTSMFPRDPKRCAP. 614
156 9.000e-98UniRef50_A0A1X7VMP2 Uncharacterized protein n=1 Tax=Amphimedon queenslandica TaxID=400682 RepID=A0A1X7VMP2_AMPQE  ali  23  138.PHLRARTKKFSSVLRIRNAASIAVHEYFQRKNFLQVHTPLLSSS----DCEGAGDLFIVKPEDFFGVPVYLTVSGQLHAETL-ACGLSNVYTFGPTFRAE--KSHTSRHLSEFYMIEAELPGESLDIIMQCSEDLCKSIIEKVLTEKEEDLSFKKEFKRLTYKEAVELLHEKYIVQEFGNTPVFITEFPASIKPFYTRNDTDTNMDLLMPNIGEVVGGSVREERFDILENTLKNLGMD-EKYQWYLDLRRFGTV-PHGGFGLGFERLLQVIVGAEHIRDVIPYPRFVGYCPM. 474
157 9.000e-98UniRef50_A0A1F4CB87 Asparagine--tRNA ligase n=14 Tax=Bacteria TaxID=2 RepID=A0A1F4CB87_9PROT  ali  25  124VAHLRPRTNVIGATTRVRHSVAQAIHRFFHENGFAWINTPIITSA----DAEGAGELFRVSTLDFFGRETFLTVSGQLNVESY-CLALSKVYTFGPTFRAEN--SNTSRHLAEFWMVEPEIAFADLADNATLAEALLKYVLAAVLTERGDDMAFDKAFVRMDYTEAISILGERYLAEQHVGGPLVLMNYPKEIKAFYMRLNDDGRMDVLAPGIGEIVGGSQREERLAVLDARIDEAKLDKNHYGWYRDLRRYGSV-PHAGFGLGFERTVSYITGLANVRDVIPFPRTPGNA... 464
158 9.000e-98UniRef50_A0A1E1LBL5 Related to aspartate-tRNA ligase, cytosolic n=10 Tax=Leotiomycetes TaxID=147548 RepID=A0A1E1LBL5_9HELO  ali  21  350.RIVDLRTGPSQAIFRIQSGICNLFRTYLDDQGFIEIHTPKLQ-------GGATESGASVFELNYFGRPAFLAQSPQLAKQMAIASDFERVYEVGPVFRAED--SNTPRHLTEYTGLDLEMALEHYHEALDIIDGMFKNLWKGIYTRYQKEIDLISEFPRIKFADGVKLLIEEKYNTDYYILDKFPASARPFYTMPDPSDNRYTNSFDIFMRGQEILSGGQRIHDAKFLEKNLKAKGIHPDTMTEYLEGFRWG-APPHAGCGIGLERLTYLFLNLGNIRLASMFPRDPK..... 670
159 9.000e-98UniRef50_A0A2W4IIP7 Aspartate--tRNA(Asn) ligase n=1 Tax=Candidatus Melainabacteria bacterium TaxID=2052166 RepID=A0A2W4IIP7_9BACT  ali  20  121.RPLTLRSPKVRSIFKIEAVFCEAFREFLRDRQFTEIHSP-------KIVATGTEGGAQLFKLNYFGREAFLAQSPQFYKQI-MVGALERVFEIAPVYRAE--EHDTTRHLNEYISMDVEMGFINEHDLMDLLNKLVKHMFEKVSQSCADELALIGTIPRVTLAEAVDIIGEKIICEHFYKDLVFITGYPLSVRPFYAMPEMSSRSFDLLFRGLEITTGGQRIHRHEELVSAMQARGLDPEAFKDYLQCFQYG-MPPHGGFAIGLERIAKQLLGLPSVKLAALFPRDINR.... 432
160 9.000e-98UniRef50_A0A2H9LVS4 Aspartate--tRNA(Asp/Asn) ligase n=21 Tax=cellular organisms TaxID=131567 RepID=A0A2H9LVS4_9ARCH  ali  22  134.RWLDLRKPKNLLIFKIWTYMEEAMREWWAKNNFIQIYSPKFM-------GAPSESGAELFSVNYFGKVAYLAQSPQFYKQMAMASGFEKIFEIGPVFRANP--SHTTRHDTEFTMIDMEISFVNHEDVMRTEEEWIAFILSKISEKYGKEIKPKLPFPRITMKEALKLLGEKKICEKFNHDFIFITEYPPFYHMKKETDPGLTKSYDLIWKGLEITTGAQREHRYELLKKQAAEKKLNLKIINDYLNFFKYG-CPPHGGFGLSPTRLLMILLNLGNVREATFLPRDTERLNP. 448
161 1.000e-97UniRef50_A0A2K9L424 Aspartyl-tRNA synthetase n=2 Tax=Tupanvirus TaxID=2094720 RepID=A0A2K9L424_9VIRU  ali  21  194.RVLDLRRADNRFIFKIQAEVTKIIRNFFDENNFIEIHSPKLI-------GAASEGGSNVFEVKYFGQNAYLAQSPQLYKQMAICADFPRVYEIGPVFRAE--KSFTHRHLTEFTGIDLEMTFVDYHEILDLFDVLFVNLFGKLRIKYGPAIEFVTPSVRITFKEAVTLLGIDKYHTDFFMVDQFPTEIRPFYTMPNKTNPLYSNSYDFFVRGEEILSGAQRINNYEMLLDSALNHGIDISKITDYLESFKYG-APLHGGGGIGLERIVMLYLGINNIRNVSLFPRDPMRI... 510
162 1.000e-97UniRef50_A0A162R6E7 Aspartate--tRNA(Asp/Asn) ligase n=59 Tax=root TaxID=1 RepID=A0A162R6E7_9CLOT  ali  21  120.RYISLRNPKTRAAFKVQQEIVTAFRDYLLANNFSEIHTPKILGAST-------EGGSEVFTVNYFDKRAFLAQSPQFYKQMMVGAGFERVFEIAPAYRAE--LHNTYRHLNEYISLDLEMGFIDDNDIMDIEEGFMRHLFQHLRKTCSKELEMKVEIPRITLAEALEEYGSKYIKEKYDSDFVFLTAYPVAKRPMYAMPDENGMTFDLIYKGLEITTGGQRIHDYEMFKENIRKFGFNPDDYGFYVESFRYG-MPPHGGLAIGLERMTMKILNLDNIREATLLPRDMKRLEP. 431
163 1.000e-97UniRef50_Q96I59 Probable asparagine--tRNA ligase, mitochondrial n=91 Tax=Bilateria TaxID=33213 RepID=SYNM_HUMAN  ali  22  143.PHFRCRTNVLGSILRIRSEATAAIHSFFKDSGFVHIHTPIITS----NDSEGAGELFQLEPENFFNVPAFLTVSGQLHLEV-MSGAFTQVFTFGPTFRAENSQS--RRHLAEFYMIEAEISFVDLQDLMQVIEELFKATTMMVLSKCPEDVELKNNFLIISYTEAVEILHEKYLVKHCGNIPVFVINYPLTLKPFYMRDNEDGPQDLLVPGVGELFGGGLREERYHFLEERLARSGLT-EVYQWYLDLRRFGSV-PHGGFGMGFERYLQCILGVDNIKDVIPFPRFPHSCLL. 477
164 2.000e-97UniRef50_A0A1D6BX18 Uncharacterized protein n=1 Tax=Triticum aestivum TaxID=4565 RepID=A0A1D6BX18_WHEAT  ali  24  465..HLRPRNDTIAAVARMRSELTFATHSFFREMGFVCVHTPIITT----DDCEGAGDMFQVFESDFFRRQAFLTVSGQLQAEAY-ACALSGVYTFGPTFRAEN--SHTSRHLAEFWMVEPEIAFADLQDIMNYAESYVQYLCKWLLEHCMEDMEFSTPFERVSYTKAVEIWGIDLASEHEFKKPVIVYNYPRGIKAFYMRQKTVAAMDVLVPKVGELIGGSQREERFGILKQRILEAGLPMASYEFYLDLRRYGSVK-HSGFGLGLERMLLFATGLDNIRDVIPFPRYPGKADL. 824
165 2.000e-97UniRef50_Q6KZ55 Asparaginyl-tRNA synthetase n=16 Tax=Euryarchaeota TaxID=28890 RepID=Q6KZ55_PICTO  ali  23  115.RHLWLRSREFTSILKIRSTVFKAFADFFYNNGYYQVQGPMMVS-------TATEGGATLFKLKFFDDDVYLTQSSQFYLET-MIFSLEKVFTIAPSFRAE--KSRTRRHLSEYWHAEGEAAWLHNDDMMNVEEKMIEYIVSEVLNKNEKDLKIKAPFPRIKYRDLINKYGDDLGADEHYEKPLFVTNYPEELKTFYHLPDPENPGEILPEGYGEIIGGGERIWRLDELLERMKKAGLPEEDYYWYIDLRRYGSV-PHSGFGLGLDRLVNWICNLNNIRDAIPYPRTVRRIKP. 427
166 2.000e-97UniRef50_A0A1F9Z922 Asparagine--tRNA ligase n=2 Tax=unclassified Euryarchaeota (miscellaneous) TaxID=115531 RepID=A0A1F9Z922_9EURY  ali  27  116VRHLWVRSQRMTTIFRIRHTVFDAVHEYFRDRGFWEVHPPMLT-------PAGSEGGSTLFEVEYFGRKAYLAQSWQLYAE-ALVLAMKKVYYIGPSFRAE--KSRTTRHLTEFWHAEMEEAWAGMDDVLRHAEGVISHVCRRVAEERPDEVAVTPPFERFTYDEALKLWGKDLRTLEERSKPVIVTHYPRISQAFYKARDPQKPDVVLGFDVGEVVGGSERETDLETIQQSLRDQGQDPASYDWYLDSRRFGSV-QHAGFGMGMERLIQWICKLEHIRDAVPFPRTPARYSP. 429
167 2.000e-97UniRef50_A0A2G8RR30 Uncharacterized protein n=1 Tax=Ganoderma sinense ZZ0214-1 TaxID=1077348 RepID=A0A2G8RR30_9APHY  ali  21  16..HLRARTREIGAMLRLRDSTTRAIHDYFKDNGFVHVHTPILTS----NDCEGAGETFRITPSEYFNHPAYLTVSSQLHLE-AVATAISRVYTLSPCFRAE--RSQTSRHLSEFWMLEAEWAFTSLDELCTIVEDALRHVLRTLWKSHPSQVDEPQPWARLTYTEAIDILHERWLADEFVRGPLFVTDYPAAMKPFYMRMNEGCCFDLLVPGIGELVGGSVREERAALLEDVIERHGLDKADYGWYMELRKYGGA-PHGGFGMGFERLISWISGIESVRECIAMPRWAGR.... 367
168 3.000e-97UniRef50_Q492P3 Asparagine--tRNA ligase n=328 Tax=cellular organisms TaxID=131567 RepID=SYN_BLOPB  ali  22  126..HLRPRTNTIGAVARIRDTLSQAIHNFLHKQGFIWIPTPIITAC----DTEGSSKMFCDTTYDFFSKKAFLTVSGQLNAEAY-ACALSKVYTFGPTFRAE--YSNTNRHLAEFWMIEPEAAFMTLDDIIILAESLLKNIIRILLEKRSDDIKYLIKFNHIEYTEAIKLWGTDLFSEHYFKSPVIIKNFPKNIKAFYMRNKTVASMDILVPGIGEIIGGSQREERLSKLDQRLQENCLTQENYWWYRDLRRYGTV-PHSGFGLGFERLMIYVTGIKNIRDVIPFPRTSKNI... 468
169 3.000e-97UniRef50_UPI000D77B50E aspartyl-tRNA synthetase n=1 Tax=Meira miltonrushii TaxID=1280837 RepID=UPI000D77B50E  ali  21  262.RVLDLRSPPSQAIFRVQAAVCQAFRQFLNEQGFIEIHTPKLL-------GGASESGASVFKVDYFGRRACLAQSPQLFKQMCICADFGRVFEIGPVFRAEN--SNTHRHLTEYTGLDLEMSGDDYHEAMYMIDGLLKSIFAKLQKSHKLEIEIARKTPILEYREGIQMLLKEKYKTDFYILDKFPRSVRPFYTHPDEKNIVASNSFDIFVRGQEIISGGQRIHLADELENNLNKQHIDTHGLEDYLDSFRL-AAPPHAGCGIGLERFVMLFLGLNDIRNASLFPRDPK..... 583
170 3.000e-97UniRef50_Q9M084 Aspartate--tRNA ligase 2, cytoplasmic n=144 Tax=Eukaryota TaxID=2759 RepID=SYDC2_ARATH  ali  18  240.RVLDLRTPANQAIFQLQYEVEYAFREKLRFKNFVGIHTPKLM-------AGSSEGGSAVFRLEYKGQPACLAQSPQLHKQMAICGDLRRVFEVGPVFRAED--SFTHRHLCEFVGLDVEMEIKHYSEIMDLVDELFVFIFTSLNERCKKELKFLPKTLRLTFEEGVQMLKEEKYNTEFYILHRYPKAVRPFYTMTCADNPLYSNSFDVFIRGEEIISGAQRVHIPEVLEQRAGECGIDVKTISTYIDSFRYG-APLHGGFGVGLERVVMLFCALNNIRKTSLFPRDPQRLSP. 558
171 3.000e-97UniRef50_A0A261Y2T4 Uncharacterized protein n=1 Tax=Bifiguratus adelaidae TaxID=1938954 RepID=A0A261Y2T4_9FUNG  ali  20  706.RVLDLRSTTNNAIFKIQSAVCHLFREYLMRQNFMEIHTP-------KIIGAASEGGANVFTVDYFKGKAYLAQSPQLYKQMCIAADFERVFEIAPVFRAED--SNTHRHMTEFVGLDMEMSFEHYHEVLEILEDMFVSIFRGLKANFSKEIERQYPFERLNFSEGIEMLREDKYHTDFFVLDKFPMAVRPFYTMPDAKNPKLSNSYDFFMRGQEILSGAQRIHDPELLTERTKVHGIDIATIQPYVDAFKLG-APPHAGGGIGLERVVFLYLDLHNIRRTSLFPRDPKR.... 1030
172 4.000e-97UniRef50_A0A1W9RV59 Aspartate--tRNA(Asp/Asn) ligase n=2 Tax=unclassified Candidatus Omnitrophica TaxID=1047005 RepID=A0A1W9RV59_9BACT  ali  19  128.RYLDLRRKPLLDKFILRSHFNYKFREYLHKCGFLEIETPYLT----KSTPEGARDFLVPSRLN-QGKFYALPQSPQLFKQILMVAGVDKYYQIVRCFRDEDLRKD---RQPEFTQLDIELSFIEEEDIYNLVEDMLKFVFKEVLG-----IELKTPFLRIKYEEAMKNYSTDKPDIGKGFRFLWVYEFPLFEYNQQEQRWQALHHYDLVLNGVEVASGSIRIHDPQLQKKIFSLIKVDEEKFGFLLRALSYG-APPHGGIAFGLDRLYAIITKSESIREVIGFPKTQKGVCML 435
173 4.000e-97UniRef50_A0A1F6R563 Aspartate--tRNA ligase n=3 Tax=root TaxID=1 RepID=A0A1F6R563_9ARCH  ali  19  126.RWLDLRKPRNALIFKIQTAMEMAMREYWVNNGFIEIHSPKLMGF-------ASESGAELFSVSYFDKEAFLAQSPQFYKQMAMASGFERVFEIGPVFRA--NQSHTTRHDTEFTSIDVEMSFIDHEDIMKFEERWLVYVIEKLKDRYGKEIKPKLPFPRLSLEEVHNMYEEDLTPEEYNHEFVFVKEFPWKIKPFYHMNPKVTKGFDLLWNGLEVTTGAQREHRYDVLLNQAKEKGLNLGSVNFFLNFFKYG-CPPHGGFGFGLTRALICMLNLSNVREVTFVFRDIDRLIP. 441
174 4.000e-97UniRef50_Q8F522 Asparagine--tRNA ligase n=139 Tax=Bacteria TaxID=2 RepID=SYN_LEPIN  ali  24  121.RHLWLRSSKQLAILRVRDSLSFAIRKYFHERDFLLIDTPILTGS----VGESAG---TLFSTEYFDGNAYLAQTGQLYLETAI-FAHNKVFCYGPTFRAE--KSKTRRHLTEFWMVEAEVAFATHAENLKLQEDFVKTVIKETVQNSFQDLKLEKDFPVIDYTKALEIWGDDINSEREFGGPVFIQKYPREAKAFYMKVNPEDPRTVLPDGVGEIIGGSEREENYENIVQRLKEEKLPVESYDWYLDLRKYGSV-PHSGFGLGSERLIAWICGLAHVRECIPFPRMMER.... 432
175 6.000e-97UniRef50_A0A0G0Z272 Aspartate--tRNA(Asp/Asn) ligase n=33 Tax=Bacteria TaxID=2 RepID=A0A0G0Z272_9BACT  ali  21  122.RYLDLRKERNALIFKVWTLMDQVFVDTMTDKGFIQIHSPKLMN-------TASESGAEVFEVNYFDRKAYLSQSPQFYKQMAMAAGFEKVFEIGPVFRADP--SFTSRHATEFTGYDLEVSFIDHHEVMDIEESIIVAITSKVNAVYGKEIKPTSPFPRITFAEVKEILKEEKGIEKYGHEFVFITDYPPFYHMRYADKPDTTMSFDLLWNGLEVTTGAQREHRYDILKNQATEKGLTDATIGDYLNFFRYG-CPPHGGLGAGPSRFIMKMLGIDNIREATYLYRGVKR.... 434
176 8.000e-97UniRef50_A0A2G9LVY6 Asparagine--tRNA ligase n=10 Tax=Archaea TaxID=2157 RepID=A0A2G9LVY6_9ARCH  ali  26  117.RHLWIRSRRLTAIMKVRSTVFGAIHKFFRERAFHEFAPPILT-------PNACEGGSTLFEVKYYDQKMYLTQSWQLYAEAA-VFALEKLYCISPCFRAE--KSKTSRHLSEFWMAEMEIAWAGLDDIGKAAEELVAFIAKEVXXXXXXXXXXKAPFPRLTYSEALKLWGKDLRTVEEYETPVIVTHYPKETMAFYKPSDPNNPKEALCMGYGEIIGGSVRDTDLDSLKKALEKEGEKLERYEWYLDLRRYGSV-PHSGFGLGVERVVAWMCGIDNIKDAIPFPRTMIR.... 427
177 9.000e-97UniRef50_A0A2P4TES3 Phospholipid-transporting ATPase n=3 Tax=Amniota TaxID=32524 RepID=A0A2P4TES3_BAMTH  ali  19 1215.RHMMIRGENMSKIFKVRSMVVQAFRDHFFANGYYEVTPPTL-------VQTQVEGGSTLFKLDYFGEEAYLTQSSQLYLETCIP-ALGDVFCIAQSYRAE--QSRTRRHLAEYTHIEAECPFISFEDLLNRLESLVCDVVDRVLDLNPNFKPPKRPFRRMNYAEAIEWLKEERFMTDTINEPILLCRFPAEIKSFYMQRCHDDSRDVLMPNVGEIVGGSMRIWDSEELLEGYKREGIDPTPYYWYTDQRKYGTC-PHGGYGLGLERFLTWILDRHHIRDVCLYPRFVQRCKP. 1530
178 9.000e-97UniRef50_Q8EW03 Asparagine--tRNA ligase n=50 Tax=Bacteria TaxID=2 RepID=SYN_MYCPE  ali  23  120IAHLRQRTNKYGTIMRLRSELAFAIHNFFHQNNFVWVSSPIITS----NDAEGAGENFSKTVKNFFGKNASLTVSGQMHAEAY-AQSYKRVYTFGPTFRAE--KSNTNRHVSEFWMVEPEIAFCNLEQLMYLIEEFVKYLIRFILKNCKDEMTFLNPFEKITYKKAIAILKSDYLCEKVFNKPLFIYDYPAEIKAFYMKMNADGTCDLLMPGIGEIVGGSERESDYTKLVKKCTKANMKVEDIEWYLALRKYGYHK-SAGFGLGFERFLMYVTECENVKDTIPFPRSYGSLD.. 452
179 9.000e-97UniRef50_A0A0L0DG71 Asparaginyl-tRNA synthetase n=1 Tax=Thecamonas trahens ATCC 50062 TaxID=461836 RepID=A0A0L0DG71_THETB  ali  22  382LAHLRVRTKVVGAAARVRNVLAMATHEFFQGIGCQYVHTPLITAS----DCEGAGEMFRVTTLDFFSKPAMLTVSGQLNVETY-CAGLSSVYTFGPTFRAEN--SHTSRHLAEFWMIEPELAFADIHDNMACAEDYLKHCVSTVMAKCSEEINVESDFTRITYTEAIREWGIDLASEHEYNMPTIVYNYPKDIKAFYMPAPTVAAMDVLCPLVGELMGGSQREERYDVLVERLKEDNMPLEPYWWYLDLRKFGSVV-HSGFGVGFERLVLLCTGLGNIRDVIPFPRYPG..... 733
180 1.000e-96UniRef50_R5IT10 Aspartate--tRNA ligase n=4 Tax=Terrabacteria group TaxID=1783272 RepID=R5IT10_9CLOT  ali  22  123.RFLDLRNEKNILMFKVQSAFVEGMRDFLYKNEFIEIHTPKLIAA-------ASESGSDVFAVDYFDRTAYLAQSPQFYKQMAMASGFEKIFEVAPAFRAEN--SNTNRHATEFTSFDVEFSYIDFNDVMNLEEDLLIAGLTKVKEKYENEIKPTKPFPRIKYKELEKRYNSRYAMEEFGHEFIFVTDFSKKKRAFYHMRNDIPQGYDLIWKGTEITTGAQREHRYEILKTQAEEKGL-KDDVKFYLDFFKYG-CPPHGGFALGIDRMTMLLLGVSSVKESMFLFRGPNR.... 434
181 1.000e-96UniRef50_A2DLE4 Uncharacterized protein n=1 Tax=Trichomonas vaginalis TaxID=5722 RepID=A2DLE4_TRIVA  ali  19  218.RVLDLRTVANQAIFRLQSKVCQFFREFLLARDFQEIHTPKLI-------PTASEGGSNVFEVKYFDSKAYLAQSPQLYKQMAVVSGMPRVFEIGPVFRAE--KSFTHRHLTEFTGLDAEMAFTNYHEALLLFQELLCTVFTRLQKECQPEIEVIKPC-IINFKDAVKLLNEEKYGTDFFILDKFPAAVRPFYTMPDPDDPMYSNSYDMFLRGEEIVSGAQRIHNSELLLQCAAKKGVDLSPIMPYVESFRYG-APPHAGLGCGLDRITFLFLGLHNVRRGSLFPRDPTRVSP. 537
182 1.000e-96UniRef50_A0A1Y2IFN8 Aspartyl-tRNA synthetase cytoplasmic n=4 Tax=Polyporales TaxID=5303 RepID=A0A1Y2IFN8_PYCCO  ali  19  284.RVLDLRSPASQAIFRIHAGVCDLFRSYLTERGFTEIHSSKLQGSST-------ESGAAVFKVDYFRRPAYLAQSPQLAKQMCIAADMERVFEIGPVFRAEN--SNTHRHLTEFTGLDLEMAISHYHEVLDTLDDLFKTMFKGLQERFRDEIETVKKYPRLRFSEAIQMLKKEKYGADFYIIDKFPAEVRPFYTMPDPEDQRWSNSYDFFLRGEEILSGGQRIHDAQFLERRMKEEGIDPETMQEYVDGFRWG-CPPHGGGGVGLERVVMLFLKLGNIRWASLFPKDPR..... 604
183 1.000e-96UniRef50_A0A166GLT1 Aspartyl-tRNA synthetase n=2 Tax=Agaricomycetes TaxID=155619 RepID=A0A166GLT1_9HOMO  ali  18  133.RVLDLRTTTNQAIFKLQAQVTKYFREYLEGQNFTEIHSPKLQ-------GAATESGASVFKVSYFKGAAFLAQSPQLAKQMCIAADFERVYEVGPVFRAED--SNTHRHLTEFTGLDLEMAIEHYHEAMEMLDGMLKHIFTQLKQHHQKEIDTIEEFKKLSFAEAIELLNKEKYDVDYYIIDKFPMALRPFYTMPDPNNPELSNSYDFFMRGEEILSGAQRVHVPKMLEEAMIKAKIDPASMKGYLDGFRMG-CPPHAGGGIGLERVLMLFLKLNNIRRTSLFPRDPKRLEP. 451
184 1.000e-96UniRef50_Q75JQ1 Aspartate--tRNA ligase, cytoplasmic 1 n=12 Tax=Eukaryota TaxID=2759 RepID=SYDC1_DICDI  ali  18  256.RALDLRVPAHQSIFRLQSGVCTLFREQLLGEGFIEIHSPKIISA-------ASESGASVFKLNYFNTHAYLAQSPQLYKQMAICADFNKVFEIGPVFRAEN--SNTHRHLTEFVGLDLEMTFKDYHEALDTLDRLMTSIFRGLETRFAKEIEPFEPFPRFTFDEAAAMLAEEKFGVDFFIVDKFHVEVRPFYTMPDPNNPQWANAYDLFMRGEEICSGAQRIHDPELLEKSAKSHGVVIEDIQGYIDSFKYG-CSQHAGGGVGLERVVMLYLGLGNIRKASFCPRDPTR.... 573
185 1.000e-96UniRef50_A0A0G1VTT8 Aspartate--tRNA ligase n=2 Tax=unclassified Parcubacteria group TaxID=1794840 RepID=A0A0G1VTT8_9BACT  ali  22  128.RYLDLRSERMRGNLVLRHRVVKFCRDYLSEHDFTEIETPILT----KGTPEGAREFLVPSRLHP-GKFYVLPQSPQQFKQLLMVAGVERYFQIARALRDEDQRGD---RQPEHTQLDIEMSFIEAEDVYELTEGLMIAMVGHLNQLVGDGLIPSRPFPRISYSDAIEKYGSDKPDLRHELAFAWIVDFPLFEHSEEEPEKAFANQYDLVANGYELASGSMRIHDPKLQQKIFHILQIPVEEFGHMLEAFTYG-APPHGGIAPGIDRLVMLLAGEPNIREVIAFPKTGDARDPM 465
186 1.000e-96UniRef50_A0A2H9TCP6 Asparagine--tRNA ligase n=1 Tax=Candidatus Pacearchaeota archaeon CG10_big_fil_rev_8_21_14_0_10_32_42 TaxID=1974442 RepID=A0A2H9T  ali  25  1..........MTAILKIRSTVFGAIHEYFREQGFYEFQSPIII-------PGGAEDGPTMFEVDYFGKKMYLCQTWQLYAEAAIYS-LEKIYCIAPSFRAE--KSKTSRHLTEFWHTEMEVAWANLDELMEYAEEMIKYVLKKVLEKNKKELEILKKFPRLTYDEVLKIWGKDLRFMEIYDTPVFVTHYPKFYKPRDSKNPKTARCFDLPEGNGELIGGSERDTDIEELKRSLKEKGEKLEDYQYYFDIHSYGAV-PHGGFGLGTERLIKWICGLDTIKDAIAFPRTMTR.... 303
187 2.000e-96UniRef50_A0A0D0AY19 Unplaced genomic scaffold CY34scaffold_26, whole genome shotgun sequence n=3 Tax=Basidiomycota TaxID=5204 RepID=A0A0D0AY19_9HOMO  ali  21  131..HLRARTDISAAMLRLRDSVLRSLHSYYEAQDFHYVHTPILTS----NDCEGGGETFRVSPVEFFSKPAYLTVSSQLHLE-ALAASLSRVYTLSPCFRAE--RSQTNRHLAEFWMLEAEWAFIDHGDVCHVVEETLKNIWKDGDGTKLRSLEPGVPWTRMSYTDAVKELHERWLSEQLVGGPVFVTDYPSSLKPFYMRANDDACFDLLVPFIGELVGGSLREERSSHLVEAIQRHGLKEEEYGWYVDLRKYGST-PHGGYGLGFERLISWMSGIENVRECIAMPRWAKRMLL. 472
188 2.000e-96UniRef50_A0A2E3DW20 Asparagine--tRNA ligase n=7 Tax=Bacteria TaxID=2 RepID=A0A2E3DW20_9BACT  ali  23  119.RHLWLRSKRQNAIMKIRHHVVNSIREFFNNNGFILIDSPIFT-------GNAVEGTTNLFEVNYFERTAYLTQSGQLY-QEAGATAFGKTYCFGPCFRAE--KSKTRRHLTEFWMVEPEMAFVDLDENMIWAENLVGYIINNIXXXXXXXXXXIPPFPRITYKEAVDLLHSKGREFEYGNKPIMIHSWPADIKAFYMKRDKDNNELALGVGYGEIIGGGQREDDYDILINRIRHHDLPLEPFKWYLDLRKYGSV-PHSGFGLGLERTIAWICGTKHIRETIPFPRTMARLEP. 431
189 2.000e-96UniRef50_UPI000719B5C3 aspartate--tRNA ligase, mitochondrial-like n=1 Tax=Priapulus caudatus TaxID=37621 RepID=UPI000719B5C3  ali  18  181.RYLDLRRTQMQQRLRIRSEMVMKMREFLNQHGFIDVETPTL----FKRTPGGAKEFVV--PTHYPGRFYCLPQSPQQFKQLLMVGGIDRYMQIARCYRDEGSRSD---RQPEFTQVDLEMSFITQEGIMSLVEGAIAHSWPSIHSK------IAKPFPRIRYENAMARYGTDKPDTRFEMTIVDVTEDFKECHASVFSVQAHSQHYDLVLNGQEIGGGSIRIHDACLQRYILEELQERSSELAHLLEALEMG-CPPHGGIALGLDRLVAIACGTDTIRNVIAFPKTGDGKCAM 498
190 2.000e-96UniRef50_A0A1S6H5M4 Aspartate--tRNA(Asp/Asn) ligase n=9 Tax=Bacteria TaxID=2 RepID=A0A1S6H5M4_9BACT  ali  21  120.RYLDLRRPRMAKNIRLRSRAVKFIHDFLTDQDFVEIETPILT----KTTPEGARDFLVPSRLKP-GQFYALPQSPQQYKQLLMVAGFERYFQIARCFRDEDPRHD--RAYGEFTQLDLEMSFVDQNEILSLTEELFTGLVKEI---FPDKKVTATPWPRIAHAEAIKKYGSDKPDLRKDKKFAWIIDFPPSHHMFTAPHPDDVKQHDLVLNGYEVGGGSVRIHDPAVQEKIFDLIGFTDKQFDHMLTAFGYG-VPPHGGIAPGIDRFLMAALAEPSLREVIAFP......... 432
191 2.000e-96UniRef50_A0A0G4ERI4 Uncharacterized protein n=1 Tax=Vitrella brassicaformis (strain CCMP3155) TaxID=1169540 RepID=A0A0G4ERI4_VITBC  ali  22  228ISHLRPRTNLMGAVTRVRSAMAEATHNFFQSRGFLYIHTPIIT----CSDCEGAGEMFQVTTLDFFQKAAYLTVSGQLAVENY-CCAVGDCYTFGPTFRAEN--SNTARHLAEFWMIEPEMAFAELSDTMTCAEEYLAYCVRWALEHCGNDLEFFNQWRRVSYTEAIDLWGIDLGTEHEFGKPVTVYNYPKEIKAFYMRLNDDDRMDVLLPKIGEVIGGSQREERLDVLDRRLEECGLDKDTYWWYRDLRRYGSI-PHSGFGLGFERLLMLVTGVDNIRDVIPFPRHPGHAEM. 580
192 2.000e-96UniRef50_A0A1Y0L3L2 Asparagine--tRNA ligase n=1 Tax=Spiroplasma clarkii TaxID=2139 RepID=A0A1Y0L3L2_9MOLU  ali  23  118IAHLRARTKTFQAIFKIRSAASFAIHQFFNSNDFLYVQTPIITE----NDAEGAGEAFIVTTRDFFGKKAALSVSGQLNAEAY-AQAFKKVYTFGPTFRAEN--SYTSRHASEFWMIEPEVAFSDLKDNIELIEAMLKAVIRYLFENVSEELEFDAKFVVTEYAQVIEILHERYLCEVVNKAPTFVINYPKEIKAFYMDQKTVAAVDLLVPGIGELVGGSQREDDYDKLIARCHEMKIDPKELGWYNDLRKFGYYK-SAGFGLGFERLIMYVTGAQNIRDVIAFPRTPK..... 450
193 2.000e-96UniRef50_A0A0R1NKB0 Asparagine--tRNA ligase n=14 Tax=Bacteria TaxID=2 RepID=A0A0R1NKB0_9LACO  ali  23  122IAHLRPRTNTFYAVFRIRSLAAFATHQYLQAHGFNYLNTPIITGS----DAEGAGEMFRVTTLDFFRKETNLTVSGQLEAE-AFALALRKVYTFGPTFRAEN--SHTARHASEFWMIEPEMAFEDLDDDIVTIEELIKAVVSYVXXXXXXEKTRDEKFARLTYTEAIKELHERYLCEHIYNKPVFLTDYPKEIKAFYMRGKTVAAVDLLVPEIGELVGGSQREERRDVLAEKIKDNHMSEEEYGWYQDLRKYGETV-HSGFGIGFERLVMYVTGMKNIRDVIPYPRTPGNAD.. 463
194 3.000e-96UniRef50_A0A2E2STJ0 Aspartate--tRNA(Asp/Asn) ligase n=60 Tax=unclassified Bacteria TaxID=2323 RepID=A0A2E2STJ0_9BACT  ali  21  123.RPLTLRRERERAIFKVQHHILHAYRSFLVSQGFVEFQAPKL-------VGGDAEGGSEVFKVEYFKRSASLATSPQLYKQI-MAAVYERVFAVGQTFRAE--KSATSRHLSEISMLDLEMAFVDHTDVIALVTELMKSITEHVAQSCKVELELLETFPTLTLRDAQQLIGEDKTNEEWGSDFVFVTHFPPFYTHVDPDNPEFTRSFDLLFRGLEMCSGGQRVHDYTELKERIAQKGLDPEKFDFYLQAFKYGIA-PHGGIGMGLERLTMKYCGLENVKEATMFPRDMNRIDTL 439
195 3.000e-96UniRef50_A0A0G0FWZ9 Aspartate--tRNA(Asp/Asn) ligase n=482 Tax=root TaxID=1 RepID=A0A0G0FWZ9_9BACT  ali  21  127.RYLDLRRERLKNNLIVRHKVIKFIRDFLDKEDFIEIETPMLT----KSTPEGSRDFLVPSRLE-KGKFYALPQSPQQYKQLLMAGGLEKYFQIARCFRDEDSRGD---RQSEHTQLDLEISFVEREDVLELTERLFIKLV-EVLFPSKKIQDI--PFPRIPYGEAIKKYNSDKPDLKKDKNFCWVIDFPKDLLNKKNIEKIVANQYDIVLNGQELASGGIRNHTPETLKAVFEIMGEIKEKFGHMLDAFSFGT-PPHGGIAPGIDRIVSILQNEPNIREVIAFPKTGDGRDFM 442
196 3.000e-96UniRef50_O07683 Aspartate--tRNA(Asp/Asn) ligase n=30 Tax=Archaea TaxID=2157 RepID=SYDND_HALSA  ali  25  123.RHLDVRKPSTKAVFSLRSKAMGAMTDWFYDNRFEEVDTPELSTA-------GAEGGADLFPVVYYDKEAYLSQSPQLYKQILVASGVDRLFEVGHAFRAEDFG--TSRHVSEIAMFDVELGYVDHHDVMDVQEESLRHTIRHVVEHAQRELDPEADFPRITFEEAREILADEYDHEEQGHPAVFVVGYPDEYRQDVDGDDVASRKFDLLYRGQELSSGGQREHDIERLTAKMREQGVEPENFEFYLDAFRYG-VPPHGGYGLGIDRLIQQLAGLDNIKEAILFPRDPDRLEP. 436
197 3.000e-96UniRef50_Q19722 Asparagine--tRNA ligase, cytoplasmic n=412 Tax=Eukaryota TaxID=2759 RepID=SYNC_CAEEL  ali  21  229.RHLVIRGENASRILRIRAAATRAMRDHFFAAGYTEVAPPTL-------VQTQVEGGSTLFGLDYYGEPAYLTQSSQLYLETCNA-ALGDVYCISQSYRAE--KSRTRRHLSEYQHVEAECAFITFDQLMDRIEALVCDTVDRLLADNPGYKAPARPFKRMPYKEAIEWYGEDRRMTDTIGVPILLNRFPHGIKAFYMPRCADDNEDLLMPGVGEIVGGSMRIWKEDQLLAAFEKGGLDSKNYYWYMDQRKYGSV-PHGGYGLGLERFICWLTDTNHIRDVCLYPRFVGRCAP. 545
198 3.000e-96UniRef50_M1VHH8 Aspartate--tRNA ligase, cytoplasmic n=1 Tax=Cyanidioschyzon merolae (strain 10D) TaxID=280699 RepID=M1VHH8_CYAM1  ali  20  244.RFMDLRVPAHQAILRLQSGVSTLFREWLVAHGFTEIHTP-------KIIGGSSEGGAEVFRLRYFDENACLSQSPQLYKQMAICGDMRRVFEVGPVFRAEN--SNTYRHLTEFVGLDIEMEIESYHEILDVLEQLFQHIFEGLEQRFGAEIQRQYPFQRLTHRQAVDLLREEIVSKEFQTDFYVIDRFPAKCRPFYTMDSRYSNAFDVFMRGEEIVSGAQRIHDVDLLRQRITEKGLDPATLQSYVEAFQYG-VFPHGGAGIGLERVVMLYLGIGNIRECSMFPRDPKR.... 560
199 3.000e-96UniRef50_B0E615 Asparaginyl-tRNA synthetase, cytoplasmic, putative n=12 Tax=Eukaryota TaxID=2759 RepID=B0E615_ENTDS  ali  23  138.RHIVIRSEHTQQVLQLRSEIQWYFRKYYHDNHFTEIQPPTIVK-------TQCEGGSTLFKLQYFNEPAYLTQSSQLYLESVIAS-LGKSFCMLSSYRAE--QSRTVRHLAEYLHLEAELPFISFEDLLNHLEDLVCTVIDNVMKMNPHLKLPTRPFKRMTYADAIKEYGEDRQMTDEIGCPIFMIHFPSKMKAFYMHPDLTESVDLLMPGVGEIVGGSMRIWDYNELMGAYKANGLNPDPYYWYTQQRKYGSC-PHGGYGLGVERLVMWLLGEDHIRKVCLYPRYLERCEP. 451
200 3.000e-96UniRef50_O43776 Asparagine--tRNA ligase, cytoplasmic n=339 Tax=Opisthokonta TaxID=33154 RepID=SYNC_HUMAN  ali  21  233.RHMMIRGENMSKILKARSMVTRCFRDHFFDRGYYEVTPPTL-------VQTQVEGGATLFKLDYFGEEAFLTQSSQLYLETCLP-ALGDVFCIAQSYRAE--QSRTRRHLAEYTHVEAECPFLTFDDLLNRLEDLVCDVVDRILELNPNFQPPKRPFKRMNYSDAIVWLKEERLMTDTINEPILLCRFPVEIKSFYMQRCPEDSRDVLMPNVGEIVGGSMRIFDSEEILAGYKREGIDPTPYYWYTDQRKYGTC-PHGGYGLGLERFLTWILNRYHIRDVCLYPRFVQRC... 546
201 3.000e-96UniRef50_A0A0H3XKH7 Asparagine--tRNA ligase n=4 Tax=Entomoplasmatales TaxID=186328 RepID=A0A0H3XKH7_9MOLU  ali  21  119IAHLRAKTKTFNAVFRIRSSAAFAIHEYFNRQNFVYVNTPIITG----NDAEGAGESFNKYHEDFFGKKASLTVSGQLHAE-GFAQAFRSVYTFGPTFRAEN--SNTTRHAAEFWMIEPEVAFSDLNDIMKLAQGMVKHVIKYLFDHNHSELSFLTEFAQTSYTTAIDLWGMDLQTEHENKKPTFLIDYPKDIKAFYMDNKTVAACDLLVPGIGELVGGSQRENDYQKIVNRCLEMKIPTPDLQWYLDLRKYGYYK-SSGFGLGFERLVMYVTGMTNIRDVIAFPRTPK..... 451
202 4.000e-96UniRef50_A0A2U0RWT8 Aspartate--tRNA(Asp/Asn) ligase n=1 Tax=Candidatus Bathyarchaeota archaeon TaxID=2026714 RepID=A0A2U0RWT8_9ARCH  ali  22  131.RFLDLRKHEVAAIFCISDSLKRSFFDYFKTQGFIDLNTPIIVEA-------AAEGGATLFALDYFGKEAYLNQSPQLYKQMVLASGFDKVNIISRVFRAEP--HDTPRHLNELVQMDAEQAFISEEDVLKHFDGYLQYAIENLNKNCAEQLKLIFPIKRLPYDEALDKWGEDLTPEAEKKLPVLITKWPSSVKPFYCMDPKYSKGFDLLLNGTEISSGAQREHRYEELVKNLKEKGLDPVDFEFYLNAFKFG-MPPHGGWSIGLERLTMTLLKLANIKEASLFPRTKERLIP. 438
203 4.000e-96UniRef50_H9JIH1 Uncharacterized protein n=21 Tax=Holometabola TaxID=33392 RepID=H9JIH1_BOMMO  ali  22  117..HLRSRTNYISALLRIRSAVVKHIHDFFNSRNYINIHTPILTS----NDCEGAGEVFKVQPDNYFGLKTFLTVSGQLHLE-AICRGMGNVYTLGPTFRAENSRS--RLHLSEFYMLEAELAFCNIVQLQTVIEELLKYIFTETRNTNEKDIWLDKPFVTLTYDEAQLILNTELILVDHCGGPVFVTKWPKDMKSFYMKESNNDSSKVLTPVTGEVVGGSLREDNYEKL-----KLKLPSERLHWYLELRKFGNI-PTGGFGLGLERLLQVLCGVNNIKDTLPFPRWPHNCDM. 441
204 5.000e-96UniRef50_D2A0S8 Putative asparagine--tRNA ligase, mitochondrial-like Protein n=6 Tax=Neoptera TaxID=33340 RepID=D2A0S8_TRICA  ali  23  139..HFRPRTHKFGALLRLRNAATLAIYNHFNSEGFVNVHTPVLTS----NDCEGAGEVFKVVPDNYFNQKSFLTVSGQLHLE-AVAHGLSKVYTFGPTFRAENSKS--RLHLSEFYMLEGEIAFVELDGLMTCIEQLIKQVTKKLVNDSIEDIELDKSFPVVTYKEAVTILNKDKFVEYFGKVPTFVIDWPKDMKPFYMKDNTVAALDLLGPNVGEVVGGSLRENNYEKLLEKINSNG----HLDWYLDLRKFGSV-PTGGFGLGFERYLQLILGISNIKDTIPFPRWPHNCSL. 470
205 5.000e-96UniRef50_A0A1V6C6W8 Aspartate--tRNA ligase n=2 Tax=Bacteria TaxID=2 RepID=A0A1V6C6W8_9BACT  ali  20  116.RYFSLRHPKLAAVFKVQSCISRGFREYLSSQEFTEIHTPKIVAS-------GTEGGANLFKVDYFGRPAYLAQSPQFYKQM-MVGVFERVFEVAPVFRAEP--HNTSRHVNEYTSLDFEMGYIDENDIMDMEEAVLQYVVGLVNETCQAELELLTKIPRMRMTEVHEILEKEYVQKEAGSEFVFIDGYPIEARPMYTMHPGDTRGFDLIYRGMEITTGGQRIHGFDMLVDNIRKFKCNPDDFTFYTDVFKYG-MPPHGGLAIGLERITCQMLGLKNIREGTLFPRDLDR.... 426
206 5.000e-96UniRef50_A0A087EQP1 Asparagine--tRNA ligase n=14 Tax=Bacteria TaxID=2 RepID=A0A087EQP1_9LACO  ali  22  120IAHLRPRTNTFYSVFRIRSLAAFAVHEYLQHNDFVYVNTPIITSS----DTEGAGEMFRVTTMDFFKTETNLTVSGQLP-EEAFTMAFKNVYTFGPTFRAEN--SHTPRHASEFWMIEPDMAYTRLPGMMDVAEGLLKYVINYVLDHAKDELEFLEDFARVTYTDAVKLWGIDLQSEHEYKRPTFLTDYPRDIKAFYMRDNDDGKTDCLVPGIGEIVGGSEREERYDVLNNKIKEFDLNPEEYDWYEDLRKYGEIK-HSGFGIGFERLVMYVTGMENIRDVIPFPREPGSA... 460
207 5.000e-96UniRef50_W2TW06 Asparagine--tRNA ligase n=5 Tax=Chromadorea TaxID=119089 RepID=W2TW06_NECAM  ali  20  181.RHLVIRGENASRILRIRAAATRAMREHFYHAGYTEICPPSL-------VQTQVEGGSTLFALDYFGEQSYLTQSSQLYLETCNAS-LGDVYCIAQSYRAE--KSRTRRHLAEYAHVEAECAFITFEELMDRIENIVCDTVDRLMSDNPEFKPPQRPFRRMTYTEAIEWLGEDRKMTDTIGEPILLNRFPAGIKSFYMSRCEDDNEDLLMPGVGEIVGGSMRIWHEDDLHKAFIGAGIDPKNYFWYMDQRKYGSV-PHGGYGLGLERFICWLTNTHHIRDVCLYPRFIGRCAP. 497
208 6.000e-96UniRef50_A0A2W1CF70 Uncharacterized protein n=2 Tax=Helicoverpa armigera TaxID=29058 RepID=A0A2W1CF70_HELAM  ali  21  207.RVLDLRTPANQAIFRIEAGVCRLFRDILTKQGFVEIHTPKIISA-------ASEGGANVFTVSYFKSSAYLAQSPQLYKQMAIAADFDKVFTVGAVFRAED--SNTHRHLTEFVGLDLEMSFHHYHEVLDTIAGSLTQLFRSLAQEYASEIARVEPFKVLQFPQAIQMLGDEKYDTDFYVLDKYPLAVRPFYTMPDADNPKVSNSYDMFMRGEEILSGAQRIHDPEFLTERAKHHGIDISKIAAYIESFRLG-CPPHAGGGIGMERVVMLYLGLDNIRKTSMFPRDPKRV... 523
209 6.000e-96UniRef50_A0A1G2KUU1 Aspartate--tRNA(Asp/Asn) ligase n=13 Tax=Bacteria TaxID=2 RepID=A0A1G2KUU1_9BACT  ali  21  122.RWIDLRKHKYALVFKVWTLMEQAFREYWIERGYIEIHSPKLI-------ATASESGAEVFEVKYFDRKAYLAQSPQFYKQMAMAAGFERVFEVGPVFRAEP--SFTSRHATEFVGYDTELSYISHHDVMEEEEKTIQHVIQRVKEKYGDEIAPSLPFPKISMKETKKILASEYAKEKYGHEFVFITDYPPFYHMRDEENPRLTKSFDLLWNGLEVTTGAQREHRYEVLTAQAKEKGMNIESLQFYLNFFKYG-CPPHGGYGMGPNRMVMQLLGLDSIRDASFVYRGVKRLEP. 437
210 6.000e-96UniRef50_A0A2G9PT92 Aspartate--tRNA(Asp/Asn) ligase n=4 Tax=cellular organisms TaxID=131567 RepID=A0A2G9PT92_9ARCH  ali  24  124.RFIDLRRIETNALFRIRSETMRAFRASCEAQGCQEITTPVLVSSST-------EGGADVFRVDYFGKEAFLAQSPQLYKQLAVIGGMDRVFMVSPVFRAE--KHNTTQHLNEVTQMDVELGFADEEDALAALEKTFIDILADVSKTRAAELKVPKSLKRFTYAQAVDEWGSDFSKEAEARIPFFITRWPAFYSMPSEADPEICLAYDLVYRGVEVASGAQRIHEPELLVKQLKYHGLRPSNFERYVDAFRYG-APPHAGWSIGCERLLMQLCNLKNIREAALFPRDRVR.... 429
211 6.000e-96UniRef50_A0A1W4ZW38 asparagine--tRNA ligase, cytoplasmic n=24 Tax=Bilateria TaxID=33213 RepID=A0A1W4ZW38_9TELE  ali  19  244.RHMMIRGENVSKILRVRSAVTQCFRDHFFSRGYCEITPPTL-------VQTQVEGGSTLFSLNYFGEQAYLTQSSQLYLETCIP-ALGDTFCIAQSYRAE--QSRTRRHLAEYTHIEAECPFMTFEDLLNRLEDLICDVVERVLKSNPNFKPPKRPFKRMNYSEAIEWLGEDRLMTDSINETILLCRFPANIKSFYMQRCPEDRRDVLMPSVGEIVGGSMRIWDSKELLEGYQREGIDPTPYYWYTDQRIYGTC-PHGGYGLGLERFLTWLLNRHHIRDVCLYPRFIQRC... 557
212 6.000e-96UniRef50_A0A1Q9NV13 Asparagine--tRNA ligase n=3 Tax=Candidatus Heimdallarchaeota TaxID=1936272 RepID=A0A1Q9NV13_9ARCH  ali  22  128.RHLVIRGQGTSNILRFRSILTQAFRNFFFNRGSFEVHPPTL-------VQTQVEGGSTLFKFKYFDQIGYLTQSSQLYLETVI-FALKDVFCVMPSYRAE--KSRTRRHLTEYTHIEWEGAFIEFEDLLNLLENMVRFIVKEIKERNPDFHLDDKPFIRITYSDAIKMLNEDGSAYEYGDEPVFLTKFPAEQKAFYMKRDSEDKDDLLVPNVGEVIGGSVREDDLETLIKRFEAEGLDTNPYYWYLDLRKYGSV-PHSGFGLGLERCLVWILGLDHIRESCLFPRLQNRI... 440
213 6.000e-96UniRef50_R5T956 Aspartate--tRNA ligase n=47 Tax=Terrabacteria group TaxID=1783272 RepID=R5T956_9CLOT  ali  22  125.RWLDLRNPYNADIFRIQSKFVEAMREFLYSKNFMEIHTPKLI-------GAASESGSEVFEVKYFDRLAYLAQSPQFYKQMAMSAGLDRIFEVGPVFRAEN--SNTNRHTTEFTGFDLEFSYIDSEDVMCMEEELLTYALGKVKDSYGELIKPTGKFPRIKYDELENRYGEDYSMEVHNSEFLFVTDYPKNKRAFYHLRKNDIPQYDLIWRGVEITTGAQREHRYDVLCEQAREKGLD-KDVKFYLEFFKYG-CPPHGGFGLGVDRLTMLLLGLPSLKESMFIFRGPNRLNP. 439
214 7.000e-96UniRef50_A0A2H0VFI7 Aspartate--tRNA(Asp/Asn) ligase n=42 Tax=cellular organisms TaxID=131567 RepID=A0A2H0VFI7_9BACT  ali  22  127.RYLDLRSKRMSYNMKMRSEMMHFVRNYLHDKGFIEFHTPILS----KSTPEGARDYLVPSR-KFPGKFFALPQSPQQYKQMLQVAGFDKYFQIAPCFRDEDARAD--RSPGEFYQVDMEMSFVTQEDILNITEEMFTKMVRTLWPEKKMTFD---PWPRLDYAEVMEKYKTDKPDLRKNKEDIFVVNFPLFAPQAKDKNKVKSYQHDLVLNGLEVGGGSVRIHDSKLQNKIFGLIGFDDEKFEHLLQAFEYG-VPPHGGIAPGFDRLLSVILGEKSIREVIAFPLMAEARDPL 452
215 7.000e-96UniRef50_A0A0H1S5C4 Asparagine--tRNA ligase n=3 Tax=Mycoplasmatales TaxID=2085 RepID=A0A0H1S5C4_9MOLU  ali  23  139.PHLRAKTNYFLTLFRLRHSISKAIHDFFHQEKFYYVPTSIITS----NDTEGAGELFNISTNNFFPKPAKLTVSGQLQAE-ALAQGLGKVYTFAPCFRAE--KSHTARHLAEFWMVEPEMIFTDLNGIINLAERLIKYVINYVLNNNGSELEFLKEFKKIDYGEVIKILHEKYLCHYFDNSPVFVLNYPTELKAFYMKNNPNEKFDLLFPEVGELIGGSMREDNYQVLVEKAQKIGLDINNLSWYFDLRKTGYA-PSGGFGLGLERLIMFISGTENIRDTIAFPRYPKH.... 467
216 7.000e-96UniRef50_A0A0E0CFC6 Uncharacterized protein n=2 Tax=Oryza TaxID=4527 RepID=A0A0E0CFC6_9ORYZ  ali  20  188.RVIDLRTPANQAIFRVQ----------------CEIENVSLASTRPKLIGGSSEGGAAVFKLDYNGQPACLAQSPQLHKQMAICGGFERVFEVGPVFRAED--SNTHRHLCEFVGLDMEMAIKDYFEVCDVVDRLFVAMFDHLNKNCAKELERQYPFKPLRHTEAKKKLGEAKYDTDFYMLCRYPSAVRPFYTMPCSDDPRYSNSFDVFVRGEEIISGAQRVHVPEVLSRQAEARGIDVGSIAAYVDAFRYG-APPHGGFGVGLERVVMLFCGLGNIRKASLFPRDPRRLNP. 483
217 8.000e-96UniRef50_A0A174R082 Aspartate--tRNA(Asp/Asn) ligase n=28 Tax=Firmicutes TaxID=1239 RepID=A0A174R082_9FIRM  ali  21  115LRPVTLRAPRARAVFRIQAAVCRAFREFLQGEGFTEIHTPKLGQA-------GAEGGSSQFRLDYFGRKAVLAQSPQLYKQ-AMVGVFERVYEIGPVFRAE--KHATQRHLNEYTSLDLEMGFLHFTDLMALEQGFLRRLVALLRQEYAGELALLEHIPAVRFDEAKRLYGEEYAKEVWGSDFVFVTHYPPFYTMDDPEDPRYTLSFDLLFRGMEITTGGQRIHNYGQQVEKLKARGMEPEDFSGYLLFHKHG-APPHGGLGIGLERLTMQLCGLDNIRRASLFPRDRTRLEP. 429
218 8.000e-96UniRef50_A0A2P6NFK2 Uncharacterized protein n=1 Tax=Planoprotostelium fungivorum TaxID=1890364 RepID=A0A2P6NFK2_9MYCE  ali  23 1642IAHLRGRTNTFSNMVRVRNACSMATHLFFQSQNFIYLNTPLITTS----DCEGAGEMFQVTTLDFFGKPAFLTVSGQLNGEMY-ASAVGRIYTFGPTFRAEV--SHTKRHMSEFWMIEPEIAFADLDENMDIAEAYLKFVLKHVRETCPEELAFEKPFKKMSYTEAVQVWGIDLGSEHEYKQPVILYNYPKDIKAFYMRLNDDGKMDVLVPKIGELMGGSQREERLEHLEQRIDELKLDKHAYRHYLDLRRFGTC-QHSGFGLGFERLVMFVTGIENIRDAIPFPRVPGSA... 1988
219 8.000e-96UniRef50_A0A0S7HRD0 SYNC (Fragment) n=15 Tax=Opisthokonta TaxID=33154 RepID=A0A0S7HRD0_9TELE  ali  19  1..HMLIRGENVSKILRVRSTVTQCFRDHFFSRGYYEITPPTL-------VQTQVEGGSTLFNLDYFGEQAYLTQSSQLYLETCIP-ALGDTFCVAQSYRAE--QSRTRRHLSEYTHIEAECPFISFEDLLTRLEDLVCDVVDRVLDINPDFKPPKRPFRRMNYTEAIEWLREERLMTDSINETILLCRFPAEIKSFYMQRCPEDRRDVLMPNVGEIVGGSMRIWDSDELLEGYKREGIDPTPYYWYTDQRKYGSC-PHGGYGLGLERFLTWLLNRHHIRDVCLYPRFIQRC... 313
220 8.000e-96UniRef50_B5YN18 Aspartate-tRNA ligase or aspartyl tRNA synthetase n=6 Tax=Eukaryota TaxID=2759 RepID=B5YN18_THAPS  ali  21  160.RWLDLRAPANNAIMRIQSAVCQLFRESLYSQGFVEIHTPKLI-------AGESESGAGVFTTDYFGTTACLAQSPQLYKQMAISSDLDRVFEIGPVFRAEN--SHTRRHLCEFTGLDLEMSIEHYMETLEVVHKMFKHIFENLETRWARELEVIRTFTVLHWPEAMEILRKEKYGTDFFMLDKYPSDIRPFYTMPDPTDDRFSNSYDMFIRGQEICSGAQRCHDPELVTEIINKKGIEIDGLKTYIDSFRHG-VSPHAGAGIGLERVVFLYLGLDNVRKASMFPRDPNRC... 478
221 9.000e-96UniRef50_A0A1Q7YQD1 Asparagine--tRNA ligase n=2 Tax=Bacteria TaxID=2 RepID=A0A1Q7YQD1_9CHLR  ali  26  120.RHLWIRTPRQAAILRIRAEAIRAAREFMDGQGYTLTDAPMFT-------PAACEGTSTLFEVNYIDQKAYLTQSGQLYGE-ALAMALGKIYTFGPTFRAE--KSKTRRHLTEFWMLEPEAAYVELDEAMALGEGLVSAIVQSVLRNKSRELELKRDTKKL---ESVKRGDEETIISSSFDRPVIVHRYPTALKAFYMQPDPQRPELALPEGYGEIIGGSQRIHDYDLLVKRLREHDLPEESFQWYLDLRRYGSV-PHSGFGLGLERTVAWICGTEHIREVIPFPRMIYRV... 406
222 1.000e-95UniRef50_A0A2P6VY54 Aspartate--tRNA(Asp/Asn) ligase n=1 Tax=Thermoplasmatales archaeon SW_10_69_26 TaxID=1919232 RepID=A0A2P6VY54_9EURY  ali  21  128.RFLDVRKPEVQAIFAVRAAAVEGGRQWLQEEGFTEFTSPNII-------GAASEGGTDIFEVQYFEETAYLSQSPQLYKQMMMATGLDKVFEIAKYFRAES--HNTRRHLNESSAFDCEVAFIDDEDVLWVLENLVHAITSFVDENCTEELELLTPFPRVTYDEALDWWGEDLIMEEKGHEYYFITKYPDECKPFYPEGEELSRSFDLGKSGMEVTSGAQRVHDPDLLRQRIEEMGADTEDFEDYLKPFTYG-MPPHGGFGLGIERIVMEMLDLHNIREAVLFPRDRDR.... 437
223 1.000e-95UniRef50_E9ICF4 Uncharacterized protein (Fragment) n=5 Tax=Holometabola TaxID=33392 RepID=E9ICF4_SOLIN  ali  19  202.RVLDLRTPANQAIFRVEAGVCKLFRDILTRKGFVEIHTPKIISA-------ASEGGANVFTVSYFKGNAYLAQSPQLYKQMAIAADFDKVFTVGAVFRAED--SNTHRHLTEFVGLDLEMAFYHYHEVIDTIGQMFTELFKGLRDIYADDIAPVEPFKKLEYPQAIELLGEEKYDTDFYILDKYPLAVRPFYTMPDPNNPKVSNSYDMFMRGEEIISGAQRIHDPDFLTERAKHHGIDIEKIKSYIDAFRYG-CPPHAGGGIGMERVVMLYLGLDNIRKVSIF.......... 511
224 1.000e-95UniRef50_F6VXM8 probable asparagine--tRNA ligase, mitochondrial n=2 Tax=Ciona TaxID=7718 RepID=F6VXM8_CIOIN  ali  23  133.PHLRMRRTSMINAFKLRNQLEMLFHEFFQNEGFTHVHTPIITLS----DCEGAGELFENSENHFFNKPAYLTVSGQMHLEAC-AMSLGSVYTLSPVFRAEHGIS--RKHLSEFRMLEVEVAFTDLHEILDLIEDSIKFCIERVLKKFDDGYKDIPPYVRIPYSEALEIWGDDFNTKHFGLTPVFIINFPKVAKPFYMYNNTVAAVDLIFPFCGEICGGSLREHRLELLQDSLRTSGLNEKDYEWYLDLRRFGSA-PHGGYGLGFDRLVHFLLGTRNIKDAVPFPRTPHSCPL. 471
225 1.000e-95UniRef50_A0A1H3GDZ9 Aspartate--tRNA(Asp/Asn) ligase n=5 Tax=Halobacteria TaxID=183963 RepID=A0A1H3GDZ9_9EURY  ali  23  124.RTLDLRKDEVKAVFEIRGEIFRAAREAFRDANATEITTP-------KIVATGTEGGTELFPITYFGEEAFMNQSPQLFKQLTAGSSLERVFEIGPIFRAE--EHNTPRHLNEATSIDFEGAFCDHEDAMDVCESVIRSAYEAVERNCEPQLEPTESFPRLTYEEAIERWGDDLPTEEDVGEHYFITDWPSEIKPFYIKDDTLSTGFDLMHPRMELVSGGQREHRYEELIAGFEQQGLDPEEFEYYTKMFKYG-MPPHAGWAIGAERLVMTMLGLDNIREAVLFPRDRQRLSP. 437
226 1.000e-95UniRef50_D5EVC3 Asparagine--tRNA ligase n=39 Tax=root TaxID=1 RepID=D5EVC3_PRER2  ali  22  121..HMRLRTNTFGAVMRIRHNMAMAIHTYFHEHGFFYFHTPLITAS----DCEGAGNMFQVTTKDFFGEQTSLTVSGQLEGE-LGATALGSIYTFGPTFRAEN--SNTPRHLAEFWMVEPEVAFLDQEELMDLEEDFIKYCVRWALDNCKDDLEFLNKFVRLPYTEGINIWGDDLASEHHFKKPVIMTDYPRAFKSFYMKQPTMQGTDVLFPQIGEIIGGSVREESYDKLMGEINRREMDQTHLWWYIDTRKWGSC-PHAGFGLGFERLILFVTGMQNIRDVIPFPRTPKSA... 477
227 2.000e-95UniRef50_A0A2R4ZQM2 Aspartate--tRNA(Asp/Asn) ligase n=6 Tax=Desulfurococcales TaxID=114380 RepID=A0A2R4ZQM2_9CREN  ali  21  124.RWLDVRNPRIMGIFVLEAEVAHAFREYFRSNGFIEIFTP-------KIVGGATEGGAEVFPIVYFDRQAFLAQSPQFYKQMGVIAGFERVFEIGPVYRAE--KHHTVRHLTEYHSIDYEVGFIDLEDVISVAEGAFKYVVESVLRKEGSDILIPKEMPKITMREAYRILGEDLDSEEFSSDFIFVTEYPPFYAMRKPGEPEWTLSFDLIFRGLEVATGGQREHRYHVLVEQAREKGLNPDNFWFYLEFFKYG-APPHGGAGIGLERVVMQILKLSNIREARLLPRDPER.... 437
228 2.000e-95UniRef50_UPI000D7F1C06 aspartyl-tRNA synthetase n=1 Tax=Acaromyces ingoldii TaxID=215250 RepID=UPI000D7F1C06  ali  21  395.RVLDLRSPSSQAIFRINSAVCLAFRSFLGKQGFVEIHTPKLL-------GGASESGASVFGVNYFGRPAFLAQSPQLYKQMCVCAGFGRVFEIGPVFRAEN--SNTHRHLTEFTGLDLEMEIGDYHEAMHLIDDMLKTIFGIITNDHARELDWLDETPVLQFPDGIKMLVKEKYGTDFYILDKFPAGVRPFYTMPDPIRKGASNSFDIFVRGQEIISGGQRIHDADMLGDNIRRAGVEMKGLEEYVSAFRL-AAPPHAGCGIGLERFVMLFLGLPDIRNASLYPRDPK..... 715
229 2.000e-95UniRef50_UPI0009752A33 uncharacterized protein LOC105324535 n=1 Tax=Crassostrea gigas TaxID=29159 RepID=UPI0009752A33  ali  19  84.RYLHLRRPSVKQNIILRSQLTKIVRDFLHGKDFCEIETPILT----KATPEGARDFLVPSRV-FPGEFYALPQSPQQYKQLLMIAGFDKYFQVARALRDEDSRAD---RQPEHTQIDMELSFVQRDEIMEILEEMFTLVTEKL---FPEKKFLQKPFPRLTYHECIQLYGTDKPDLRYDLDFAFVVDFPPIHHMFVMPNKVISTQFDVICNGYELCSGSCRIHSSNLQRKIMAMIGLIEEKFAHLLQALEYG-APPHGGAAPGLDRLLMVLTGTTNIRDVIAFPKTQRG.... 402
230 2.000e-95UniRef50_F0Y5S0 Uncharacterized protein n=1 Tax=Aureococcus anophagefferens TaxID=44056 RepID=F0Y5S0_AURAN  ali  23  157IAHLRPRTNTLAAAARLRSCLAQATHRFFEQEGFAYVHSPIITAS----DCEGAGEMFRVFEDDFFARSAFLTVSGQLSAETY-ACAMGDVYTFGPTFRAEN--SQTSRHLAEFWMIEPEMAFATITEAMDNAEALLKSTIAAALDKCGADLKFCAPFVRLKYADAVDEFGTDLATEHEGGNCVFVYDYPRTIKSFYMRDNDDAAFDLLAPGVGELVGGSQREERTDKLEAKMVEFGLDPEDYWWYLDLRKYGSV-PHAGYGLGFDRLVCYVSAIENIRDSIPYPRYPGSA... 505
231 2.000e-95UniRef50_A0A0G0QZN8 Aspartyl-tRNA synthetase n=3 Tax=root TaxID=1 RepID=A0A0G0QZN8_9BACT  ali  19  6...LTLRTEKAKAVFKVQAEIVKAFREFLNQENFTEFQSPKLI-------GEDAEGGANSFDVTYFKHIAHLAQSPQLYKQI-MVGVFERVFAVGNVYRAE--KHSTTRHLNEYTSLDMEMGFIDHTDIMKMENRLLKFVMGELTETCAKEFELLKNIPAMKLREAQEIWLCEYAKKQFGSDFIFITHFPMAKRPFYTHEDEYAKGFDLLFRGVEITTGAQRIHKYDELVEALKKKGLNPDKFSFYLQAFKCG-MPPHGGFGMGLERLTAKLLGLENVKEATLFPRDLNRIDTL 319
232 2.000e-95UniRef50_K1WZH6 Aspartyl-tRNA synthetase n=29 Tax=Leotiomycetes TaxID=147548 RepID=K1WZH6_MARBU  ali  22  346.RIVDLRTGPAQAIFRIQSGICNLFRTYLDDRGFIEIHTPKLQ-------GGATESGASVFEVNYFGRPGFLAQSPQLAKQMAIAADFERVYEVGPVFRAED--SNTPRHLTEYTGLDLEMALEHYHEALDIIDGMFKNLWKGIYERYQKEIDLISEFPRIKFKDGVQLLIEDKYKTDYYILDKFPASARPFYTMPDPDDNTYTNSFDIFMRGQEILSGGQRIHDAKFLEKNLKTKGIHPDTMIEYLEGFRWG-APPHAGCGIGLERLTYLFLNLGNIRLASLFPRDPK..... 666
233 3.000e-95UniRef50_A0A094C563 Uncharacterized protein n=1 Tax=Pseudogymnoascus sp. VKM F-4513 (FW-928) TaxID=1420907 RepID=A0A094C563_9PEZI  ali  21  370.RVVDLRTASSQGIFRIQSGISKIFRDYLDSKGFIEIHTPKLQGS-------ATESGASVFEINYFGRPVYLAQSPQLAKQMCIAADFERVYEIGAVFRAEN--SNTSRHLTEYTGLDLEMAFEHYHETLDLIDEMFKSVWKGLYKRYSKEIGVISQFPRLSFSDGVKLLLEDGWHADYYILDKFPASARPFYTMPDPNNESFTNSFDIFLRGQEILSGGQRIHDAEFLEERMRKLGVKPENMNDYLEGFRWG-APPHAGAGVGLERLTYLFLNLGNIRLASLFPRDPK..... 690
234 3.000e-95UniRef50_A0A251TEY7 Putative class II aminoacyl-tRNA and biotin synthetases superfamily protein n=20 Tax=Eukaryota TaxID=2759 RepID=A0A251TEY7_HELAN  ali  19  220.RILDVRTPANQGIFRLECQVSNFFRQFLLNEDFIEINTPKLTAGT-------SEGGAAVFKLEYKKQPACLAQSPQLHKQMAICGDFGRVFIVGPVFRAED--SYTHRHLCEFIGLDMEMEIEHYSEVMDVVDRLFVGMFDRLNERCQKELEKQYPFKRLTFEEGVQMLKEKLVLEKYGTEFYILHRYPPFYTMPCPDNEAYSNSFDVFIRGEEIISGAQRVHIPELLESRATACGIDVKTISSYVDSFRYG-APPHGGFGVGLERVVMLFCALDNIRKTSLFPRDPRRLEP. 538
235 3.000e-95UniRef50_U4TWR4 Uncharacterized protein n=2 Tax=Dendroctonus ponderosae TaxID=77166 RepID=U4TWR4_DENPD  ali  19  738.RHIMIRGENTSKVLRMRSVLLQAFRDHYLDRGYCEVTPPSI-------VQTQVEGGSTLFKLDYFGEEAYLTQSSQLYLETCLPS-MGDVYCIAESFRAE--QSRTRRHLAEYTHVEAECPFISFNDLLDRLEDLICDVVDRVLELNPNFQVPTRPFMRMNYSDAIDYLKEERKMTDEINKPIMLCRFPANIKSFYMSKCPEDVRDVLLPNVGEIVGGSMRIWDSEELLEGYKREGIDPAPYFWYTDQRKYGTC-PHGGYGLGLERFLCWLLNRYHIREVCLYPRYLNHCKP. 1053
236 3.000e-95UniRef50_I7J097 Asparagine--tRNA ligase n=2 Tax=Lactobacillus TaxID=1578 RepID=I7J097_9LACO  ali  24  119.RHLWLRSRRPFAIMQIRNTLFKATVDFFEKEGFIKFDAPFFVHSAP-------EGTTELFHTEYFDHDAYLSQSGQLYGEVG-AEAFGKIFTFGPTFRAE--ESKTRRHLTEFWMMEPEMAWMHQDESLDIQERLLAYITGQVLEKNLYELKLLGNFTRLSYDDAVKMWGDDFFISEQFDRPFFIVNYPTAIKPFYMKKNPENPKEYLPEGYGEIMGGSERESDYETLKSQIEEAGLNLDDYEWYLDLRKFGSV-PHSGFGMGFERVIAWICNLDHVREAIPFPRTINR.... 429
237 3.000e-95UniRef50_M1MGB0 Aspartate--tRNA(Asp/Asn) ligase n=677 Tax=Bacteria TaxID=2 RepID=M1MGB0_9CLOT  ali  21  116.RTISLRIPKKKAIFKVQNEIEDAFRKFFKGNDFEEIHTPKITHS-------GTEGGSEMFTVNYFNRRAFLSQSPQFWKQMMVGAGFERVFEVGYAYRAE--LHNTWRHLNEYVSLDVEMGFIDETDLMDMEENFIRYLYKHLKETCSDELKLEISIPRIPLAKAQEILLTEYNKEKYNSDYVFLTEYPTAKRPMYAMDPEMTKSFDLIFKGVEITTGGQRIHDYEMLKAKMERLGLKLEDFAFYLDTFKYG-MPPHGGFAIGLERITMQILNLGNIREASLFPRDMKR.... 426
238 3.000e-95UniRef50_Q4WHE9 Cytoplasmic asparaginyl-tRNA synthetase, putative n=41 Tax=Opisthokonta TaxID=33154 RepID=Q4WHE9_ASPFU  ali  18  258.RHLVLRGEISSAVMKVRAACLKAFRQVFEEKRMLEVTPP-------AMVQTQVEGGSTLFKFDYYGEDAYLTQSSQLYLETCLPS-LGDVFCVCPSFRAE--KSLTRRHLSEYTHIEAELDFITFTDLLDHLEEVICRVIELIKQLNPDFKPPSRPFRRMKYADAIQWLVEERKMTDIINQPIFLTHFPAEIKAFYMKKDPEDRRDVLMPGVGEIVGGSMRMDDWDELMAAYKHEGMDPTPYYWYTDQRKYGTS-PHGGYGLGLERFLAWLCARYTVRDCCLYPRFTGRC... 572
239 4.000e-95UniRef50_W0T5U7 Asparaginyl-tRNA synthetase n=3 Tax=Kluyveromyces TaxID=4910 RepID=W0T5U7_KLUMD  ali  24  127......RTTYLSNLLRFRHKVESQLTKTLDDLDFTLVRPPTLTSI----DCEGAGEMFQLKQSHW-NKPVNLTVSSQLHLEVLM-MGLGRVYCLQPCFRAE--KSDTNRHLCEFWMLEVETAFIDKNELMDLVELMIKNVVSSLSESNDKWAKLLQDWRRITYTDAIELWGQDKWLCEHFGGPVFVTNYPRDCKAFYMKQRPQECFDLLFPEIGEIVGGSIREDNYDVLKNEVERRKMDYKELEWYLNLRKEGTV-PHGGFGIGIERLVSYLYGNPNIRDSIPFHRTTGQIDL. 443
240 4.000e-95UniRef50_A0A2E9KWE8 Asparagine--tRNA ligase n=47 Tax=root TaxID=1 RepID=A0A2E9KWE8_9SPIR  ali  21  118.RHLWLRSRKMIAILKIRDTVLSSLREHWRKNSFYEYHSPTIL-------GTQCEGGSSLFAVDYFGKELYLAQTWQLHAEPGIFS-LEKIFTIQPSFRAE--KSKTSRHLTEYWHAEMEVAWEDFNYLQDDAEKAVKYVVSEVLKNNLEELEILERFPRMSYDEALKILKQKKKMEEFYDTPIFVTDYPKKVKAFYMKDSENCFDMIGPEGSGELIGGSQREESIEKLRENLEADGENSENYEFYFDTRRYGSV-PHGGYGLGVERLIAWICGLSTIKDAITFPRTMTRHSP. 435
241 4.000e-95UniRef50_A0A1I7VKB6 Uncharacterized protein n=20 Tax=Eukaryota TaxID=2759 RepID=A0A1I7VKB6_LOALO  ali  18  223.RVLDLRTQTSHAIFSIQDGVCELFRNTLKKRGFMEIHTPKIISA-------ASEGGANVFEVSYFKGSAYLAQSPQLYKQMAIAADFDRVFTIGAVFRAED--SNTHRHLTEFVGLDIEMAFFHYHEVLEMIAAVMIDIFKDLKAKFKYEIEPCEPFEILKYSDAVKLLREEKYHTDFYVLDRYPLAVRPFYTMPDAKDSKYSNSYDMFMRGEEILSGAQRIHDASLLTERAKHHQIDLEKIRAYIDSFKYG-CPPHAGGGIGLERVTMLFLGLGNVRLASLFPRDPKRI... 539
242 4.000e-95UniRef50_A0A2K5LWI0 Asparaginyl-tRNA synthetase n=4 Tax=Opisthokonta TaxID=33154 RepID=A0A2K5LWI0_CERAT  ali  21  207.RHMMIRGENMSKILKARSMIIRCFRDHFFDRGYHEVTPPSL-------VQTQVEGGATLFKLDYFGEEAFLTQSSQLYLETCLP-ALGDVFCIAQSYRAE--QSRTRRHLAEYTHVEAECPFLTFEDLLNRLEDLVCDVVDRILELNPNFQPPKRPFKRMNYSDAIIWLKEERLMTDTINEPILLCRFPVEIKSFYMQRCPEDSCDVLMPNVGEIVGGSMRTSDAEEILAGYKREGIDPAPYYWYTDQRKYGTC-PHGGYGLGLERFLTWILNRYHIRDVCLYPRFVQRC... 520
243 5.000e-95UniRef50_D8M0R5 Uncharacterized protein n=3 Tax=Stramenopiles TaxID=33634 RepID=D8M0R5_BLAHO  ali  19  293.RWIDLRTPCNQAIVRLSSAVCLLFREYLLQNDFVEIHTPKINPGT-------SEGGSNVFKLDYFGSQACLAQSPQLYKQMTTACAFERVFEIGPVFRAEN--SNTHRHLTEFVGLDMEMTIEHYYEAVNMIANMFVYIFDGLNARFAKELNAVQPFTILSYSEGMQRLVKEKYNTDFYILDKFPLSIRPFYTMPDPHNPKLSNSYDIFIRGEEIVSGAQRIHDPELLAERAKACGISIESLHAYLQSFSHG-AYPHAGCGIGLERVVMLFLGLPNIRYTSMFPRDPKRCNPL 613
244 5.000e-95UniRef50_A0A288GVN4 Asparagine--tRNA ligase n=1 Tax=candidate division SR1 bacterium Aalborg_AAW-1 TaxID=1643353 RepID=A0A288GVN4_9BACT  ali  23  117.RHLYLRSKSQVAIQRVRDTIIHATYDWMRDNGFTKIDAPIFTP----NAAEGTTELYEVEHVN--GETMYLSQTGQLYIEAAM-YGVGRVFDFGPVFRAE--KSKTRRHLNEFWMMDAEMPFVQQEENMQIQEDMLKYIITQVLEKNAKDLTLLKPWIRMTHAQWVDDLGSDIQYMEMVDTPIFVTHFPMGIKAFYTKEDPNCSDLLAPEGCGEVVGSSTRDDDYDVLLQKIKDHGLDPATFDWYLDLRKYGTV-PHAGFGYGLERLVRWFCGLHHIRETIPFPRYANRI... 429
245 6.000e-95UniRef50_A0A0F7S7N9 Related to aspartate-tRNA ligase n=15 Tax=Ustilaginomycotina TaxID=452284 RepID=A0A0F7S7N9_9BASI  ali  20  314.RIVDLRTPTAQAIFRINAAICNSFRSHLDQNGFIEIHTPKLQ-------GGASESGSSVFMLDYFGRPAFLAQSPQLYKQMCIASDFKRVYEIGPVFRAEN--SNTARHLTEYTGLDIEMEIVHYYDAIRVIDGMLKSIFTALKNNFKAEREIKRHFPILPFAQGVRLLKEKKYHTDYYILDKFPTSVRPFYAMEDKNDPKVTNSFDIFIRGQEICTGGQRIHDIEELERKMQRLSISAKGMQEYLEGFRLG-APPHAGCGIGLERLVMLYLNLGDVRYGTLFHRDPRSLPL. 637
246 6.000e-95UniRef50_A0A2G9NGB8 Asparagine--tRNA ligase n=8 Tax=Archaea TaxID=2157 RepID=A0A2G9NGB8_9ARCH  ali  24  118.RHLWLRSRKMTSILKIRDTVLQGLREHWHKKGFYEYHSPSLLGMQ-------AEGGATLFKVDYFGKPLYLAQTWQLHAEPGI-FALEKIFTIQPSFRAE--KSKTSRHLTEYWHAEMESAWEDFEYLQDDAEEAIKEIVAEVLKKNKEELEIKKKFPRMSYDDVLKIWGKDLRTIEEYDTPIIVTRYPKAVKAFYMKEDPKNPKVVLPEGYGEIVGASQREESIEKLKENLIAQGEDPSKYEFYFDTRRYGSV-PHGGFGMGVERVISWICGLDTIKDAMPFPRTMTRYSP. 432
247 7.000e-95UniRef50_L1JKJ1 Aspartyl-tRNA synthetase n=2 Tax=Guillardia theta CCMP2712 TaxID=905079 RepID=L1JKJ1_GUITH  ali  23  176.RVLDLRSPSHNSIMRIQSHVGQAFRNFLAARGFVEIHTPKLQGGSSC------EGGAAVFPLDYFGSKAWLAQSPQLHKQMAVMSGFERVMEVGPVFRAES--SHTSRHLCEFVGLDFEMEIESYAEAMDIVEGFVVTLLEELLSSHVDEVAKQYPCKRLRCREAVDLLNDEIVAEKHETDFFFITDFPPFYSMPSSSDPSSSNSFDAYLRGQEICSGAQRIHDSSLLVESLKSRGIDPSSMQPYINSFKYGGS-PHAGAGLGLERLTMTILGLDNIRLASMFPRDPKRLSP. 490
248 7.000e-95UniRef50_H5SF90 Aspartate--tRNA(Asp/Asn) ligase n=6 Tax=Bacteria TaxID=2 RepID=H5SF90_9BACT  ali  21  119.RVLALRNPEIAAIFRVQAELIHGFREFLTHEGFLEVHTPKIVAS-------GTEGGTELFPVQYFERTAYLAQSPQFYKQMLVGAGFERVFEVGPVYRAEP--HSTTRHLNEYISLDIEMGFIESEDLLALEARLLRHIFARVQERCAKELAIPEKIPQITLAQAHEILHKRFHQEELGCELLFVTHYPKEKRPMYPENPALTRSFDLLYKGLEITTGGQRIHQYELLVESIKSRGLDPENFAFYLEVFKYG-MPPHGGFAIGAERLTMQLLNLSNVREASFFPRDRTR.... 429
249 8.000e-95UniRef50_A0A257B0R7 Asparagine--tRNA ligase n=18 Tax=Bacteria TaxID=2 RepID=A0A257B0R7_9BACT  ali  24  118.RHLWLRSRRQHAILRVRHEVVRAIRDFLDDDGFILADTPILT-------PAACEGTTTLFELDYFGDKAYLAQSGQLYNE-ATAAAFGKVYCFGPTFRAE--KSKTRRHLTEFWMVEPEVAYATLDDMMTLAERFLSFIVARVLDRRKEELKLLEPFPRLPYDEAVRMWGGDFGAPDEFDRPVIVHRYPGQVKAFYMEEDPERPEVALCMDVGEIIGGGQRMQSYDKLVERLAAHNLPREAFEWYLDLRKYGAV-PHAGFGMGVERCVAWLCGLEHVRETIPFPRMLYR.... 434
250 8.000e-95UniRef50_O74407 Aspartate--tRNA ligase, cytoplasmic n=5 Tax=Ascomycota TaxID=4890 RepID=SYDC_SCHPO  ali  22  241.RVLDLRTPTNQAIFDIQAGICQAFREFLLSNSFNEIHTPKMSGAS-------SEGGSNVFKIQYFKTDGFLSQSPQLYKQMLIAADRERVFEIGPVFRAED--SNTYRHMTEFTGLDLEMAFEHYHEVMEFIEKLFLYIFKTIREKYAKQVAPSEDFIRFHFKDAVKLLKEEKYHTDFYVIDKYPSSVRPFYTMPDPEDPRYSNSYDFFMKGQEIMSGAQRIHDPELLVERMKALGVSPDGLQQYIDAFAIG-CPPHAGGGIGLERVVMFYLNLPNIRLASSFPRDPKR.... 577
251 1.000e-94UniRef50_A0A1Y1YIA7 Asparaginyl-tRNA synthetase n=7 Tax=Fungi TaxID=4751 RepID=A0A1Y1YIA7_9FUNG  ali  19  253.RHLVIRGETASSILRARSSIQKAFRDHFYSRGYSEVVPP-------CMVQTQVEGGSTLFEFNYYGESAYLTQSSQLYLETCLP-ALGDVYCMSESFRAE--KSHTRRHLSEYTHLEAEMAFIDFDDLLNRIEDLVCDTIDRVKSLNPDFKPPQRPFLRMDYTEAIEWLREERQMTDKIGRPILLCRFPVEIKSFYMKKDKVDPRDLLMPGVGEIVGGSMRISDLDELLAGYKREGIDPTPYYWFSDQRKYGSCE-HGGYGLGVERFLAWILNRYTVREVCLYPRFTGRCKP. 569
252 1.000e-94UniRef50_A0A1C6BKL2 Multifunctional fusion protein n=17 Tax=Ruminococcaceae TaxID=541000 RepID=A0A1C6BKL2_9FIRM  ali  23  650.....LRNPYERAIFKLQEGLVQGMHKFMQANNFTEIHSP-------KIVAQGAEGGANIFRLDYFGKSAFLNQSPQFYKQMAVAF-FDRVYEIAPVYRAE--KHATSRHINEYIGLDFEMGYIDMYDVMKMEIAMLKSIFEYIKENYQNELKILKEVPSIKFADAIELLGEKYAKEKYDSDFIFVTHFPSSKPPFYAMDPREAYKFDLLFRGLEITSGGQRIHDYNEQVEKMKAQGLDPADFKNYLEAHKYG-LPPHGGLGIGLERLLMKLLNKNNIRETSLFPRDINR.... 954
253 1.000e-94UniRef50_UPI000D7FDFEC aspartyl-tRNA synthetase n=1 Tax=Acaromyces ingoldii TaxID=215250 RepID=UPI000D7FDFEC  ali  20  359.RVLDLRTPYSQAIFRVQSATCRAFRNFLDDHDFIEIHTPKLL-------GGASESGASVFPVDYFGRSAFLAQSPQLMKQMCIVADFNRVFEIGPVFRAEN--SNTHRHLTEYTGLDLEMALGDYHEAMDIIDEMLKSMFTYINRRYPKEVELLKSFPVLDYAEGIQMLNEDLVKEKYGTDYYILDKFPASVRPFYTMPAPASNSFDIFVRGQEIISGSQRVHQAEELIAALKKQGVDIKGVQEYVDSFKL-AAPAHAGCGIGLERFVMLFLGLDDIRNASLFPRDPK..... 682
254 1.000e-94UniRef50_Q9P6I0 Asparagine--tRNA ligase, mitochondrial n=3 Tax=Schizosaccharomyces TaxID=4895 RepID=SYNM_SCHPO  ali  20  122IPHLRLRTAKQGEIFRLRSDSLKALRQFFSSKDFTETNPPIITSS----DCEGAGEVFTLTPQHFFDRPAFLTVSTQLHLE-ALALGLSRVYTISPAFRAE--QSHTSRHLAEFWMLEAEVAFMTLSQLTSLMEDMIKYTLNSLMEQNDHWDQLLKPWKCMTYSEAIEKWGNDLSSEHEHKTPVFVTDYPQKIKPFYMKPDTVAAVDLLVPQVGELAGGSLRKDHLDEYKT-------YPPELQWYLDLMKYSNA-PHGGFGLGIERLIAFLEGENNVKETIPFPRSVGSI... 439
255 2.000e-94UniRef50_A0A0G0FG60 Aspartate--tRNA(Asp/Asn) ligase n=17 Tax=root TaxID=1 RepID=A0A0G0FG60_9BACT  ali  20  128.RNLALRNRKVNDIFKVYSQILKSYGDVMREKGFLEIKTPKILSA-------ATEGGANFFKIKYFKREAFLAQSPQFYKQ-AGVGAFERVFEIGTVFRAEP--HFTTRHVNEYTGLDAEMGFINFSEIMDELEAVMKRIIKDVKEKCPKELEPEESFPRIRLTEALEILKKEWAKKTHGSDFIFITHYPANAKPFYTMDPQFTEGFDLLFNGVEIATGSQRIHNYQQLVANIKKHGLNPEDFKDYLEVFKIG-MPAHGGWGLGSERIVQKILGIASIKEAILFPRDVKRLAP. 441
256 2.000e-94UniRef50_A0A2A4U487 Asparagine--tRNA ligase n=1 Tax=Thiotrichales bacterium TaxID=2026796 RepID=A0A2A4U487_9GAMM  ali  21  123..HLRARTNIFGAITRVRHTVANIIHNFFHNEGFFWINTPIITS----NDCEGAGELFSISTLDFFSKESFLTVSGQLCLESY-CLAMSKVYTFGPTFRAEN--SNTSRHLAEFWMIEPEIAFADLQMDVQLADKLLRHVTKTVLQECQEDMQFFNQWEVIEYKDAIKHYGKDLQSEHEFDAPIAIINYPKNIKAFYMRDQTVAAMDIIVPGIGEIIGGAQREERMDVLDARMQECNVNAKDLAWYKDLRRYGTV-PHAGFGLGFERLLGYLTGVANVRDLIPFPRTPGNI... 455
257 2.000e-94UniRef50_A0A0N1IGH0 Putative asparaginyl-tRNA synthetase, mitochondrial n=7 Tax=Obtectomera TaxID=104431 RepID=A0A0N1IGH0_PAPMA  ali  22  139..HLRCRTNYISALLRIRNAVSKHIHNYFDTKNYLHIHTPILTS----NDCEGAGEVFKVLPDNYFGSKTFLTVSGQLHLE-AMCRGLGNVYTLGPTFRAENSRS--RLHLSEFYMLEAELAFCNLEDLQSSIEDLLKYIFIETRNTNEDDLWLDKKFITITYTEAKDILGINKEQEHCDNVPVFIVRWPKEQKSFYMDNTKVEALDLLAPITGEIVGGSLREDDYKKL-----KLKLPSEALNWYLELRKFGNI-PTGGYGLGLERLLQVLCSVPNIKDTLPFPRWPHNCDM. 465
258 2.000e-94UniRef50_UPI000D386DC1 asparagine--tRNA ligase n=1 Tax=Candidatus Similichlamydia epinepheli TaxID=1903953 RepID=UPI000D386DC1  ali  23  118IAHLRSRSKSICAIMRLRHALTMATHNFFSERGFLHLATPILTPT----DCEGGCDLFQVEKKNFFDHPAYLTVSGQLNAE-AFACGIGPVYTFGPTFRAE--HSTTPRHLAEFWMIEPEVPFADMQDMMKLSEDYLRFLALWCLDKCEEELLFQESFCKISYGEAIKIWGIDLQTEHYSKKPTIVFDFPESLKAFYMRINEDGNTDVLLPRIGEVIGGSQREDRLHYLEERMKNKGISHQSHDWYLDLRRFASI-PHSGFGAGFERIIRWITGVENIRETIPFPRSPG..... 442
259 2.000e-94UniRef50_A0A151BCL0 Aspartate--tRNA(Asp/Asn) ligase n=9 Tax=root TaxID=1 RepID=A0A151BCL0_9ARCH  ali  23  129IRAVDLRRPTAQAVFKIRHQVLQAIRSFLVEKGFIEVNTP-------KIIGSATEGGAALFPLLYYDKEAFLAQSPQLYKEQL-SSAFERVFEIGPVFRAEKFK--TPRHLSEITSVDVEMAFADYEDVMKLLEEMIHRAITDVLDKCSEELKALEPLKRLTYNEAYKTWGEDFSTPELNPGFYFITDWPTVSKPFYIDNPRLSESFDLMHGSLELASGGSRVSSRDLLARRLRRQGLNPKLFEYHLRVYEYG-MPPHAGFGLGLERFMMAITGISNIREVTLFPRDQTR.... 434
260 2.000e-94UniRef50_A0A1Q7MID6 Aspartate--tRNA(Asp) ligase n=11 Tax=Archaea TaxID=2157 RepID=A0A1Q7MID6_9CREN  ali  24  126.RFLDFRNEESNAIFKIQSKILQTFREFFATRHYVEIQPPVIIAS-------ASEGGAELFSLKYFEKDAYLAQSPQLYKQMCAIS-FEKVFTVLPVFRAEKFEQPT--HLNEVRQMDIEQSFSTDEDVMKVLEEFLAECIKKISASSSEELELQLPLTRVQYKDAIELLGSDFSKTQEKKEAFFIIDWPSEQKAFYAMPSKTSRAFDLIYRGLEIASGTQRIHLPTLLIQQLKSKGLNPENFKSYVDSFRYG-APPHAGWSIGLERLTMKMTGRENIRETTMFPRDRNRLSP. 433
261 2.000e-94UniRef50_A0A0H3J5S2 Aspartate--tRNA(Asp/Asn) ligase n=5 Tax=Clostridium TaxID=1485 RepID=A0A0H3J5S2_CLOPA  ali  22  117.RTISLRAPKITAVFKVQEKIADAFKDYLKGQNFTEVYTPKIIAS-------GTEGGSELFTVNYFDHRAFLAQSPQFYKQMMVGSGFERIFEIGHAYRAE--LHNTYRHLNEYVSLDLEMGFIEDEEIMDLEEGFMNYLFKYIKKECSAELKLEVKIPRITLFDAQEIYGKEYVKKEYGSDFVFLTKYPAAKRPMYTMPDDETRSFDLIYKGLEITTGGQRIHDYEELVANIAKMGFKTEEFEFYTDNFRYG-MPPHGGLAIGLERLTMKILGLDNIREAALLPRDMKRI... 428
262 2.000e-94UniRef50_A0A0G0QL26 Aspartate--tRNA(Asp/Asn) ligase n=27 Tax=Parcubacteria group TaxID=1794811 RepID=A0A0G0QL26_9BACT  ali  22  133.RYLDLRRQRMAKNMTKRHELILFIRNWLDKVGFLEVETPILT----KSTPEGARDYVVPSRL-YPGKFFALPQSPQQYKQLLMASGIEKYFQIARCFRDEDTRGD---RQPEFTQMDLEMSFVKREDVMEVNEKLLIDLVHQLY----PEKEIQEPFPRISYKDAMEKYDIDRPDMRKDKGFCWVIDFPDDLMNKKDVGDIITTQYDIVLNGWEIGGGSIRNHKAEALEAVFEIMGFEKENFGHMLEAFRFGT-PPHGGIAWGIDRLLTLLHQEPNIREVMAFPKTGDARDLL 448
263 2.000e-94UniRef50_A0A1Y2TKP2 Aspartyl-tRNA synthetase n=3 Tax=Hypoxylaceae TaxID=2033035 RepID=A0A1Y2TKP2_9PEZI  ali  20  242.RLIFIRTPVMQSVFRIRSGICNIFRNTLEEQGFIEIQTPKLQ-------PAATESGASVFRVNYFGRTAFLAQSPQLAKQMAVSADLGRVFEIGPVFRAED--SNTHRHLTEYTGLDIEMAIHDYHEALDIIDDLLKSIFKGIYARYRKELDIKTKFPRLTFKEGVQLLNSEKYGTDYFILDKFPASARPFYTHLDPNDETVTNSFDIFLRGQEITTGGQRIHNPRLLVERMKKAGVDPDGMEEYMQAFEWG-APPHAGCGIGLERVLFLLLNLGDVRNATLFPRDPK..... 562
264 2.000e-94UniRef50_A0A066V5Z6 Uncharacterized protein (Fragment) n=4 Tax=Opisthokonta TaxID=33154 RepID=A0A066V5Z6_9HOMO  ali  19  95.RHLLLRGETASAVLRVRSGILSAFRHTFAKHSLLEVTPPCL-------VQTQVEGGATLFKLDYYGQPAFLTQSSQLYLETCLPS-LGDVFCVQESFRAEN--SHTRRHLSEFTHLEAELAFITFDDLMTHIEAVICETVDILLEDHPKFEKPKRPFMRMNYKDAIKYLVEERQMTDQLNVPVFLYGFPKELKSFYMKKIPGDECDLLMPNVGEIVGGSMRIADMQELLEGYKREGIDPSPYYWFTDQRKYGTCE-HGGYGLGVERLLAWLTNRFTVRECSLYPRWPGRAAP. 416
265 2.000e-94UniRef50_A0A1W2TE75 Putative aspartyl-tRNA synthetase n=9 Tax=Fungi TaxID=4751 RepID=A0A1W2TE75_ROSNE  ali  18  246.....LRTPVMQSVFRIRSGICNIFRTTLDEQGFLEIQTPKLQ-------PAATESGASVFPVKYFGRTAYLAQSPQLAKQMAISADFGRVYEIGPVFRAED--SNTHRHLTEYTGLDLEMAILDYHEAMDIIDAMLKAIFKGIYARYRKEIEIKEKFPRLTFEEGVRLLNKEKYKTDYFILDKFPASARPFYTHLDNNNENVTNSFDIFLRGQEITTGGQRINNPRLLKERMTKAGVDPETMEEYMQAFEWG-APPHAGCGIGLERVLFLMLNLGDVRNASMFPRDPK..... 562
266 2.000e-94UniRef50_P38707 Asparagine--tRNA ligase, cytoplasmic n=144 Tax=Eukaryota TaxID=2759 RepID=SYNC_YEAST  ali  17  238.RHLALRGDALSAVMKVRAALLKSVRRVYDEEHLTEVTPP-------CMVQTQVEGGSTLFKMNYYGEEAYLTQSSQLYLETCLAS-LGDVYTIQESFRAE--KSHTRRHLSEYTHIEAELAFLTFDDLLQHIETLIVKSVQYVLEDNPNFKAPKAPFMRLQYKDAITWLNEERKMTDTIGVPIFLTRFPVEIKSFYMKRCSDDPRDVLMPNVGEITGGSMRIDDMDELMAGFKREGIDTDAYYWFIDQRKYGTC-PHGGYGIGTERILAWLCDRFTVRDCSLYPRFSGRCKP. 554
267 2.000e-94UniRef50_A0A1W9QLW0 Asparagine--tRNA ligase n=2 Tax=Parcubacteria group TaxID=1794811 RepID=A0A1W9QLW0_9BACT  ali  23  117.RHLWLRGKKQWAVQNVRNEIIKATYNFLWQNDFIKIDAPILT-------PTSCEDTTTLFELKYFNGKAYLSQSGQLYIEAGIVS-HNKVFDFGPTFRAE--KSKTRKHLTEFWMMDAEMAFVEHKENMEIQEKLISYIIKHIXXXXXXXXXXKPPFERITYKKAVKKFGEDFGAKDESKVPVFVEKWPKNSKAFYMKTDSQNPNLVLPEGYGEIIGGSQREDDYETLKKRMIKEKIPIKKFQWYLDLRKYGSV-PHSGFGYGLERLTGWICGCKHIREAIPFPRLINR.... 427
268 3.000e-94UniRef50_A0A1G2CMK3 Aspartate--tRNA(Asp/Asn) ligase n=16 Tax=cellular organisms TaxID=131567 RepID=A0A1G2CMK3_9BACT  ali  24  123.RYLDLRRERMQRNIRLRHEVSQFMRSYLTERGFWEIETPMLT----KSTPEGARDFLVPSRLQP-GKFYALPQSPQQYKQLLMVAGFEKYFQIARCFRDEDPRAD--RAYGEFTQLDLEMSFVTQEDILALAEDLFTKLVEKV---FPDKHISQSPWPRISHKEAKAKYGSDKPDLRKEKNFAWVVDFPKFAPSHHMFTAPHPDDIDLVLNGYEVGGGSIRIHERDIQEKIFNLIGFDEHQFTHMLEAFTYG-VPPHGGIAPGLDRFLFAVLGEKSIREVMAFPASAGGQ... 442
269 3.000e-94UniRef50_A0A1D7YJM6 Aspartate--tRNA ligase n=8 Tax=Bacteria TaxID=2 RepID=A0A1D7YJM6_9ACTN  ali  21  123.RFLDIRRPAAQSLFAVQTTLEQGMREYAYGQGCTEMHTPKLM-------GTASESGAEVFELGYFGRSAYLAQSPQFFKQMAIAAGIDRVFEVGPVFRAEP--SFTSRHATEFTGVDVELAWIDVEDVMAFEERMLAHAISRVADAHGEAIVPTVPFPRITMAVAQELLKEDLDPEHMGHAWVFVTHYPTSVRPFYHMRPADNPSFDLLWQGLEVTTGAQREHRYDVLVKQAAAKGLRPEPMQDYLNVFRYG-CPPHGGLGMGLSRVLMVLLGLDSIREATFLFRGPNRLAP. 440
270 3.000e-94UniRef50_A0A1J1HJL7 CLUMA_CG002012, isoform A n=1 Tax=Clunio marinus TaxID=568069 RepID=A0A1J1HJL7_9DIPT  ali  18 1106.RVLDLRTPANQAIFRLEAGVCKLFRDILAAKGFVEIHTPKIISA-------ASEGGANVFTVSYFKESAYLAQSPQLYKQMAIAADFDRVFTVGAVFRAED--SNTHRHLTEFVGLDLEMAFYHYHEVLDTIGNTFTEMFKGLRDNYANEIKFLEPPLRLEFHQGVQMLGDEKYDTDFYILDKFPLAIRPFYTMPDPNNPKYSNSYDMFMRGEEILSGAQRIHDPEYLVERAKHHEIDISKIAAYIEAFRFG-CPPHAGGGIGMERVVMLYLGLDNIRKTSMFPRDPKR.... 1421
271 3.000e-94UniRef50_A0A256Y3N2 Aspartate--tRNA ligase n=1 Tax=Candidatus Aenigmarchaeota archaeon ex4484_52 TaxID=2012504 RepID=A0A256Y3N2_9ARCH  ali  19  124.RYLDLRNQKTLAIFKIQAQIMQSFRQFMISNDFYEFNSPGIISSS-------SEGGADLFSLLYYQKEAFLAQSPQLYKQMAAIGGMERVFTISRIWRAEV--SNTIKHLSESRQMDAEACFFDWSDAINLLCEVFCYIVKDINKKCKTELEILNEIPKIEYTEAIKILQKNKIDIKFGNKPIIVKKWPAFYSMPDEKDKKFSKSYDLLFGGMELASGAERIHIPELLEQKLKEKQMDIENFKSYIKSFRYG-APPHSGWSIGLERFTMTLCNLSNIREATLFPRDTERI... 432
272 3.000e-94UniRef50_J7S2B7 Uncharacterized protein n=16 Tax=Fungi TaxID=4751 RepID=J7S2B7_KAZNA  ali  17  242.RHLALRGETLSGVMKVRAALLRAIRRVYVEEGLTEVTPP-------CMVQTQVEGGSTLFKLDYYGEEAFLTQSSQLYLETCLP-ALGDVYCVQESFRAE--KSHTRRHLSEYTHIEAELAFLTFEELLEHIETLLVKSVKYVLEDNPDFVPPQAPFKRLEYKDAIEWLREHQILNEEGKEFEFLTKFPVEIKSFYMPRCKDDPRDVLMPTVGEITGGSMRINNIEELMAGFKREGIDPKPYYWFIDQRKYGTC-PHGGYGLGTERILAWLCNRYTVRDCSLYPRFSGRCKP. 558
273 3.000e-94UniRef50_A0A0H6QNI0 Asparaginyl-tRNA synthetase n=24 Tax=root TaxID=1 RepID=A0A0H6QNI0_VIBCL  ali  22  14VAHLRPRTNVIGAVARVRNCLAQAIHRFYHEQGYFWVSAPLITAS----DAEGAGEMFRVSTLDFFGKETFLTVSGQLNAEAY-ACAISKVYTFGPTFRAXXXXXNTSRHLAEFWMVEPEVAFADLNTVAKLAEDMLKYVFKAVLAERRDDLEFESDFAQVDYTDAIEILHERFLAEEHFKAPVIVKNYPKDIKAFYMRMNEDAAMDVLAPGIGEIIGGSQREERLDILDARMREFGIDPEHMDWYRDLRRYGTV-PHAGFGLGFERLVSYVTGMGNVRDVIPFPRTPRSAS.. 360
274 3.000e-94UniRef50_UPI00094CF308 asparagine--tRNA ligase n=3 Tax=Buchnera aphidicola TaxID=9 RepID=UPI00094CF308  ali  22  126..HLRSRTNLFGAITRIRNVAFHAAHNFLYKKQYFWISTPIITSINT----EGAGSMFKVSMLEFFNKKVFLTVSGQLTLEAY-ACALSKVYSFGPTFRAEN--SNTKRHLAEFWMLEVETAFANIDDISKFSEKLLKYIISTVLKNSLVDLLFLQPFININYSDAIKIWGNDLSIEKYFKRPIIIRNYPKSLKAFYMRNRTVSAIDVLIPLVGEIIGGSEREERLPLLKKRINEMGLNKNDYIWYQELRKYGTV-PHAGFGLGFERLVMYITGIKNIREAIPFPRTAKNAD.. 465
275 3.000e-94UniRef50_A0A2H9LDX4 Asparagine--tRNA ligase n=1 Tax=Candidatus Diapherotrites archaeon CG08_land_8_20_14_0_20_34_12 TaxID=1974404 RepID=A0A2H9LDX4_9A  ali  21  116VRHLWIRSSKISNALKVRATVFEAFREFMKENNFTETSGPMFVS-------GSVEGGSTLFKVPYFDKTVYLTQSSQFYLEVMMYS-LGNCYTIAPSFRAE--KSRTPRHLTEFWHAEAEMPWAGLEDIIDLEERMLKYMVEKVVTDREKELVINKKFHRMTYEEAVKEIKEEREFTKDLDRPIILTHYPTSLKPFYHRADPKDPMHVLPEGYGEIIGSGERCWNTEELIERIKKDKLPLEPYQWYIDLRKYGSV-PHAGFGMGLERFTSWLCKAQTIRDVVPIPRTITR.... 427
276 4.000e-94UniRef50_A0A0D2YJM3 Aspartyl-tRNA synthetase n=4 Tax=Dikarya TaxID=451864 RepID=A0A0D2YJM3_FUSO4  ali  20  177.RILDLRHPSNQALFRLRSLVSRAFRNTLEEHGFVEIHTPKLQ-------PAATESGAAVFPVSYFDRRAFLAQSPQLAKQMSISADFGRVFEVGPVFRAEN--SNTHRHLTEYTGLDLEMAITDYHEVIQLIDIFLKEVFKAVKRWPSSEFRWLDETPIIPFREGIKMLREDKYGTDYYVLDKFPANARPFYAAKDPEDPKWTRSFDIFIRGQEICSGGQRIHNAEELRANMVAAGMSEDGMEDYLIAFDLG-VPPHAGAGLGLERIVSWMLELGDVRYASLFHRDPK..... 488
277 4.000e-94UniRef50_A0A2J7Q1S2 Aspartate--tRNA ligase, cytoplasmic n=2 Tax=Bilateria TaxID=33213 RepID=A0A2J7Q1S2_9NEOP  ali  19  39.RVLDLRTPANQAIFRLEAGVCRLFRDILTEKGFVEIHTP-------KIIPAASEGGANVFTVSYFKGSAYLAQSPQLYKQMAIAADFDKVFTIGAVFRAED--SNTHRHLTEFVGLDLEMAFYHYHEVLHTIGDTFTLMFKGLRDRYADEIASVEPFKQLEFPTAVAMLGDEKYDTDFYILDKYPLAVRPFYTMPDPKDSKRSNSYDIFMRGEEIMSGAQRIHDAEFLTERAKAHDIDLEKIRSYIDAFRFG-CAPHAGGGIGLERVVMLYLGLDNIRKTSMFPRDPKRI... 355
278 4.000e-94UniRef50_A0A2G9NKA2 Aspartate--tRNA ligase n=120 Tax=cellular organisms TaxID=131567 RepID=A0A2G9NKA2_9ARCH  ali  23  117.RHIDLRDPKKFLIFKTQTTAEQAMREFWINNGFVEIHSPKL-------VAGASESGAELFQLDYFGTVASLAQSPQFYKQMAMAAGFDRVFEIGPVFRA--NKSHTSRHDTEFTSVDMELSWIDHEDVMAMEERWIEYFMTEVQRKHGEELVPRVPFPRVTMEEAYSILKSDKKKENHNHEFVLVTDYPASVRPFYHMNPEITKSFDLIWKGTEVTTGAQREHRYDRLVNQIEEKGIDPKSLRSYTEFFKHG-CPPHGGCGFGLTRMLMNITGEKSVKEVTFVYRGPNRI... 432
279 4.000e-94UniRef50_A0A1W2TQX8 Putative asparaginyl-tRNA synthetase n=5 Tax=leotiomyceta TaxID=716546 RepID=A0A1W2TQX8_ROSNE  ali  21  149LPHLRPRTPFNSTVLRFRSEIIASLTSFFNARQFIQTHTPILTAS----DCEGAGEVFQVVTEHFFRRPIYTTVSSQLHLE-ALSQALGNVWTLSPTFRAE--QSDTPRHLSEFYMLEAELSFTDSQSVMDLVEDMLKYVASDLSDSKGELLNPLGDWPRITYTEAIKLWGEDLRTEHEGCSPVFVTDYPRDIKPFYMKAAETDCFDLLVPDFCEIAGGSMREHRLQNLVESMRVHGFDPNNLDWYVDLRRWG-CPPHGGFGLGFDRLICYLTGVPTIHDTAAFPRWYGRCDC. 518
280 5.000e-94UniRef50_D6GUX5 Asparaginyl-tRNA synthetase n=2 Tax=Candidatus Parvarchaeum TaxID=662758 RepID=D6GUX5_PARA5  ali  23  115.RHLWIRSPKTTAIMKIRSTVFSSIHEFFSSMNFYEIQSPSF-------VGGSVEGGATLFETQYFNRKAYLTQSWQLYAE-AMVDSLWKIYTVAPSFRAE--KSRTWRHLTEFWHAEAEVAFKTNDDVMDLEEKLIKFVIKNVLSKNEDDLKVSKPFLRMKYEEVIDLYGEERVITSKLDVPIFSIDYPIELKPFYHKPNPKDPKHVLPEGYGEIIGGGQRVDDKETLLKRLKEEKLNEKDYEWYIDLRRYGAI-PHSGFGLGVDRLVMWICKLPHIMYGVPFPRTPRRLNP. 428
281 5.000e-94UniRef50_A0A060HLS2 Aspartate--tRNA(Asp) ligase n=57 Tax=Thaumarchaeota TaxID=651137 RepID=A0A060HLS2_9ARCH  ali  21  122.RALDLRNPKTAAIFHLRSAGLKVVRDTLRGEGFVEVNTP-------KIIGSASEGGANLFGFDYFKRKAYLAQSPQLYKEQL-TLGLDRVFEIGPYFRAEN--SHTVRHLTEFTSIDVEAAFLDYEDVMDLVEKVVGNVIRDFNENHRVELEIPKKIDRLTYEQCLDELVKEGEKLSFGDDFYFIMDWPLKLKPFYIHEKEGNEKFDLQHGYLELVSGGRRLHDPERLRSRLVEQGLNPASFSEHLKAFDWG-MPPHSGWGLGYDRLMMVLTGSQNVRDVVLYPRDTDR.... 428
282 6.000e-94UniRef50_UPI0007EE7B3A probable asparagine--tRNA ligase, mitochondrial isoform X3 n=6 Tax=Boreoeutheria TaxID=1437010 RepID=UPI0007EE7B3A  ali  21  143.PHLRCRTNVLGSILRVRSEATAAIHSFFKDRGFVHIHTPVITS----NDCEGAGELFQVEEGNFFDVPTFLTVSGQLHLEV-MSGAFAQVFTFGPTFRAENSQS--RRHLAEFYMVEAEISFINLQDLTQIMEDLFKSTAMMVLSNCPEDVELCHKFPGKKWGADLQTEHEKYLVEHCGNIPVFIINYPLALKPFYMRDNEDGPQDLLVPGVGELFGGSLREERYHFLEQQLARSGLT-EAYQWYLELRRFGSV-PHGGFGMGFERYLQCILGVDNIKDVIPFPRFTHSCLL. 442
283 6.000e-94UniRef50_A0A2N2P022 Aspartate--tRNA ligase n=142 Tax=Bacteria TaxID=2 RepID=A0A2N2P022_9CHLR  ali  20  124.RYMDLRRTENLLLFRVQTTMEMALREFWIQHGFMEMHSPKLMGS-------PSESGAELFALPYFETKAYLAQSPQFYKQMAMAAGWEGVFEIGPVFRADP--SFTSRHMTEFTSVDMEMSWVSEEDVMDNQERMLQHAYQRVKEVHGAEIVPSVPFPRLTMSEAHEILKKDYIKQTTGSDFVYITEWPFAARPFYHMKKNLTRSFDLIGGGLELCTGAQREHRYDVLLEQAKEKGLGAEPIQFYLDFFRYG-CPPHGGYAIGLSRLLMVMLKLPNIRETVYLFRGPNRLHP. 439
284 7.000e-94UniRef50_D5G534 Uncharacterized protein n=6 Tax=Pezizomycotina TaxID=147538 RepID=D5G534_TUBMM  ali  22  148..HLRQRIPANTNLLHLRSNIISTLTAFFVEHSFIQCHTPIITSS----DCEGAGEVFAIVPEKFFNTPKYLTVSGQLHLE-ALAAAVPRVWTLSPSFRAE--KSGTTRHLSEFYMLEVEAAFIDLDPLVALIEDMVKTIVRSISEDKAVQLELERPWSRITYTEAISRLGERFLAQTVFNGPVFVTDYPKSLKPFYMLPSVSTCFDLLVPAVGELIGGSLREYRYDELLTEMRRHGIDEGSLRWYLELRKWGSTR-HGGFGLGLDRLVCYLAGVENIREATAFPRWVGRCDC. 492
285 8.000e-94UniRef50_A0A1F5WD00 Aspartate--tRNA(Asp/Asn) ligase n=8 Tax=Parcubacteria group TaxID=1794811 RepID=A0A1F5WD00_9BACT  ali  23  123.RWIDLRKPEKALIFKIWTTMEQAFRNYCIENGFVEIHSPKLT-------ATATESGSELFEVKYFDRKAHLAQSPQLYKQMAMAAGFEKIFEVGPVFRANP--SFTSRHDTEFTMYDVEISFISHHDLMDEEEKMIVAMLKAVKEKYGEEIQPKIPFPRLAVKEAKEILGDDYIKKETGSEFVFIHDFPAFYSMRKEDDPSVTKSFDLLWNGLEITSGAQREHRVEQLEKQIKEQGLDPKSFRTYINFFRYG-CPPHGGFAPGPTRMLMKLLNIANVREVTYLYRGVRRLEP. 438
286 8.000e-94UniRef50_P54263 Asparagine--tRNA ligase n=1763 Tax=root TaxID=1 RepID=SYN_THET8  ali  26  118.RHLWLRHRRPFAVMRIRDELERAIHEFFGERGFLRFDAPILTPS-------AVEGTTELFEVELFGEKAYLSQSGQLYAE-AGALAFAKVYTFGPTFRAE--RSKTRRHLLEFWMVEPEVAFMTHEENMALQEELVSFLVARVLERRSRELEMLGRYPRLTYKEAVALYGEDFGAPHEFDRPVFVERYPARIKAFYMEPDPEDPELVLPEGYGEIIGGSQRIHDLELLRRKIQEFGLPEEVYDWYLDLRRFGSV-PHSGFGLGLERTVAWICGLAHVREAIPFPRMYTR.... 435
287 8.000e-94UniRef50_A0A2C9JJK9 Uncharacterized protein n=9 Tax=Eukaryota TaxID=2759 RepID=A0A2C9JJK9_BIOGL  ali  22  234.RHMMIRGENTAKILKMRSVIVHCFREHFFDRGYFELTPPTI-------VQTQVEGGSTLFKLNYFGEEAYLTQSSQLYLETAIP-AMGDVFCMAQSYRAEV--SKTRRHLAEYTHCEAECPFITYEKLLDKIEDLVCDVVDRVLELNPDFKPPKKPFRRMDYTDAIVWLKEERKMTDTINEPIMLCRFPAEIKSFYMPRCKEDNRDLLMPNVGEIVGGSMRIWRQEELEAGFKREGIDTSPYYWYFDQTKYGSC-PHGGYGLGVERFLCWILNRYHIREVCAYPRFVGRCKP. 549
288 8.000e-94UniRef50_U2NKQ4 Aspartate--tRNA(Asp/Asn) ligase n=117 Tax=Terrabacteria group TaxID=1783272 RepID=U2NKQ4_9CLOT  ali  21  116.RSLSLRSPKTRAVFKIQEEIGDAFRTYLKDLRFSEIHTPKIISSST-------EGGSEMFTVNYFNKRAFLSQSPQFYKQMMVGAGFERVFEVGHAYRAE--LHGTWRHLSEYVSLDVEMGFIEDEEVMDLEEGFLNYLFKTLKEKCPKELQMKLEIPRMPLAKAQEILLEKYIKETYDCDFVFLTEYPVSKRPMYAMRPELTKSFDLIYKGLEITTGGQRIHDYDMLAANIRKFGLNPEDFGFYLDSFKYG-MPPHGGFAIGLERLTLKILDLENIREATLLPRDLKRLEP. 429
289 9.000e-94UniRef50_A0A2A3E7U9 Aspartyl-tRNA synthetase, cytoplasmic n=2 Tax=Apis TaxID=7459 RepID=A0A2A3E7U9_APICC  ali  20  215.RVLDLRTPANQAIYRVEAAICKLFRDILTNKGFVEIHTPKIISA-------ASEGGANVFTVSYFKGNAYLAQSPQLYKQMAIAADFDKVFTVGAVFRAED--SNTHRHLTEFVGLDLEMAFYHYHEVVETIGQLFVEIFKGLRNNYAAEIEAVRPFKKLEYSDAIEILGEEKYDTDFYILDKYPLIVRPFYTMPDPNNPKLSNSYDMFMRGEEIISGAQRIHDPELLTERAKYHGIDLEKIKSYIDAFKYG-CPPHAGGGIGMERVVMLYLGLDNIRKRYQYPKMTTSKSLI 534
290 9.000e-94UniRef50_A0A0B7FT38 Aspartyl-tRNA synthetase n=47 Tax=Opisthokonta TaxID=33154 RepID=A0A0B7FT38_THACB  ali  18  223.RVLDLRTQTSQSIFVMQSAVTDLFRQSLQAKGFIEIHSPKLQ-------GAATESGASVFKVDYFKGNAFLAQSPQLAKQMAIGADFERVYEIGPVFRAEN--SFTHRHLTEFTGLDLEMTIEHYHEVVDVLDSMLLHIFNGLKTKFSDDIEWLEKTLRLQWKDGIALLREEKYNTDYYILDKFPLALRPFYTMPDPVDPNYSNSYDFFMRGEEILSGAQRVHDTKMLEKRMIEVGIKPEDMQGYLDGFRMGIA-PHGGGGIGLERVVMLFLKLGNIRNASLFPRDPKRLEP. 541
291 9.000e-94UniRef50_A0A1W9SB19 Aspartate--tRNA ligase n=5 Tax=root TaxID=1 RepID=A0A1W9SB19_9BACT  ali  21  124.RFLDLRIERNYLIFKAQTIAEMAMREYWVNHNFIEIHSP-------KILGTASESGAEVFSLDYFGKKVYLAQSPQFYKQMAMAAGFNNVFEIGPVFRAEN--SHTAYHATEFTSVDCEISWINHHDVMDLEEAVLVYTMKKLKKEYKKEIKIPTTFPRITFKEAKKIIQEDFDRKEENSDFVFITEYPFEARPFYHMLDETTKSFDLLYKGIEITTGAQREHRIDILMKQAKEKGLSEESLEFYFKFFRYG-MPPHGGYGFGLNRFLMQLFEIDNIRDVTFLYRGPNRVNP. 438
292 1.000e-93UniRef50_A0A1V5YYX7 Asparagine--tRNA ligase n=7 Tax=Bacteria TaxID=2 RepID=A0A1V5YYX7_9BACT  ali  24  4.RHLWLRSSRQQAILRIRAELIRQIRAYFDANGFLLLDAPIFTPS-------ACEGTTTLFETDYVGSKAYLTQSGQLYME-AGAAAFGRVYCFGPTFRAE--KSKTRRHLTEFWMVEPEVAHIGLDEDMDLAEDFLVSIVQGVXXXXXXXXXXQKPFARISYTEAVERWGEDFGGDEEFDRPVMIHRYPAECKAFYMKTDPDDLKCALCVDVGEIIGGGQREDDYDTLLKKIRTHGLSEEAFGWYLDLRRYGTV-PHAGFGLGVERTLGWICGLPHVRETIPFPRLMQRV... 315
293 1.000e-93UniRef50_A0A1Y5IA86 Uncharacterized protein n=1 Tax=Ostreococcus tauri TaxID=70448 RepID=A0A1Y5IA86_OSTTA  ali  19  600.RVLDLRTPANNAIFKIQSGVGTLFREALLRRNFTEIHTPKLI-------AGASEGGAAVFRLDYMKGPACLAQSPQLYKQMAIMGDLEGVFEIGPVFRAED--SNTHRHLCEFTGLDMEMSIEHYDEVLDVLDELFVSMFDGLNERFAREIGVQYPFERLTFAEGVKMLQDKLVKEKYGTDFYMLTRYPPFYTMPAPDDPNYTNSFDIFIRGQEIISGAQRIHDPKLLAERALACGIELPTIQSYIDSFKYG-ATPHGGCGVGLERVAMLFLDLNNIRKTSMFPRDPKRIAP. 919
294 1.000e-93UniRef50_A0A261XWV8 Uncharacterized protein (Fragment) n=1 Tax=Bifiguratus adelaidae TaxID=1938954 RepID=A0A261XWV8_9FUNG  ali  19 1651.RIVDLRTPVSQAIFRVNAGICTLFRSYLEGHDFIEIHTPKLQAS-------ATESGSSVFQVNYFGREAFLAQSPQLSKQMCIAADFGKVYEIGPVFRAEN--SNTHRHLTEYTGLDLEMTIGHYHEAMELIDDMLKSVFAGIHKRYAQDIVWLEETPRLSFTEGVRLLHDEKYGTDYYILDKFPASARPFYTMLDPENPKFTNSFDIFLRGQEILTGGQRIHDPKMLEQRMRESGVRPETMEEYMNGFRWG-APPHAGAGIGLERLVMLMLGLGNIRLGSLFPRDPK..... 1971
295 1.000e-93UniRef50_A0A2D6PAY1 Aspartate--tRNA(Asp/Asn) ligase n=37 Tax=root TaxID=1 RepID=A0A2D6PAY1_9ARCH  ali  22  120.RWIELRKPKNLLIFKIWTFMEKAMREYWDKENFIQIYTPKFM-------PAPSESGAELFTVPYFGKKAYLAQSPQFYKQMAMASGFEKIFEIGPVFRANP--SHTVRHDTEFTMIDMEVSYVNHEDVMKVEEEWINYFIKRIKEEYGKEIKPKIPFPRITMEEAQKLIRSDEIKKKFNHEFIFVTEYPWSGRPFYHMKKEKTKDFDLVWKGTEVTTGAQREHRHDILKEQAKDKKINLKLIKDYLNFFKYG-CPPHGGFAISPTRFLMLLLGIKNVREVTFLPRDTSR.... 431
296 1.000e-93UniRef50_A0A183TID9 Uncharacterized protein n=1 Tax=Schistocephalus solidus TaxID=70667 RepID=A0A183TID9_SCHSO  ali  18  240.RYIDLRTPVNQSIYRVEHGIVHFFMEYLDNKGFTNIHTP-------KMISAASEGGANVFKVSYFNGSAFLAQSPQLYKQMAIAADFDRVYTVGAVFRAED--SNTHRHLTEFVGLDLEVAFKHYHEVVDLIADMFVHMFKGLQRQYASDIETIEPFKRLEFSEGIKMLREEKYDTDFYILDKFPLAIRPFYTMPDPHNKNYSNSYDFFMRGEEIMSGAQRIHEPEFLTERAKAHNIDISTIKSYIDSFRYG-CPPHAGGGIGLERVAMLFLGLDNIRKTSMFPRDPKR.... 575
297 1.000e-93UniRef50_G7E8K9 Uncharacterized protein n=1 Tax=Mixia osmundae (strain CBS 9802 / IAM 14324 / JCM 22182 / KY 12970) TaxID=764103 RepID=G7E8K9_MIXOS :  ali  20  132IPHLRPRTATFADVLRARHRLVQRAHTFLEEQDYLHVHPPVITSS----DCEGAGQVFSVSPSNFFGRPGFLSVSTQLHLE-ALAASLGRVWTLAPTFRAE--RSDTSRHLAEFWMLEAESVCDSLQGLMDDVEQLILAMVSAVPDLPLSPALLAKPWPRITYARAIELLGSDLSSEHEKWLPIFVHDYPAELKPFYMKRQTAECFDLLVPHIGELAGGSLREDDLGRLQLRMEQDGMNLDAYAWYLDLRRYGST-PHGGFGLGFDRLIAWLTDTANLRDVVAFPRS....... 454
298 1.000e-93UniRef50_A0A1Y1ZG06 Aspartyl-tRNA synthetase n=2 Tax=Pleosporales TaxID=92860 RepID=A0A1Y1ZG06_9PLEO  ali  20  227.RTLDLRAKINHAIFVIKSGVCALFQEFLSQKGFILIHTP-------KILGAASEGGANVFELKYFDRPAYLAQSPQFYKQMLIASRFQKVMEIGPVFRAEN--SNTARHLTEFTGLDLEMEFENYHEVMSVLEDLMLFIFKELNSRYEKETELVRKVPRIPFTEGIQMLRDEKYNSDFYVLDQFPLAIRPAYTMPSPANPLLSNSYDMFMRGQEILSGAQRIHNADLLAEMMRKHGLGTKD---YVECFRYG-CPPHGGGGFGLERIVQFWLGLPNIRMCSLFPRDPQRVIP. 551
299 2.000e-93UniRef50_P54262 Asparagine--tRNA ligase n=2337 Tax=root TaxID=1 RepID=SYN_LACDA  ali  25  119.RHLWLRSRRPFAIMQIRNRIFKATVDFFENEGFVKFDAPLLMHSAP-------EGTTELFHIDYFNHDAYLSQSGQLYGEVG-AEAFGKIFTFGPTFRAEA--SKTRRHLTEFWMMEPEMAWMHQDESLDLQERFLSYVVGQVLEHCEYELSILGNYTRLSYDDAVKMLGKDFKWSEQFDRPFFIVNYPVAIKPFYMKKNPENPLTYLPEGYGEIMGGSEREADYDTLKAQIEEAGLNLDDYSWYLDLRKYGSV-PHSGFGMGFERVIAWICKLDHVREAVPFPRMINRMQP. 432
300 2.000e-93UniRef50_A0A1W4W710 probable asparagine--tRNA ligase, mitochondrial n=1 Tax=Agrilus planipennis TaxID=224129 RepID=A0A1W4W710_AGRPL  ali  23  133..HFRPRTNRFSSLLRVRSNLLTEVTKYFNEVGFIHINTPIITS----NDCEGGGEVFTAVPANYFNSEVYLTVSGQLHLE-AVAHGLSKVYTMGPVFRAENSRS--RLHLSEFYMLEAELAFINISEILNVIENLLKTVTRRVLETSQDDIWLDKPFVILTYDEAINILSSKLKMPDCGNLPTFVINWPKQV----------SALDLLVPGVGEIVGGGLRENTYEKLQKNIPS---DDKNFEWYLELRKFGGV-PTGGFGLGFERYLQFLLDIENIKDAIPFPRWPHNCQL. 450
301 2.000e-93UniRef50_A0A2D6JC61 Aspartate--tRNA ligase n=1 Tax=Euryarchaeota archaeon TaxID=2026739 RepID=A0A2D6JC61_9EURY  ali  22  130.RVLDLRKPKSVAVFKIRNQILESAREYFTEQGLMEIESPKIIAS-------ASEGGAALFPVSYYDKEAFLRQSPQLYKE-LMTACFERVFEIGHVFRAEP--SDTIHHLSEVTQMDIELGFATEEDTWEILEGVINRIYSDVSEKQMEALEPKIPFKRITYDEAVEKWGDDKMITDHFKGPVIVHDYPMDMKPFYIDNPKISYGFDLFMEGVEISSGGRRVHEAAQYIENLKAKDLNPAEFADIIKFYEYG-MPPHAGWAIGVDRLTMLIAGVENVRETVLFPRDLKR.... 434
302 2.000e-93UniRef50_R7SZN6 Aspartyl-tRNA synthetase, cytoplasmic n=16 Tax=Agaricomycetes TaxID=155619 RepID=R7SZN6_DICSQ  ali  20  288.RVLDLRSPAAQSIFRIQAGVCELFRSFLVERGFTEIH-------SSKFQGTSTESGAAVFKVDYFRRPACLAQSPQLAKQMCIAADMERVFEIGPVFRAEN--SNTHRHLTEFTGLDIEMAIEHYHEVLDTLDECFKFIFKNLLTRFRSEIDVKKTFPRLKFAEGIRMLKEEKYGADYYILDKFPLDVRPFYTMPDPENNKFSNSYDIFLRGEEILSGGQRIHVAPFLEQRMRESNIDPDTMKEYVDGFRWG-CPPHGGGGVGLERLVMLFLKLGNIRWASLFPRDPR..... 608
303 2.000e-93UniRef50_D7KWB9 Uncharacterized protein n=2 Tax=Mesangiospermae TaxID=1437183 RepID=D7KWB9_ARALL  ali  20  167....RARTTTMAAVTRIRHKICLAAHVFCDKHDICYIHTPIITTS----DCEGAGEMFQVTTLDFFARQAYLTVSGQLHAETY-ACSMGDVYTFGPTFQAE--KSHTSRHLAEFWMVEVELAFAGVEEAMNCLDDM--ELMKNVDEACIHRLQMLTSFERVTHTKAITLLEEDLASEHEYKKPVIVYNYPKEIKAFYMRLNDDAAFDVLVPKVGELIGGSQREERMDVLMKRMEEKGLPIKEYEWYIDLRRHGTVK-HSGFGLGLERMLLFATGMDNIRDVIPFPRYPGRADL. 497
304 2.000e-93UniRef50_Q5SIC2 Aspartate--tRNA(Asp/Asn) ligase n=59 Tax=Terrabacteria group TaxID=1783272 RepID=SYDND_THET8  ali  20  112.RYVTLRGEKARAPLKVQAALVRGFRRYLDRQDFTEIFTP-------KVVRAGAEGGSGLFGVDYFEKRAYLAQSPQLYKQI-MVGVFERVYEVAPVWRME--EHHTSRHLNEYLSLDVEMGFIDEEDLMRLEEALLAEMLEEALNTAGDEISFPQDIPRLTHAEAKRILKEELGYERWGSDWLFVTRYPRSVRPFYTYPEEDTRSFDLLFRGLEITSGGQRIHRYEELLESLKAKGMDPEAFHGYLEVFKYG-MPPHGGFAIGAERLTQKLLGLPNVRYARAFPRDRHR.... 419
305 2.000e-93UniRef50_V4M100 Aspartate--tRNA ligase n=5 Tax=Acidilobus TaxID=105850 RepID=V4M100_9CREN  ali  21  126.RWLDVRNRKVSAIFVFESWVAHMFREHFRGRGFVEVFTP-------KIVAAGTEGGAEVFPVIYFGREAYLAQSPQFYKQMAVIAGLERVFEVGPVFRAEA--HHTVKHLTEFHGLDIEMGFIEPEDVMGELEGFFRRLLRAVREFFDLSVRVPGKVPRITIRQAYEILREDYAREEYDSDFVFVTEYPWKVRPFYTMRKEWTYGFDLLFRGLEIATGSQREHRYDHLLKNLRDKGLDPSKFQFYLNFFKHG-APPHGGAGLGLERIVKQFLGLENVREARLLPRDPER.... 439
306 2.000e-93UniRef50_A0A0K3C7P7 BY PROTMAP:  ali  20  268.RHLVIRGENASAILKVRAALLQSFRQSYANLGLLEVTPP-------CMVQTQVEGGATLFAFDYYGEQAYLTQSSQLYLETCLPS-LGDVFCVQESFRAE--KSHTRRHLSEYTHVEAELAFLTFKDLLEHIEELICQTIDRVLADPKKFEPPSRPFMRMDYRDAIKWLNDERKMTDTIGRPIFLINFPKDIKSFYMSRVPGDEEYLLMPNVGEIVGGSMRISDLDELLAAYKREGIDPEPYYWFTDQRKYGTS-PHGGYGLGLERLLAWLLNRYTVRECSLYPRWTGRC... 589
307 2.000e-93UniRef50_A0A292PXU0 Uncharacterized protein n=2 Tax=Pezizomycotina TaxID=147538 RepID=A0A292PXU0_9PEZI  ali  22  149..HLRSRIPANTNLLHLRSGLISTLTAFFAENSFIQCHTPVITSS----DCEGGGEVFTITRKDFFKTPKYLTVSGQLHLETL-VAAVPRVWALGPTFRA--DKSDTARHLSEFYMLEVEIAFIDLDPLIALIEDMVKTLIRSISGDKAKELELERSWSRITYTEAISRLGERFLAQTVFNGPVFVTDYPKGLKPFYMLPSVSTCFDLLVPTVGELVGGSLREHRYDELLAEMRRQGITVESLRWYLELRKWGSVK-HGGFGLGFDRLVCYLAGVENIREAVAFPRWYGRCDC. 495
308 3.000e-93UniRef50_A0A0G1PLM3 Aspartate--tRNA(Asp/Asn) ligase n=310 Tax=Bacteria TaxID=2 RepID=A0A0G1PLM3_9BACT  ali  22  134.RYLDLRKEKNTLIFKVWTLMDQVYTNFLTDQGFIQIHSPKLMS-------TPSETKAELFEVKYFEAKAYLAQSPQFYKQMAQAAGFEKVFEIGPVFRADP--SFTSRHNTEFTGYDLEMSFISHEDIMQLEEKLLIEIIKVVNEKYGHEIKPIMPFPRITFAEAKAILGT-YVKEKYNHEFVFITDYPPFYHMRHEDNSKLTKSFDLLWNGLEITTGAQREHRYDVLKAQAIEKDLDPEGLAGYLDFFKYG-CPPHGGFGAGPNRFIMKMLGLDNIREATYIYRGVKR.... 446
309 3.000e-93UniRef50_A0A1V4JH70 Asparagine--tRNA ligase, cytoplasmic n=1 Tax=Patagioenas fasciata monilis TaxID=372326 RepID=A0A1V4JH70_PATFA  ali  19  244.RHMMIRGENMSKIFKVRSMVVQAFRDHFFANGYYEVTPPTL-------VQTQVEGGSTLFKLDYFGEEAYLTQSSQLYLETCIP-ALGDVFCIAQSYRAE--QSRTRRHLAEYTHIEAECPFISFEDLLDRLESLVCDVVGRVLELNPAFKPPKRPFRRMNYSEAIEWLKEERLMTDTINEPILLCRFPAEIKSFYMQRCHDDSRDVLMPNVGEIVGGSMRIWDSEELLEGYKREGIDPTPYYWYTDQRKYGTC-PHGGYGLGLERFLTWILNRHHIRD.............. 546
310 3.000e-93UniRef50_A0A0M4EMA9 Aats-asn n=5 Tax=Holometabola TaxID=33392 RepID=A0A0M4EMA9_DROBS  ali  18  233.RHIMIRGENTSKVLKMRSVVMQAFRAHYFDRGYTEVTPPTL-------VQTQVEGGSTLFTLKYFGEDAYLTQSSQLYLETCLP-ALGDVFTIAQSYRAE--QSRTRRHLAEYTHIEAECPFLSFNDLLDRLEDLVTDVVDRVLELNPDFKPPKKPFRRMEYADAIKWLKEERKMTDTINEPILLIKFPLEIKSFYMSRCVEDQRDVLLPNVGEIIGGSMRIFNNDELFKGYEREGIDPKPYYWYTDQRVYGTV-PHGGYGLGLERFLCWLLNRYHIREVCLYPRFLERCKP. 548
311 3.000e-93UniRef50_Q2NIF5 Asparagine--tRNA ligase n=11 Tax=Candidatus Phytoplasma TaxID=33926 RepID=SYN_AYWBP  ali  21  146ISHLRVRTKLFGAVFRIRNTAFFALHSFFQKKGFFHINTPIITP----NDGEGVGELFQITTLDFFGKKVFLTVTGQLEAE-AMALGLNKVYTFGPTFRSE--KSNTTRHAAEFWMLEPEMAFCDLSQNLKVAQEMLQFVISKCLEQNYQDIEFLKEFLTVKYEQALEILHEKYLTEKHFKKPVFIVDWPKEIKAFYMKNNPDQKMDLLFPRVGELIGGSQREENLSVLIEKMNQMKISQKDLEWYLDLRRFGGCI-HSGFGLGFERLLIFLTGLDNIRDVIAFPRTYH..... 499
312 3.000e-93UniRef50_A0A0V0QDU2 Nucleic acid-binding, OB-fold n=1 Tax=Pseudocohnilembus persalinus TaxID=266149 RepID=A0A0V0QDU2_PSEPJ  ali  20  225..HLRPRTRLMGAVMRVRNSLAQATHLFFSANNFQYIHTPLITAS----DCEGAGEMFQVTTLDFFKKPAYLTVSGQLSVENY-CCALGNVYTFGPTFRAET--SNSTRHAAEFWMIEPELAFADLIDDMDCAEQYIQFCIKYILDNNKDDLDFLTPFERITYTDAIKLLHEKFLCDYVFHKPVMVYNYPKEVKAFYMRKKTVACVDVLVPGVGELVGGSQREERMHILDERMKELSLEKQDYWWYLQLREYGTI-PHSGFGLGFERLVMLTTGISNIKDAIPFPRQTG..... 598
313 4.000e-93UniRef50_A0A2K3NKU5 Asparaginyl-tRNA synthetase n=3 Tax=Mesangiospermae TaxID=1437183 RepID=A0A2K3NKU5_TRIPR  ali  22  31.....LKLNKLVLVARVRNALTYATHKFFQENGFVWVSSPIITASN----CEGAGEQFCVTTLDFFGKPAFLTVSGQLNAETY-ATALSDVYTFGPTFRAEN--SNTSRHLAEFWMIETELAFADLNDDMACATAYLQFEIRHILDNCKEDMEFFNTWIRLS-----VKWGCDLQSEHFGRCPVIIRDYPKACYFFYMRQNDDGRMDMLVPKIGELIGGSQREERLDHLEARLDDLKLNKNAYWWYLDLRRYGSV-PHAGFGLGFVRLVQFATGMDNIRDVIPFPRTPGSA... 337
314 8.000e-93UniRef50_A0A1Y2FAP5 Uncharacterized protein (Fragment) n=1 Tax=Protomyces lactucaedebilis TaxID=56484 RepID=A0A1Y2FAP5_9ASCO  ali  22  133..HFRPQTQVSASILRLQSKVLQSVTDYFSSQDYIQTLPPVLTSS----DCEGAGETFQIQQGKFFGKPTSLAVSSQLHLE-CLAMGLGRVWTLAPTFRAE--KSTTSRHLAEFRMLEAELSFCELPDLLTVVEGIIRAAAKHVDGKLAAALSLSTPWPRIRYEEAIIILGSALQTEHHFGGPLFVTHYPMKQKPFYMQKEGDSCFDLLVPGMGELCGGSMREHNHHALLSSMRQQGISIDEMAWYADLRKYGTV-PHGGFGIGFERLVGYLIGVTNVREVAAFPRW....... 439
315 8.000e-93UniRef50_A0A151ERU8 Aspartate--tRNA ligase n=4 Tax=cellular organisms TaxID=131567 RepID=A0A151ERU8_9EURY  ali  23  121.RVLDLRSRSHQLTFCVQACLVSGFREFLDKEGFYEVHTP-------KIVATGTEGGTELFPVQYFENKAFLAQSPQFYKQMLVGAGFERVYEIGPVYRAE--EHNTVRHINEYTSLDLEFGFITDDDVRVLENRLLLYMYQKLERECSPVLEVPDTIPAITFEEALEITGEDYSAESLNSEFIFITAYPQDKRPMYMPDGELTKTFDLLLRGIEVTTGGQRIHQYHLLVEKIRERGLNPEDFTFYLEVFKYG-MPPHGGFAIGAERLTMQTLNLPNIREATFFPRDRTRIAP. 426
316 8.000e-93UniRef50_A0A0G0L434 Aspartate--tRNA(Asp/Asn) ligase n=1 Tax=Candidatus Woesebacteria bacterium GW2011_GWB1_38_8 TaxID=1618570 RepID=A0A0G0L434_9BACT  ali  23  121.RYLDLRTERMRKNIISRAKMIKAFRNFFDENGFLEIETPALT----KGTPEGAREYLVPSRL-YPGEGYVLPQSPQQFKQLLMVAGIERYYQLARCFRDEDSRKD---RQPEFTQFDIETSFFSQDEVMNLAESAVTSMIRDV---FPFLKLPDGKFPIYTYDYVIKKYNSDKPDLRKNPKFCWVVDFPMFAVHHPFTRPNVKNVYDLVLNGYEIAGGSLRISDIALQHKVFEILGLKEKEFGHMLEAFKF-SPPPHGGIAFGFDRLVAVLCGESSIREVIAFPKTGEALDLL 438
317 9.000e-93UniRef50_A0A2H9QEE8 Asparagine--tRNA ligase n=2 Tax=unclassified Diapherotrites TaxID=1046942 RepID=A0A2H9QEE8_9ARCH  ali  23  119VRHLWMRSSRMTSIMKIRSTMLYAVREFYKKENYFECSPAIIT-------PNACEGGTTLFPLKYFGEQRFLSQSGQMYLEV-MIFALGKVFSLTPSFRAE--KSKTARHLTEYWHLEGECAWMNMDDQMGEIEKMVSFICQKIAKENPVELKIRVPFSRISYDEAIDVLKEEKILSEDEKIPFFIYDYPTAIKAFYDPKKCFSFDLIGPEGYGELCTGGQREDVNENMLKKLKKEKIPLENYNWYLDLRKYGSV-PHSGFGIGIERLLRWICKLDSIKETIPFPRTMNR.... 429
318 1.000e-92UniRef50_F4PAD8 Uncharacterized protein n=2 Tax=Batrachochytrium dendrobatidis TaxID=109871 RepID=F4PAD8_BATDJ  ali  23  135..HLRSRTRIFGALWRIRSAALQGIHDFFKAQEFTQVNMPILTT----HDCEGGGEAFRVLTDDFFGKPVYTTVSAQLHLEF-MASALSRVYVLGPAFRAE--KSQSTRHLAEFWMLEAEACFITISALTDLIEGNIKHVIQHVLNTCQEDLALNKLFERMTYTDAVQKWGEKFLAETIIKGPVFVTDYPKKIKPFYMKQSTVACTDLLLPKVGELAGGSLREDQYELLAQKINDAGLDSAQLEWYLDLRKYGSV-PHGGYGMGFERLLGYLTGMTNIRDMIPAPRSYGHC... 501
319 1.000e-92UniRef50_A0A165HUQ2 Aspartyl-tRNA synthetase n=3 Tax=leotiomyceta TaxID=716546 RepID=A0A165HUQ2_9PEZI  ali  19  261.RIVDLRTAVSQSIFRVQSGICNLFRSYLDTQDFIEIHTPKLQ-------GGATESGASVFKVEYFGRPAFLAQSPQLAKQMCVAADFERVYEIGAVFRAEN--SNTHRHMTEYTGLDLEMAIEHYHEALTVIDATFKHIFKGLYERYRKELDWLEKTPIIQFKEGIKMLNEEKYLTDFYVLDKFPASARPFYTMPDPNDERYTNSFDIFIRGQEVLSGGQRIHDSKMLEERMAKQGLRPNAMEDYLSGFRWG-APPHAGGGIGLERVVMLILGLGDIRHASLYPRDPR..... 581
320 1.000e-92UniRef50_Q0CN98 Aspartyl-tRNA synthetase n=1 Tax=Aspergillus terreus (strain NIH 2624 / FGSC A1156) TaxID=341663 RepID=Q0CN98_ASPTN  ali  19  258.RLLDLRTPTSQSIFRIQSAVGNLFRTALDEQGFIEIHTPKLQGS-------ATESGASVFSVNYFGRDAFLAQSPQLAKQMAIAADFGRVYEIGAVFRAEN--SNTHRHLTEYTGLDIEMAIEHYHEMLDVLDAVIKNILQGVYGRYRREVEIIKKTPIIRFADGIKMLNKEKYGTDYYIIDKFPVGARPFYAMPDPDDSRFTNSFDIFIRGQEIVSGGQRIHDPRMLEENMRRNGINPDSMEEYMEGFEWG-APPHAGAGVGLERLVMLLLKLGNIRLASLFHRDPK..... 578
321 1.000e-92UniRef50_A0A0G0BB34 Aspartate--tRNA(Asp/Asn) ligase n=10 Tax=root TaxID=1 RepID=A0A0G0BB34_9BACT  ali  26  120.RYLDLRRPRMYKNLALRSRFIDLIRQHLFKQDFLEIETPILSET----TPEGARDFIVPSRLQ-LGKFYALPQSPQQYKQLLMVGGVEKYFQIARCFRDEDPRAD--RAYGEFTQLDLEMSFVEREDVMRLTENLFIEVYEKLKVSIK-----QKPFPVFTYTEAIKKFGADKFDLRTPEEFAWVVDFPKDLLNKKNVGNILTTQYDLVCNGYEVGGGSIRNHTPEGLKSVFEIMGLSEEKFGHMIEALGYG-APPHGGIAPGIDRLLTCITGETSIREVIAMPMTSGGR... 432
322 1.000e-92UniRef50_Q6C700 YALI0E04939p n=6 Tax=Saccharomycetales TaxID=4892 RepID=Q6C700_YARLI  ali  23  138...LRWRTSVNSSTLRYRSFCMAQMTNFFAENDFVQTNPPLLTSS----DCEGAGEVFKVAGGGKGDKPAYLTVSTQLHLEVL-AAAVGRVWTFTPAFRAEN--SDTNRHLSEFWMAEAEISFIDLEPLMDLAEGMVKSCLAPLMEEEQKEELLDRDFPRLTYKQAIKILHEKWLATEYFISPVFVTDYPKEQKPFYMKQSPHDCFDLLMPHIGEVIGGSVREDNYDTLLKNIETTGMDKSALEWYLELRKQGST-PHGGFGMGFERLISYATGIENIRDVTAFPRWVDNCSC. 473
323 1.000e-92UniRef50_A0A210QD01 Asparagine--tRNA ligase, mitochondrial n=2 Tax=Mizuhopecten yessoensis TaxID=6573 RepID=A0A210QD01_MIZYE  ali  20  154..HLRSRSKINSSIFRVRNAATMAIHKFFQTNNFMHIHTPMLTS----NDCEGAGEVFNVKPIHFFKKPVYLTVSGQLHLESFL-GAFGKVYSFGPAFRAE-SQSGGRFHLSEFYMVEGEIAFLDLEGLLKVMEDLVKFSTKEIYENSEEDVNFITKFVRISYSEAMVKWGDDLNKEHEGNVPVFLTDFPASIKPFYALENIDNRTDLLVPEVGELFGGTLREHRFDHLERKLKDIG-QQDQLHWYLDLRKYGSV-PHGGFGMGFERYLQFLLGVRNIRDTIPFPRTPLNCKM. 502
324 2.000e-92UniRef50_A0A1V5YK47 Aspartate--tRNA ligase n=1 Tax=Chloroflexi bacterium ADurb.Bin180 TaxID=1852857 RepID=A0A1V5YK47_9CHLR  ali  21  122.....LRNLQKRALFRISAELMTGYREYLNEQGFVEIQTP-------KIVGSATESGANVFVLDYFGRPAYLAQSPQFYKQI-MVGVFERVFEIGPVFRAE--KHNTARHTNEYVSMDLEMGFVDDHDVMKMLTGVLRHMFTRVTEGCAKEVALLKSIPSIRMPDALERYKEDYAAKELGSEFLFVTHYPPFYALPDEQEPTLTKSFDLLFRGCEVVTGGQRIHRYEQLLENAAKWGIKAEQISGYLQAFKYG-MPPHGGFGMGLERLLMQLTGQTNLREVTLFPRDQDRLAP. 432
325 2.000e-92UniRef50_A0A2H6GZV7 Aspartate--tRNA(Asp/Asn) ligase n=25 Tax=Archaea TaxID=2157 RepID=A0A2H6GZV7_9ARCH  ali  20  121.RFLDLHRQKTQAIFKIQSEICNSFREFFYKKSFIEMQPPCIISS-------ASEGGTDLFPVKYFEKDAYLAQSPQLYKQM-VACSMGNTFMITPIWRAE--KHNTTRHINEIRQMDIEIAFANQEIAMKEHEDVVKYIVGQVIKKCKDELKLLKKIPKLSYDETVKKYGEDLSPEDYPDTIVFVHSWPTKLKPFYIMDAKLSEGFDAIYGGVEICSGGQRIHLPDLLEKMLKSKGLNPKNFKEYVDSFRYG-APHHAGWSLGLERLTEIICGLDNIREATMFPRDRDRLSP. 424
326 2.000e-92UniRef50_A0A0L0HKZ6 Asparagine-tRNA ligase (Fragment) n=2 Tax=Fungi incertae sedis TaxID=112252 RepID=A0A0L0HKZ6_SPIPN  ali  21  141..HFRSRSKTFGAIWRIRNTAILGLQHFFQSHRFVQAHTPILTS----NDCEGAGEVFRVVPSEFFNHAVYLTVSGQLHAEML-ASAMSRVYTLGPTFRAEPSLS--SRHLAEFWMLEAEMAFITQGELLDFIEACIRETTAFVLEHSEEDIAFSQPFARITYGEAVEILHERYLAEEHIKGPVFVTDYPKCVKPFYMRQETVACVDLLVPKIGELVGGSLREDNPDILEQSMRHAGLDVEEYGWYLDLRRFGSV-PHGGFGLGFERYLAYITGMANIRDLILVPRWLGHC... 506
327 2.000e-92UniRef50_A0A2D6P655 Asparagine--tRNA ligase n=2 Tax=Candidatus Woesearchaeota archaeon TaxID=2026803 RepID=A0A2D6P655_9ARCH  ali  23  124IRHLSIRDPKQQAILKIRSGVISGFHEYFRSRGYHEHQSPSFT-------PTPGESGAETFEVKYFGKKAYLTQTWQLYAEM-MLPVLEKIYTMAPSFRA--DKSMTSRHLTEYWHAEAETAWQEFPELLQTIEECVRYICSKISKEYASEMTLLPKFKKLKYRAAVEELKEEKYLVDKRKIPLFITHYPTSLKAFYMKRDKKDPDQVLAPGIGELVGSSERSLDFEDVKKRLRSAGEDPKKYEFYFDSSRYGKI-PHSGFGLGIERLVMWLTGAESVKECIAFPRTPTR.... 432
328 2.000e-92UniRef50_A0A1V4TKK6 Asparagine--tRNA ligase n=7 Tax=Archaea TaxID=2157 RepID=A0A1V4TKK6_9EURY  ali  22  120.RHLWIRSREQTAVMKVKASLLAGAREWLAENEFTEVTPPIFTQ-------NACEGGVTLFKLKYFDREAYLSQSAQMYLESLIFS-LEKVYSITPSFRAE--KSRTPRHLTEYWHMELEEAWVDNEGNMKIQEELVSAMVXXXXXXXXXXXXXVPPFKRLRYSDMIDLLKKKGFDIEFGADPVFVTNFPKECKAFYMKEDPDDTRLLAPFGFGEVIGGSERETDLNKILQRLEAAGIPEDPYRWYLDLRRYGSV-PHSGFGLGVERIAKWVCNLEHIRDAIPYPRTVARV... 430
329 2.000e-92UniRef50_A0A2V1DNH2 Aspartyl-tRNA synthetase-like protein n=1 Tax=Periconia macrospinosa TaxID=97972 RepID=A0A2V1DNH2_9PLEO  ali  18  372.RVIDLRTTTSQGIFRIQSGICSFFRQQLDKEGFIEIHTPKLQ-------GGATESGASVFKVEYFGRGAFLAQSPQLAKQMCISADFGKVYEIGAVFRAEN--SNTYRHLTEYTGLDLEMAIEHYHEVLRTLDRTFKAIFTGIYERYRPEIEIVKETPIIPFAEGIRMLNEEKLGTDYYVLDKFPVNARPFYAMPDPNNKNVTNSFDIFLRGQEILSGGQRIHDADMLLENMRRLKIDPQTMEEYIQGFQWG-APPHGGGGIGLERILMLLLNLGNIRHASLFPRDPK..... 692
330 3.000e-92UniRef50_A0A1D6FGX5 Aspartate--tRNA ligase 2 cytoplasmic n=11 Tax=Mesangiospermae TaxID=1437183 RepID=A0A1D6FGX5_MAIZE  ali  21  227.RAIDLRTPSNQAIFRIQCQVENKFREFLLSKDFVGIHTPKLIS-------GSSEGGAAVFKLLYNGQPACLAQSPQLHKQMALCGGFERVFEVGPVFRAEN--SNTHRHLCEFVGLDAEMEIEHYFEVCDIIDGLFVSIFKHLTENCNKELERQYPFEKLTYEEGVQMLKAKQNRLQYCTLLVYLINRKPEQKLSLWVTSILKLRKNLVGKSEEIISGAQRIHTPELLTKRATECGIDVSTISTYIEVFSYG-APPHGGFGVGLERVVMLFCALNNIRKTSMFPRDPQR.... 529
331 3.000e-92UniRef50_A0A2N3UQV3 Aspartate--tRNA ligase n=7 Tax=Bacteria TaxID=2 RepID=A0A2N3UQV3_9ACTN  ali  20  124.RFLDIRRRPAARLFTVAATLEQGLREYAQVHGCTELHTPKLM-------GTASESGAEVFRVDYFGGSAYLAQSPQFYKQMAIASGIDRVFEVGPVFRAEP--SYTSRHATEFTGVDVELGWTDAEEVQAFEEGMIAHALALVAERHGAEIQPKTPFPRLAMAEAQELLGERLMRERTGHQFVFVTHYPASIRPFYHGRPDLTLSFDLLWQGLEVTTGAQREHRYDVLAAQAAEKGMSLEPLTDYLNCFRYG-CPPHGGFGMGLNRMLMVLLGLGSIRDAVFLFRGPNR.... 438
332 3.000e-92UniRef50_A0A226E5F1 Aspartate--tRNA ligase, mitochondrial n=1 Tax=Folsomia candida TaxID=158441 RepID=A0A226E5F1_FOLCA  ali  20  241.RYLDLRTELLQRRLRFRASLIRSMREFMDRNYFIDVETPSLI----RRTPGGAREFPVATRHP--GLFYALAQSPQLLKQILMVGGMDKYYQVARCYRDEGAKPD---RQPEFTQFDIELSFTTREQVMDLIEDLLKYALR---------LSPKRDFDIMTYKEAIKNYGTDKPNT---SGFCWIIDFPKESDVYENPENAVGQSYDLVFQGNEIGGGSVRIHNSRLQRHIFDILKLPTSDIDYLLTALDSG-CPPHAGFALGIDRLVALWSDANSIRDVIAFPKSSEGRDPL 533
333 3.000e-92UniRef50_A0A2J4G9T4 Asparagine--tRNA ligase n=7 Tax=Archaea TaxID=2157 RepID=A0A2J4G9T4_9CREN  ali  25  117VRHLAVRSRKMTAVLKIRHTVFGALHEWFRENGFYEVQCPMFISA-------AVEGGATLFPVKYVDETVYLTQSSQFYLEALIFS-LEKVYTVAPSFRAE--KSRTRRHLTEFWHAEAEVAWVGLEGILKVEEELVSHIVRRVLERNREELDLLPPFPRVSYDNAIEIWGDDLGADEEFDKPFFLYGFPEKSKAFYHKNDPSRPEVTLPEGYGEIIGGGERIDRLDELVEKIKRFGFNPKDYEWYLDLRRFGTV-PHAGFGLGMDRLVMWIGGLEHIVDSVPFPRTVAR.... 428
334 3.000e-92UniRef50_A0A1G6JIN1 Asparagine--tRNA ligase n=14 Tax=Bacteria TaxID=2 RepID=A0A1G6JIN1_9BACT  ali  23  121.RHLWLRSRKQFHILRVRNQIIKAIREFYLENDFTLIDTPIFTGS----IGESAGNTFEMEYFDY--GKVYLAQTGQLYLEAA-CQSLGKVFNLGPTFRAE--KSKTRRHLIEFWMNEAEVAFYEHEDNIKLQNDLVNYIVKSVXXXXXXXXXXXXEFPRITYTEAVENWGDDLGAEHEYDKPLIIEKYPKHAKAFYMQPDPQNPEVVLPEGYGEIIGASERIWKEEVLLKRLEEENLSKDDYQWYLDLRKFGSV-PHSGFGLGIERTVAWICGLEHIRETIPFPRTLYRV... 432
335 3.000e-92UniRef50_A0A1Z5KKG9 Aspartyl-tRNA synthetase n=7 Tax=Eukaryota TaxID=2759 RepID=A0A1Z5KKG9_FISSO  ali  21  271.RWMDLRAPANNAILRIQSAVCQLFREALYAEGFVEIHSPKLI-------AGESESGAGVFTTDYFGTTACLAQSPQLYKQMAIASDLPRVFEIGPVFRAEN--SNTRRHLCEFTGLDLEMAIDDYMETLEVIHKLFKHIFNGLETRWAKELAVVRTFTVLHWPEAMDLLKKEKYGTDFFMLDKYPSTIRPFYTMPDPEDQRYSNSYDIFIRGQEICSGAQRCHDPDLVVKNLQDKGIEPEGLSAYIESFRHG-VSPHAGAGIGLERVVFLYLGLDNVRKASMFPRDPNRC... 588
336 3.000e-92UniRef50_A0A167VRV5 Aspartyl-tRNA synthetase cytoplasmic n=3 Tax=Agaricomycetes TaxID=155619 RepID=A0A167VRV5_9HOMO  ali  22  267.RAMDLRTPTNQAIFTIQARVCRYFREYLDERGFLEVHT-------AKLQPAATESGSSVFKVDYFQRAAFLAQSPQLAKETCISADFERVYEIGPVFRAEN--SNTHRHMTEFTGLDLEMAIEHYLEARTVIDGLLKHVFRSLQTQNAEEIEVKRQFPILAFTDGIRLLQEEKYNTDYYILDKFPAEVRPFYTMPDPSNPKLSNSFDIFLRGEEILSGGQRLHSAKELEARITAAGINPAEMADYLDAFRWG-VPPHAGGGIGLERLVMLFLKLGNLRNASLFPRDPR..... 587
337 3.000e-92UniRef50_A0A090WRF9 Asparaginyl-tRNA synthetase n=7 Tax=root TaxID=1 RepID=A0A090WRF9_9FLAO  ali  22  1..............MRLRSSLSFAIHKYFNENGFYYMHAPIITGS----DAEGAGEMFKVSSLDFFGKETNLTVSGQLEAETY-AMSLGKVYTFGPTFRAEN--SNTSRHLAEFWMIEPEVAFMDLAGNMDLAEDFMKSVITHVLEHNREDLEFLEKFKRVSYTEAIDILHERFLVEKHFKCPVILFDYPADIKAFYMRLNDDGKMDILFPGIGEIVGGAQREERLDILKQRMAAIDIPEEDLWWYMDLRKYGTAV-HSGFGLGFERLVMFATGMGNIRDVIPFPRTPQNA... 346
338 3.000e-92UniRef50_G4TGB2 Related to SLM5-Asparaginyl-tRNA synthetase, mitochondrial n=2 Tax=Serendipita TaxID=358905 RepID=G4TGB2_SERID  ali  22  151....RPRTDEIARMLRLRHAAKRAFEDYYEVNGFTSIQAPVITN----NDCEGGGEVFRVLPDHFFGNPAYLTVSSQLHLE-AFASAFSRVYTLQPAFRAE--RSHTNRHLSEFWMLEAEMAFVDLSVIMDVVEASIKHVFQETLASDSQRAQLDSPWKRITYTEAVEEWGQNISVEQEGGQPLFVTNYPTNQKPFYMRVNTDACFDLLVPRVGELVGGSLREERVDYLEAALNKHGLPADQYEWYTELRRFGTT-PHGGFGLGFERFISWVGGWENVRECIPAPRWKGRCVL. 482
339 4.000e-92UniRef50_UPI000CD8CA86 aspartate--tRNA ligase 2, cytoplasmic-like n=1 Tax=Lactuca sativa TaxID=4236 RepID=UPI000CD8CA86  ali  21  470.RILDLRTPANQAIYRLECQVSNLFRQNLLDEDFIEIYTPKLTAGT-------SEGGAAVFKLDYKKQPACLAQSPQLHKQMAICGDLGRVFIVGPVFRAED--SYTHRHLCEFTGLDIEMEIEHYSEVMDVVDRLFVNMFDKLNERCKKKLEAIRPFTRLTFEEGIQMLKDKLVLEKYGTEFYILHRYPPFYTMPCPDNALYSNSFDVFIRGEEIISGAQRVHIPELLEARATACGIDVKTISSYIDSFRY-FAPPHGGVGVGLERVVMLFCGLDNIRKVSLFPRDPRRLEP. 788
340 4.000e-92UniRef50_A0A109V511 Aspartate--tRNA(Asp) ligase n=3 Tax=Nanopusillaceae TaxID=1890942 RepID=A0A109V511_9ARCH  ali  22  113.RWIDLRDPKKSLIIKLTSYAVKYIREYLYNNNFIEIFSPKIIS-------TASEGGAEVFELNYFNRKAYLAQSPQFYKQMAICSGFEKVFEIAPAFRAEP--SFTSRHLTEFTSFDVEIGYISSHDVMKVLEEIVKYTNKKIKENFEDEIKIPENIPKIKMEEVYEIIGKDYVKKTYDNEFVFIIDWPWTARPFYHMKMITTKSFDLLYNGLEISTGSQREHRYKILLEQIKEKGLNPDNFKYYLEFFKYG-APTMGGFGFGIARYIKQLLNIENVKEAVLIPRDPNRLEP. 428
341 4.000e-92UniRef50_A0A1Y1JAF0 Asparagine--tRNA ligase n=1 Tax=Plasmodium gonderi TaxID=77519 RepID=A0A1Y1JAF0_PLAGO  ali  22  201VAHLRPRSYFISSVIRIRNALATATHLFFQSRGFLYIHTPLITPRVKANKGGGKKEYLIDYKKDFFNKQAFLTVSGQLSLENL-CSSMGDVYTFGPTFRAEN--SHTSRHLAEFWMIEPEIAFSDLYDNMELAESYIKYCIQYVLNNNFDDIILNENFAKITYTNVIEIWGMDLQSEHEFKKPVIVYNYPKDLKAFYMDQKTVAAMDVLVPKIGEIIGGSQREDNLELLDKMIIEKKLNMESYWWYRQLRKFGS-HPHSGFGLGFERLIMLVTGVDNIKDTIPFPRYPGHA... 581
342 4.000e-92UniRef50_D8PK59 Uncharacterized protein n=1 Tax=Schizophyllum commune (strain H4-8 / FGSC 9210) TaxID=578458 RepID=D8PK59_SCHCM  ali  20  140.RVIDLRTPPSNALFRLNAAVCRYFRNYLDDHGFIEIHSPKLQGS-------ATESGSSVFPVEYFGRKAFLAQSPQLAKQMAISADMGRVFEIGPVFRAEN--SNTHRHLTEYTGLDIEMAFQHYHETMYLMIDLLKNIFKNVYEHNRPQIEVLKETPVIPFKEGIRMLKEEKYHTDFYVLDKFPVAARPFYAMLDPKDKRFTNSFDMFIRGQEIMTGGQRIHEPAALLRRMRDAGVVPASLEEYMKAFEWG-CPPHAGAGVGLERILMLMFKLGNIRFASMFPRDPK..... 462
343 5.000e-92UniRef50_A0A2H6GTL3 Aspartate--tRNA(Asp/Asn) ligase n=9 Tax=unclassified Bacteria TaxID=2323 RepID=A0A2H6GTL3_9BACT  ali  20  128.RSLTLRNEKVKTIFKIYSGLLDAYREFMKKEGFIEIKTPKILSS-------ATEGGANFFKIKYFEKEAFLAQSPQFYKQ-AGVGVFERVFEVGTVFRAEP--HFTTRHVNEYTSLDAEMGFINMEDLMKQLEKTMDYMFKSVAKKYKEDVKLSKIVPRIKLTEALDILEKEWAKKKYKSDFVFLTHYPTSVRPFYTMDPQYTESFDLLYNGVEIATGGQRIHDYNQLTENIKKHGLNPEEFKHYLDIFKYG-MPPHGGWGLGSERILQRMLGLKSIKEAVLFPRDVKRI... 437
344 5.000e-92UniRef50_Q9V434 Asparaginyl-tRNA synthetase, isoform A n=207 Tax=Opisthokonta TaxID=33154 RepID=Q9V434_DROME  ali  18  243.RHIMIRGENTSKVLKMRSVVTQAFRGHYEARGYNEVTPPTL-------VQTQVEGGSTLFKLKYFGEEAYLTQSSQLYLETCLP-ALGDVFTISQSYRAE--QSRTRRHLAEYTHVEAECPFLTFDLVCDVVDRVLKSPWGYVKELNPDFKPPQKPFRRMNYEDAIKWLKEERKMTDTINEPIMLCRFPAEIKSFYMQRCKEDQRDVLLPNVGEIVGGSMRIYDSEELLKGYKREGIDPQPYYWYTDQRVYGTM-PHGGYGLGLERFLCWLLNRYHIREVCLYPRFLDRC... 556
345 5.000e-92UniRef50_A0A0D1Z888 Aspartate-tRNA(Asn) ligase, variant 2 n=1 Tax=Exophiala mesophila TaxID=212818 RepID=A0A0D1Z888_9EURO  ali  20  41.RIMDLRTAASQSIFRIQAGVGNLFRTALDDKRFVEIHSPKLQ-------GAATESGASVFKVNYFGRPAFLAQSPQLAKQMAIASDFERVYEIGAVFRAEN--SNTHRHLTEYTGLDLEMAIEHYHEMMDVIDEVLKGIFKGVYTKYRTEVEIIKETPRIPFTDAVKLLNKEKFKTDYYILDKFPRSARPFYTMPDANDPRYTNSFDVFVRGQEIISGGQRIHESKMLEDNMRLVGIDPEDMAEYMEGFRWG-APPHAGCGVGLERIVMLILKLGNIRLASLFHRDPK..... 361
346 5.000e-92UniRef50_A0A1J5IIG3 Aspartate--tRNA(Asp/Asn) ligase n=1 Tax=Candidatus Wirthbacteria bacterium CG2_30_54_11 TaxID=1817892 RepID=A0A1J5IIG3_9BACT  ali  24  131.RYLDLRRPAMQAKMMLRSKLFNLMRQYLVSHEFIEIETPMLT----KSTPEGARDFIVPSRLQP-GKFYALPQSPQQYKQLLMVAGMERYFQFARCVRDEDLRADRGF---EFTQLDLEMSFVEREDVMGMIEGMVIDSIEKLDGKKIR----QKPFPVLSYKEAFEKYGADKFDMREDPKFAWVVDWPTFELDKMTGNWTYSHQYDLVCNGYEVGGGGIRIYDPEALAKVFEIIGHDQEQFGHILEAFSYG-VPPHGGIALGLDRLVMLLTRDSSLKEVMAFPMTSSG.... 453
347 6.000e-92UniRef50_D8LYF0 Uncharacterized protein n=3 Tax=Blastocystis TaxID=12967 RepID=D8LYF0_BLAHO  ali  21  38IPHIRPRSNLQGVVNRMRNTMIQSVHHTLQSNDFIQVMTPIMTS----NDCEGAGELFSVALASFFNSRAFLTVSGQLQAEM-MAHAMTRVYSFAPTFRAEN--SNTSRHLCEFWMIEPEMCFVQLPDLMDLAKKVIMDVAKNLEGKHGEDFRFLKNYCHLTYTEAIDIWGIDLQSEHEGNKPLFLTHYPAEIKPFYMKDKTVEAMDLLVPRVGEIVGGSMREDQYDVLKRRMEEKGLLSEELDWYLDLRRYGSV-PHGGWGLGLERLIETFTGVQNIRDVIPVPRVPGSCLL. 393
348 6.000e-92UniRef50_A0A2H9LWC6 Aspartate--tRNA(Asp/Asn) ligase n=14 Tax=DPANN group TaxID=1783276 RepID=A0A2H9LWC6_9ARCH  ali  23  144.RYIDLRREIPKAIFSIKSVVANSFRNYLYGHGYTEIFTPCIISA-------ASEGGANLFPIIYFDREAFLAQSPQLYKQIAVVGGMDKVFMTVPAFRAE--KHNTTCHLNEVIQMDIEQGFANHHDVMDVSAAVFTHVLKTVNEKCKAELAVLKEVKRYTYSEVVELWGEDFTRETEREELYFIYDWPTQIRAFYSMPNKTCKGFDLMYRGLEISSGAQRIHIPELLITQLKKRGLNPTDFDFYIRAFRAG-APPHAGWSIGLERATMVICDQKNIREVAMFPRDRTR.... 448
349 7.000e-92UniRef50_A0A151IDC7 Asparaginyl-tRNA synthetase, cytoplasmic n=5 Tax=Attini TaxID=143999 RepID=A0A151IDC7_9HYME  ali  20 1754.RHIMIRGENTSRILMMRSILMQAVRDHYKDRGYYEVTPPTL-------VQTQVEGGSTLFKLDYFGETAFLTQSSQLYLETCIP-AMGDVYCIAQSYRAE--QSRTRRHLAEYTHLEAECPFITFDLICDVVERVLKSPLGYVKELNPNFQVPKKPFKRMNYSDAIEEFGEDRKMTDAINEPIMLCRFPAEIKSFYMQRCMDDKRDVLLPNVGEIVGGSMRIWDYKELMEGYKRENIDPTSYYWYTDQRKYGSC-PHGGYGLGLERFLCWLLNRHHIREVCLYPRFLERC... 2067
350 8.000e-92UniRef50_A0A066WTE0 Putative asparaginyl-tRNA synthetase n=4 Tax=Sordariomycetes TaxID=147550 RepID=A0A066WTE0_COLSU  ali  24  1MPHLRPRIPLNAAILRLRSEAVAILTQFFASRSFVQTHPPIITSS----DCEGAGEVFNVTKDQFFRSPKYLTVSSQLHLE-ALAQSLGDVWTLSPTFRAE--QSDTSRHMSEFYMLEAEMSFIDMDDVMDLVEDMLRNLATGLHKTRAEEVEPISKWPRITYTDAIKILQEDRFEHKPTWEPVFVTHYPREFKAFYMRRDTVDCFDLLVPDLCEIAGGSMREHRLETLLETMEARGMGSPDLDWYVDLRRWGS-NPHGGFGLGFDRLLSYLVGVPNVRDVVAFPRWFGRCDC. 386
351 9.000e-92UniRef50_A0A0G1S0V0 Aspartate--tRNA(Asp/Asn) ligase n=13 Tax=root TaxID=1 RepID=A0A0G1S0V0_9BACT  ali  23  122.RWLDLRKSDSHRIFRVWTALEQGMRAYFAEHDFVQIYAPSLMSA-------ASESGAEVFEVKYFETKAYLAQSPQFYKQMAIASGFEKVFLVGPVFRAE--LSFTTRHMTEFTGWDFEIAYINHHEIMDTLEASLKAGFTELKKQELIQESISFPFARLTFTDAKIQLQSDKPHEDSGSDFVFIYDYPPFYHMRHTDNPALTRGFDLLYKGVEITTGAQREHRYDVLVKQAKERGLTAESLSDYLNFFKYG-CPPHGGVGIGPGRIVAQILGLSSVKESAFLPRDVKR.... 425
352 1.000e-91UniRef50_A0A2D8MYY2 Aspartate--tRNA(Asp/Asn) ligase n=3 Tax=Planctomycetes bacterium TaxID=2026780 RepID=A0A2D8MYY2_9BACT  ali  19  119.RPISLRAPEIRAVFEVQAVLVEAFGSYLRSQDFTEI-------KSSKLVGTGTEGGANVFEIDYFGQPAFLAQSPQFYKQIMVGXGLERVFEIGPVYRAE--KHETSRHVNEYTSLDFEMGFIDEQDIXSMQIGLVGHMCAAARENCPEQLELLGKIPQVTFKEAIELLEKEWSEKEHGSDFLYVVGFPLSKRPMYTDDPETSRSFDLLWRGLEVTTGSQRIHDHGLLCEKMRERGLDPAEYDYYVSAFRHG-MPPHGGLGLGLERFTMQLLGLANVKQATLFPRDRRRISP. 433
353 2.000e-91UniRef50_A0A1V6GY13 Aspartate--tRNA ligase n=1 Tax=Thermotogae bacterium ADurb.Bin062 TaxID=1852923 RepID=A0A1V6GY13_9BACT  ali  21  130.RFLDLRDERQRTIMLMCSDFERFSRDFFYREGLREIHSP-------KIMGTASESGAEVFTVNYFDTKAYLAQSPQFYKQMAIAAGFDRVFEIAPAYRAE--KSYTNRHLTEFVSLDVELGYIDVEDVMAFEERWIVDVLDRLKEKFGVEIEIPAPFPRIRMEEAIEKEGERRIAEERHHPFVFVTHFPFSVRPFYHHDPVTSCSYDLLWNGVEITTGAQREHQYEVLKGQLAEKGMKEEPLTDYLNFFRFG-CPPHGGFGLGIARFLMALLGLENIREATLLTRDPKR.... 440
354 2.000e-91UniRef50_A0A0L6UUV7 Aspartate--tRNA(Asn) ligase n=1 Tax=Puccinia sorghi TaxID=27349 RepID=A0A0L6UUV7_9BASI  ali  18  251.RVLDLRTPVNQAIFRVQSRVCNLFRRYLDEAGFIEIHTPKIQ-------GAATESGASVFKLAYFEQTAFLAQSPQLAKQMAIAADFERVYEIGPVFRAEN--SNTYRHMTEFIGLDLEMAIEHYHEAVDLLDGLFISIFKGLQASSTKEIEIIKDFKRLRHHEAIQILKDNGHDIEFGQDMKFPLAIRPFYTMPDPVDPTLSNSYDFFMRGEEIISGAQRIHSAGLLMERMREAKIEPGEMKGYLDGFKL-ACPPHAGGGIGLERVVMLFFGLGNIRRACLFPRDPKR.... 584
355 2.000e-91UniRef50_A0A2C5ZDE4 Uncharacterized protein n=1 Tax=Cordyceps sp. RAO-2017 TaxID=2004951 RepID=A0A2C5ZDE4_9HYPO  ali  20  143.RILDLRHPSNQALFRIRSLVNRKFHEVLFDQGFVEINTPKLQ-------PAATESGAAVFKVNYFGRNAFLAQSPQLAKQMSVSADFGRVFEVGPVFRAEN--SNTHRHLTEYTGLDIEMAIEDYHEVIDVIDDFLKAVFKAVYTM-PELAEVQKRWPILDFRDGVRMLRDDKYDTDYYVLDKFPASARPFYTHKDTQDPRWTRSFDIFIRGQEICSGGQRIHNVDELRASMRAAGMAEDGMEDYLSAFDLG-APPHAGAGLGLERIVAWMLELGDVRYASLFHRDPK..... 455
356 2.000e-91UniRef50_A0A218NM48 Aspartate--tRNA(Asp) ligase n=8 Tax=root TaxID=1 RepID=A0A218NM48_9ARCH  ali  22  123.RYIDLRRLQTEAIFKIESTILNSFRNFLYNKGFNEIRT-------SSIVAEATEGGADLFPLQYFEEKAYLAQSPQLYKQMAVIGGLDKVFMIMPVYRAE--KSNDLYHLNEITQMDVEIGFSDYNDAEKLLKDTLEFIISEVVRRNDSDLKVLPETKVIEYAEVVKKLKEEKAIEKYFGESVLVTEFPAFYSMPNENNKELSHSYDLIYKGMEISSGAQRIHIADMLVDAIKERGMDPNNFKSYVDAFRCG-APPHAGWSIGLERLAMQITGMKNIRECAMFPRDRKRISP. 429
357 2.000e-91UniRef50_A0A2H0VFN2 Aspartate--tRNA(Asp/Asn) ligase n=2 Tax=Bacteria TaxID=2 RepID=A0A2H0VFN2_9BACT  ali  22  123.RWLDLRKPKSALIFKIWTTMEQALVNHCSNNGFTRIHSPKFMSS-------PSESGGELFEVKYFDRKAYLAQSPQFYKQMAMASGMERVFEIGPVFRANP--SFTSRHDTEWTSYDMEIAFIDSHDVMAEEEKLIVAMLKAVEKKYGKRVKPKRPFPQIEFFEAKKVLKSKYVMEQHGHEFVFVTNWPVSARPFYHMRPELTKSFDLLWNGLEVTTGAQREHRYNVLIKQAKEKGLSTKSLKYYLDFFKYG-CPPHGGLGMGASRMLMKLVGANNVREVTFLYRGVNR.... 435
358 2.000e-91UniRef50_A0A2G9U8X7 Aspartate--tRNA ligase n=5 Tax=Opisthokonta TaxID=33154 RepID=A0A2G9U8X7_TELCI  ali  19  90..................AGVCKLFRDTLTERGFIEIHTPKIISA-------ASEGGANVFTVSYFKGSAYLAQSPQLYKQMAIAGDFGKVFTIGGVFRAED--SNTHRHMTEFVGLDLEMAFFHYHEVLETIGAVLISIFKGLKRDYAAEIEPAEPFEILKYPEAVKMLREDKYKTDFFILDKFPLAVRPFYTMPDPHDPRYSNSYDMFMRGEEILSGAQRIHDADFLVERAKHHNIELEKIQSYIDSFKYG-CPPHAGGGIGLERVTMLFLGLHNIRLASMFPRDPKRI... 389
359 2.000e-91UniRef50_A0A2R7WW59 Uncharacterized protein n=2 Tax=Hemiptera TaxID=7524 RepID=A0A2R7WW59_ONCFA  ali  21  148..HLRFRTSGFSALLRIRNEAVIGLNDFFRKEGFLNIHTPILTS----NDCEGAGEVFTVLPVSFFDHKTYLTVSGQLHLEAA-ARAIGNVYTFGPTFRAENSKS--RLHLSEFYMAEAEMAFISSEDITSLSERLIKHMIETIMNKCAEDVDICRKFTLMSYKEASEILNKDKINKHNSNKPVFVIDWPTSLKPFYMKQDTNDQNTVLCNTVGELCGGSLRENDYNKLQQALALHGLT-EKLKWYLELRKYGNIM-TGGFGMGFERFLQAFLNIGNIKDTLPFPRWPHNCDM. 492
360 3.000e-91UniRef50_R5TKX6 Asparagine--tRNA ligase n=1 Tax=Clostridium sp. CAG:710 TaxID=1262833 RepID=R5TKX6_9CLOT  ali  19  126..YLRPRTALFQAVFRVRSILSMAIHEYFQSQGYLYLHAPIFTAS----DCEGAGEMFQVTTQDFFGKKVGLSVSTQFEAET-FAQAFSKVYTFGPTFRA--DKSHTPYHVAEFWQIEPEVAFCDLDGIMDIAEDLVKYVIKYTLDHAKDEMEYLDKFKRVPYKECIDILKKEKYLTDYFKCPFFLTMWPKELKSFYMKQMPDGTVDLEMPGIGEVFGMSQREEDLDKLVSRMKELDMKIEEYEWYIKLRKYGTCE-RSGFGIGFERLLMYITGIDNIKDVTPYPRVHKSCD.. 461
361 3.000e-91UniRef50_A0A2E5KGN8 Aspartate--tRNA ligase n=2 Tax=Thaumarchaeota TaxID=651137 RepID=A0A2E5KGN8_9ARCH  ali  20  125.RSLSLRKPEIKSIFKLRNDSLMYIRDFFINNDFLEINTPKILSL-------GAEGGATLFKTEYFDKLGFLAQSPQLYKEQLM-LAFEKVFEISHYFRAE--KSNTTRHLNEFVSVDFEWAYKNNEQTMDLCEDLIKYTINNLIKNSFKELKYLNKFDRITYQNVIDDLGEDITEHEKHKSFYFITDWPSEIKPFYHKDSDLSMSFDLQFSNVELVSGGVRIHKVDELEKNMKKSGLDIKNFKSHLQTFKWG-MPPHSGLGLGFDRLIMILANRKNIREVVLYPRDKDRLEP. 431
362 3.000e-91UniRef50_A0A166BAS5 Asparaginyl-tRNA synthetase n=1 Tax=Exidia glandulosa HHB12029 TaxID=1314781 RepID=A0A166BAS5_EXIGL  ali  24  137LPHLRTRTQAHAHIIRERDRLMRGFHSYFETNGFYHIHTPALTQ----NDCEGGGEAFALAAPDMFGHPAYLTVSAQLHLE-AMAAALPRVYTLSPAFRAES--SATSRHLSEFWMLEAELAFADLEDIMALTEGCVRAVLPKASDTDPS------PWPRITYAEYEPRHGDPLRSDHENDRPVFVTSYPAAHKPFYMLPNDDACFDLLIPRVGELAGGSLREHRLDRLQDAMKRHGVNERELEWYLDLRRWGST-PHGGFGLGFERLVAFVTGTESVKECVPFPRWAGR.... 444
363 3.000e-91UniRef50_U4U7G8 Uncharacterized protein n=4 Tax=Dendroctonus ponderosae TaxID=77166 RepID=U4U7G8_DENPD  ali  21  133..HLRPRTKTFASVLRLRHAAYLAIHNYLHQNHYINIHTPIITA----NDCEGAGETFVPFDNAYFDTKAYLTVSGQLHLEAA-AHALNKVYCFGPTFRAENSIS--RFHLSEFYMLELEQAFLDDLDDLLVVEKMIKHVTADLLEHNFSDLEIDKEFKRIPHEEALDIVGDEVALTHYFGHPVFIINWPKEEKPFYMNDDQVAAFDLLAPSVGEIVGGSLRENSYEKLKAQIPE---SNSQLDWYLDLRRFGSV-PTGGFGMGFERYLQLVLGVQTIKDCIPFPRWPHNCKL. 461
364 4.000e-91UniRef50_Q74MV5 Aspartate--tRNA ligase n=1 Tax=Nanoarchaeum equitans (strain Kin4-M) TaxID=228908 RepID=Q74MV5_NANEQ  ali  22  102.RIIDLKLPERQTLFRLRAKVQKFFRDWFMENGFVEINTPKIVII-------GAESGAEVFPVLYFGKEAYLTQSPQLYKQM-MVSVFPKVFEIAFAYRAEP--SRTSRHLAEFTSVDAEMGFIKDEDVINTIKKMLIDVSEKAMQT-KEFEELAKPFEIITFDEAKEIVKEERKLGEHFMEFVAVTKYPPFYTMRLDDNPSYTRGFDIIFRGLEIISGAQREHRYEKLLENIKEKGIDPNKLEYYLMAFKYG-MPPHGGFGLGLERYLRQLLGLDDVREVILFYRDIDR.... 401
365 5.000e-91UniRef50_A0A0L1HCW6 Aspartyl-trna synthetase n=32 Tax=leotiomyceta TaxID=716546 RepID=A0A0L1HCW6_9PLEO  ali  19  364.RIIDLRTTASQGIFRIQSGICKLFREQLDSEGFIEIHTPKLQ-------GGATESGASVFKIEYFGRGAFLAQSPQLAKQMAISADFGKVYEIGAVFRAEN--SNTYRHLTEYTGLDLEMQIEHYHEVLRVLDRTFKAIFKGIYERFRPEIEIKKHFPIIPFAEGIRMLNKEKLGTDYYILDKFPASARPFYAMNDPNNPALTNSFDIFCRGQEILSGGQRIHDADMLLDKMRKLKVDPSSMEDYIQGFQWG-APPHGGGGIGLERILMLMMGLGNIRHASMFPRDPK..... 684
366 6.000e-91UniRef50_A0A1D2MA01 Aspartate--tRNA ligase, mitochondrial n=1 Tax=Orchesella cincta TaxID=48709 RepID=A0A1D2MA01_ORCCI  ali  22  219.RHLYIRNPRSQSVLRRRALFLGNVRRFMDANHFIEVETPTLV----RRTPGGAREFPVVTRVK--NAYYALAQSPQILKQLLMCGGMDKYYQIARCYRDEGGKPD---RQPEFTQLDIEMSFTTREDVMRLVEDLLKYSL-------PEELLPKPPFPIMTYAECMSKYGSDKPDT---GGFLWVVDFPLFLKGEESNRLEAAHHYDLVYCGAEVGGGSIRIHDPKLQKHVFGKLGLKLEEIDYLLEGLESG-APPHGGFALGVDRFLAKVMGTKSIRDVIAFPKTSQGKDAL 522
367 6.000e-91UniRef50_A0A0G1CN81 Aspartate--tRNA(Asp/Asn) ligase n=13 Tax=Microgenomates group TaxID=1794810 RepID=A0A0G1CN81_9BACT  ali  20  120.RYLDIRRPRMTRNLRLRSQVTTFIRNFLAGRDFVEVETPILT----KTTPEGARDFIVPSRLQP-GKFYALPQSPQQYKQLLMVAGLERYFQIARCFRDEDPRKD--RAYGEFTQLDLEMSFITQEDILRLTEELFTQIVTTI---FPGKRIQTSPWPRIPHAEAMAKYGTDKPDLRLDKNDPDLIDFPKFAPSHHMFTAPHPDDIDLVLNGFEVGGGSIRIHDPKVQAKIFELIGFSEEQFAHMLTAFTYG-VPPHGGIAPGIDRFMMAVLGEPSVREVMAYPTSASGQ... 439
368 6.000e-91UniRef50_A0A2H9NSS7 Aspartate--tRNA(Asp/Asn) ligase n=10 Tax=Archaea TaxID=2157 RepID=A0A2H9NSS7_9ARCH  ali  21  108.RFLDFRNKRTLAIFKIQNQILKSFRDYLFSENFIEIQPPAII-------GAASEGGTEVFSVPYFEKQAYLAQSPQLYKQMGAIS-FGKVCMVTPVWRAE--KHNTVTHLNEIRQMDIEMGFISEEDVMKIAENTLVKILQNISKNCKAELEPKLPFRRATYSECIEEWGEDKMLKEIFGEVFFLKEWPSEAKPFYTMPNKDCRAFDIIYQGLEVLSGTQRIHIPDLLIQRIKDKGLNPESFKPYIDCFRFG-APPHGGWSFGLERLTMVITGLSNVREGCMFPRDRTRLNP. 415
369 6.000e-91UniRef50_D3PLE8 Aspartate--tRNA(Asp/Asn) ligase n=32 Tax=Terrabacteria group TaxID=1783272 RepID=D3PLE8_MEIRD  ali  21  114.RYVSLRGEKARAPLKIQAALVRGFRSYLDSQGFTEIFTPKIVSA-------GAEGGSNLFGIDYFEHRAYLAQSPQLYKQI-MVGVFERVYEVAPVFRAE--QHATSRHLNEYLSLDVEMGFIESEDVMDLEEELIRAMLDEARHTAAPECELLGEMPRLEHPEARRILREEWAKEKWGVDFLFISKYPESARPFYAYPDGSTRGFDLLFRGLEITSGGQRIHQYEVLVEQLKKKGNDPAHFAGYLEVFKYG-MPPHGGFAIGAERLTQKLVGLPNVRYARAFPRDRHR.... 420
370 6.000e-91UniRef50_A0A1Y2IK95 Asparaginyl-tRNA synthetase n=1 Tax=Trametes coccinea BRFM310 TaxID=1353009 RepID=A0A1Y2IK95_PYCCO  ali  21  132..HLRARTREIGAMLRLRDSAATAIHDYFHNNGFIHVHTPIITS----NDCEGAGETFQSTPSEYFHHPAYLTVSSQLHLE-AVAAAISRVYTLSPCFRAE--RSQTSRHLAEFWMLEAEWAFTSSDDVCTVVEGALRHLLRAHADKRPELLALPQPWTRLTYTAAVDLLHERWLAEEHVRGPVFVTDYPASLKPFYMRANDASCFDLLVPGVGELVGGSLREERLELLEAAIERHGLDRADYAWYLDLRRYGGA-PHGGFGLGFERLISWMSGIESVRECVAMPRWAGRMLL. 501
371 6.000e-91UniRef50_E2AI73 Asparaginyl-tRNA synthetase, cytoplasmic n=8 Tax=Formicidae TaxID=36668 RepID=E2AI73_CAMFO  ali  21 1398.RHIMIRGENTSKVLIMRSILVQAFRDHYRDRGYYEVTPPTL-------VQTQVEGGSTLFKLDYFGENAFLTQSSQLYLETCMP-AMGDVYCVAQSYRAE--QSRTRRHLAEYTHIEAECPFILEDLICDVVERVLQSPFGHVQELNPGFQIPKRPFKRMNYTDAIEEFGEDRKMTDAINEPILLCRFPVEIKSFYMQRCAENERDVLLPNVGEIVGGSMRIWNYEELLEGYKRENIDPTPYYWYTDQRKYGSC-PHGGYGLGLERFLCWLLNRYHIREVCLYPRFMERC... 1711
372 6.000e-91UniRef50_A0A2H9MMY2 Aspartate--tRNA ligase n=10 Tax=Archaea TaxID=2157 RepID=A0A2H9MMY2_9ARCH  ali  19  113.RFLDLRNPKKMAIFKIKQVFISTAREFLESEDFIEIHSP-------KIVGTGAEGGSEIFPIVYYSREAFLSQSPQLYKQLGLACGFEKVFEIGANYRAE--KSHTTRHLTEYIGLDLELSFIESEDLMDLEEKMLKYCLEKVKEKCEATIKIPKPFPKIAISEAFKKLNEEKIEKETGSQFVFVTKYPPFYTMKDEKDPTLTKSFDLLWKGLEITTGSQREHRHNILINQCKEKGVPTQSIATYLEAFKYG-MPPEGGMGIGIERIIMQMLNLSNIREASFFPRTAERLEP. 424
373 6.000e-91UniRef50_A0A2E9CFJ5 Asparagine--tRNA ligase n=1 Tax=Candidatus Heimdallarchaeota archaeon TaxID=2026747 RepID=A0A2E9CFJ5_9ARCH  ali  21  154.RHIVLRGPKSSSVLRLASHVLKYLRDFFYERGLEEVFPPLITEAQ-------AEGGSEVFELKYFDNTAYLTQSSQLYLEAAIYS-LRDVFCILPSYRAE--KSRTKRHLTEYRHVEAEFSFANFEYLKDFIEDMIIYIADKVNENDKDILVPNKPFKRISYSAAIDLLKSEFNIEEYFDEPIILEHFPTFMKPFYHNDKITNSADFIFPICGELVGSGERETDLNSMMERMKKMDLNYDDYYWYMDLRKYGSV-PHSGFGLGLERLIQWLLGLDNVRDVTLFPRTVNRLSP. 465
374 8.000e-91UniRef50_S3BVB7 Asparaginyl-trna synthetase n=10 Tax=Sordariomycetes TaxID=147550 RepID=S3BVB7_OPHP1  ali  21  194MPHLRPRISTNAALLRFRSDVIASLNRFFASRDFVQTQPPLITSS----DCEGAGEVFSVSPPDFFRSPKYLTVSTQLHLE-ALAQAVGNVWTLSPTFRAE--ESDTPRHLSEFYMLEAEVSFVDRMDVMDLVEDMLRFVAAEVVEQRWQGLLSPERWPRITYTEAVAMWGAPLQTEHEVKTPVFVTQYPRASKAFYMLPDTVDCFDLLVPDFCEIAGGSMREHRLAELVSAMKARGMPVSTLGWYVDLRRWG-CPPHGGFGLGFDRLLCYLTGVQTIRDMVAFPRWYGRCDC. 577
375 1.000e-90UniRef50_A0A2V0NVJ4 Asparaginyl-tRNA synthetase n=1 Tax=Raphidocelis subcapitata TaxID=307507 RepID=A0A2V0NVJ4_9CHLO  ali  27  309.......................................................DGAVDYGRDFFGEKTFLTVSGQLNGEMY-ACAMGDIYTFGPTFRAEN--SNTARHLAEFWMIEPEIAFADLEDDMACAEAYLKHCTRHILKHCEEDLAFNKPFATVTYTEAVRLWGLDLQSEHFNRTPLFVTDYPRDIKAFYMRQNTVAAMDLLVPRVGELIGGSQREERLDVLSDRMRACGLEPDDYSSYLDLRRYGSV-PHAGFGLGFERLVQFSTGVENIRDVIPFPRWPGHC... 572
376 1.000e-90UniRef50_A0A1J5WM82 Asparaginyl-tRNA synthetase n=1 Tax=Amphiamblys sp. WSBS2006 TaxID=1866961 RepID=A0A1J5WM82_9MICR  ali  20  221.RHLVHRGERTAAIMKTRAEALHAFRMHYRARGYVEMTPPCL-------VQTQCEGGSTLFHVKYFGEDAYLTQSSQLYLET-VCPAHGDVFCIQPSFRAEG--SRTRRHVAEYTHVEGECVFIDFEELLLRAEDLVCDTVEEVLKLNPEFTAPSRPFQRMDYSDAISWLRERDIKKEDGTDFVFLTRFPAKMKAFYMSRDPKNPFDLLLPNVGEVIGGSMREPDYDALLERFREEGLPEERYYWYLDQRKYGTF-PHGGYGLGFERFITWILGLHHIRETCMYPRYVGRCEP. 536
377 1.000e-90UniRef50_Q7VR09 Asparagine--tRNA ligase n=17 Tax=cellular organisms TaxID=131567 RepID=SYN_BLOFL  ali  19  125VAHLRPRTHIFGAISRIRHVLFQSIHNLMNTKGFIWVPTPIITAS----DTEGNSKMFYVSPELFFGKEAFLTVSGQLNVESY-ACALTKVYTFGPTFRAE--HSNTNRHLAEFWMLEPEMAFTDLNIIIKIADSLLKDIVQTILEQCINDIELHSKIIHIEYTDAIKLLHEKYLSEEYFQSPIVIKNHPKNIKAFYMRNKTVSSMDILVPGIGEIIGGSQREERLSILDKRLLENNLKTECYWWYRDLRRYGTV-PHSGFGLGFERLIIYITGLTNIRDAVPFPRTINSI... 468
378 1.000e-90UniRef50_B7QIG4 Asparaginyl-tRNA synthetase, putative n=2 Tax=Bilateria TaxID=33213 RepID=B7QIG4_IXOSC  ali  19  149.RHLAIRGETHSKIMFAKSAVMQCFRDYYFSKHYVEVIPPTM-------VQTQVEGGSTLFSFNYFGEEAYLTQSSQLYLETVIPS-LGDVFCVAQSYRAE--QSRTRRHLSEFTHIEAECPFLTFDEFLDRIEDLVVGVCERVLELNPEFKVPERPFLRMQYSEAIEYLRTERQMTDQINRPILLCRFPAELKAFYMQKCADDPRDLLMPGVGEIVGGSMRMWDAEELVQAFQRKGIDPTPYYWYIDQRKYGTC-PHGGYGMGFERFVTWVLKRHHIRDVCLYPRFVGRCKP. 464
379 1.000e-90UniRef50_A0A1Y2E5T8 Uncharacterized protein n=7 Tax=Opisthokonta TaxID=33154 RepID=A0A1Y2E5T8_9BASI  ali  19  274.RILDLRTITNQSIFKMSSGVCNLFREYLNSQGFVEIHTPKLQ-------GAATESGSSVFKVSYFKGNAYLAQSPQLAKQMCIAADMEKVYEIAPVFRAED--SNTHRHMTEFMGLDMEMAFEHYHEVMETIDGMLKSIFAGLKQRYADDIAVVQKFPVLHYTDAIKLLQEEKYKTDYYIIDKFPIALRPFYTMPDPTNPLLSNSYDFFMRGEEILSGAQRLHDAPMLEERMRAVGINPDDMKSYVDGFRLG-APPHAGGGIGLERVVMLFLKLNNIRRASLFPRDPKR.... 596
380 2.000e-90UniRef50_V4A8A6 Uncharacterized protein n=4 Tax=Bilateria TaxID=33213 RepID=V4A8A6_LOTGI  ali  20  103..HLRPKTKTHSSLLRVRNTASMAVHQYYQDKGYCFVHTPILTT----NDCEGAGEVFQIQPMKFFRCPTFLTVSGQLHLEI-ITGGLNKAYNFGPTFRAENSKG--RHHLAEFYMIEAELCFLDLDQLMEVMEDMIKTITSSILTTSHSDVELNSKFERMRYTEAVDKWGDDLSKEHELDCPVFITDYPATLKPFYARANEDGKTDLLVPEVGELIGGSLREERLKFMDEKLKSLKLSEE-YQWYLDLRRYGT-NPHGGYGLGFERYLQFLLGVSNIRDVIPFPRSSSHCQL. 432
381 2.000e-90UniRef50_A0A163DM98 Aspartate-tRNA ligase n=1 Tax=Didymella rabiei TaxID=5454 RepID=A0A163DM98_DIDRA  ali  20  230.RTLDLRAKINQSIFVVKSGVCAIFQEFLSKKGFTLVQTP-------KILGAASEGGANVFELKYFDRQAYLAQSPQFYKQMLIASRFQKVMEIGPVFRAEN--SNTARHLTEFTGLDLEMEFEHYHEVMGVLEDLMLFIFKELNVRYKRETDLIREFPRIPFTEGIKMLRDEKYNSDFYVLDQFPLAIRPAYTMPSPHDPKLSNSYDMFMRGQEICSGAQRIHNSELLSKQMREHDPPIDPNGDYVDCFRYG-CPPHAGGGFGLERIVQFWLGLPNIRMCSLFPRDPQRV... 552
382 2.000e-90UniRef50_C3ZZX4 Uncharacterized protein (Fragment) n=4 Tax=Bilateria TaxID=33213 RepID=C3ZZX4_BRAFL  ali  22  96.PHLRARTNSFSALLRIRSQAASAIHKFFQDEGYIEVHTPVISS----NDCEGAGELFQVKTKHFFDVPAFLTVSGQLQLEV-MASALSRVYVFGPTLQQESC-------LSEFYMVEAELAFTQQEDVMEVIEMMVKQPTEQILALCPEDLHLFYKFIRMTYTEAIQIWGHDLQKEHEGSVPVFVTDFPKELKPFYARDNDDDKFDLLVPEVGELFGGSLREERLEILQDRLDRLGLS-NSYQWYLDLRRYGSV-PHGGFGMGFERYLQCILGVPHIRDVIPFPRFPHSCKM. 423
383 2.000e-90UniRef50_A0A2B7XE97 Aspartate-tRNA(Asn) ligase n=7 Tax=Eurotiomycetidae TaxID=451871 RepID=A0A2B7XE97_9EURO  ali  19  291.RILDLRTDTSQSIFRIQSAVCNLFRAALDAQGFIEIHTPKLQSS-------ATESGASVFEVKYFSRDAFLAQSPQLAKQMAVASDFERVYEIGAVFRAEN--SNTHRHLTEYTGLDMEMAIEHYHEALEAIDSVIKEIFKGLYGRYRREVDIVKETPIIPFSEGIKLLNEENYHTDYYILDNFPKSARPFYTMEDPENPEFTNSFDIFVRGQEIVSGGQRIHDEKILAQRMKDAGIDPSTMEEYMEGFRWG-APPHAGAGIGLERLIMLILKLGNIRLASLFHRDPK..... 610
384 2.000e-90UniRef50_A0A1B7SEU6 Uncharacterized protein n=1 Tax=Ogataea polymorpha TaxID=460523 RepID=A0A1B7SEU6_9ASCO  ali  24  147....RWRVPEAVSILRMSSKLESSFSKFFEEHSFFKTHPPMVTSS----DCEGAGELFRISPEQFFGKKAYLTVSTQLHLEVL-CAALGRVWTLTPCFRAE--ESDTNRHLSEFWMLEAEIAFID--DVSQLTEELLRYVARTVQNSGFDEFPEETKYTQISYSEAIDLWGEKWLAGEYYKGPVFVTNYPEDQKPFYMKKNNDACYDLLIPQIGELIGGSLREHDLHKLEQEISDRQMDIGPLQWYLNLRKNGSV-PHGGFGMGFERLLQYMSGAENIRDTIPFPRTTKHCAC. 469
385 3.000e-90UniRef50_A0A2P4N925 Aspartate--trna ligase, cytoplasmic n=3 Tax=Quercus suber TaxID=58331 RepID=A0A2P4N925_QUESU  ali  18  316.RIIDLRTTASQGIFRIQSGVCYAFRNNLSALGFIEIHTPKLQ-------GAASESGASVFKVDYFGRPAFLAQSPQLGKQMAISGDMRRVFEIGPVFRAEN--SNTHRHLTEFTGLDLEMAIEHYHEVLRVLDSTFKAIFKHIYDNYKSEIEVVKETPIIPFAQGIRMLNEEKLGTDYYVLDKFPASARPFYAMPDPSDPKLTNSFDIFLRGQEILSGGQRIHDAVMLEKKMESLKMNPKDMEEYMTGFEWG-APPHGGGGIGMERILMLLLKLGDIRHATMFPRDPR..... 636
386 3.000e-90UniRef50_A0A0G0NIV3 Aspartate--tRNA(Asp/Asn) ligase n=19 Tax=Bacteria candidate phyla TaxID=1783234 RepID=A0A0G0NIV3_9BACT  ali  21  134.RVLGVRNINEGKVFRIRSELNRYLREFLNQNEFVEIQTP-------KILAGATEGGAEVFKFDYFGKEATLAQSPQFYKQI-MVGAFERVFEIGPTFRAEP--STTSRHLSEITMLDIEMGFISHDDVLKMTENLLYNVLTKIYGEHVEELKLKPSFPRYTYAKAEEKWICDYSKKENGCEAVFVTEFPKFYHMINPQDTTTVLWADLLFRGLEIATCPMREHRYQNLVAQMKKAGLNPEHYKYYLQAFKFG-LPPHGGFGFGIDRFLEKILGLGNVKEATLFPRDINR.... 447
387 3.000e-90UniRef50_A0A109V016 HGL199Wp n=3 Tax=Ascomycota TaxID=4890 RepID=A0A109V016_9SACH  ali  18  236.RHLVLRGETISAVMKVRAAFLKSIRRVFDEEGLTEVTPP-------CMVQTQVEGGSTLFKLDYYGEEAYLTQSSQLYLETCLPS-LGNVYCIQESFRAE--KSHTRRHLSEYSHIEGELCFLSFEDLLDHIERLITNTVKYILEDNPGFEAPTTPFMRLEYKDAITWLNEERKMTDTIGVPIFLTRFPLTLKSFYMKRCADDPRDVLMPNVGEITGGSMRIESTEELMAGITREGIDPSSYYWFIDQRRYGTS-PHGGYGIGTERILAWLCNRYTVRDCSLYPRFTGRCKP. 552
388 3.000e-90UniRef50_A0A0L1HD61 Wd repeat-containing protein mip1 n=1 Tax=Stemphylium lycopersici TaxID=183478 RepID=A0A0L1HD61_9PLEO  ali  20 1688.RTLDLRAKINQSIFVIKSGVCALFQEFLSKKGFVLVHTP-------KILGAASEGGANVFELKYFGRPAYLAQSPQFYKQMLIASRFQKVMEIGPVFRAEN--SNTARHLTEFTGLDLEMEFENYHEVMGVLEDLMLFIFNELNARYSKETELVRPFPRIPFQEGIKMLREEKYNTDFYTLDQFPLAIRPAYTMPSPADPALSNSYDMFMRGQEICSGAQRIHSSALLADQMRKHDPPIDPAGDYVDCFKYG-CPPHAGGGFGLERIVQFWLGLPNIRMCSLFPRDPQRV... 2010
389 3.000e-90UniRef50_A0A252F670 Aspartate--tRNA ligase n=1 Tax=Butyricicoccus porcorum TaxID=1945634 RepID=A0A252F670_9CLOT  ali  23  127.RPVTLRHPRMKAIFRIQGALCDGFAEYMMSQGFVHMNSP-------KIVAAGAEGGANIFKLDYFGQKAYLAQSPQFYKQ-YLAGVFGRVFEIGGVYRAE--RHSTSRHLNEYIGLDFEMAYIDMKDVMEMETGMLKYVMDYIRAHCKPELELLKTIPSITFKDALDKFGCDYAKSELGSEFIFVTHFPPFYAKDDPSDPSLALSFDLLFRGLEITTGGQRINDYQEQVDKLNARDMDVSLFESFLLLHKYG-MPPHGGLGIGLERLTMQLLGLKNIREAAYFPRDMSRLIP. 440
390 4.000e-90UniRef50_A0A1I6I0V9 Aspartate--tRNA(Asp/Asn) ligase n=43 Tax=Archaea TaxID=2157 RepID=A0A1I6I0V9_HALSD  ali  23  121.RALDLRKPETLAVFTLRSELITAMEEWFDDEGFVDIKTPLISK-------GGAEGGAELFPILYYNQDAFLSQSPQLYKQMLMASGYEAVYETGTAFRAEDF--ATSRHVSEIAMFDVELAYIDHDDVMDVQEASLRHALREVAENAERELDLLDDFPRITFDEALDILETEYHFEERGHPAFFVVGYPKFYYMQDVPDDEISRKFDLIYKGQELSSGGQREHDVERMVEVMEAEGVETGNFEFYIEALSYGT-PPHGGYGLGIDRLVQKVAGLDNIKEAIMFPRDPNRLEP. 434
391 4.000e-90UniRef50_E9G1G5 Uncharacterized protein n=7 Tax=Daphnia TaxID=6668 RepID=E9G1G5_DAPPU  ali  23  82..HLRPKTNIYSAILRLSSLITNALQTTLIQDNFVSVFTPILTS----NDCEGAGEVFLTRPESYFNKKVYLTVSGQLHLE-AIAGGISKVFTLGPTFRSENSRS--RRHLAEFRMLEAEIAFCDLQPILSTIESLVKHSAKVILEHGALDLVLKSPFTTISYREAMELLEHELFLVKHMGGPTFLVDWPAKIKPFYMRNSLVSCVDLLVPGVGELCGGSLRENRYDILKSRLESLNL-EESLSWYLDLRKYGGS-PTGGFGMGVERLISYLLKIPNVKDIVPFPRTPHNCPM. 421
392 4.000e-90UniRef50_A0A1F5YI80 Asparagine--tRNA ligase n=14 Tax=Patescibacteria group TaxID=1783273 RepID=A0A1F5YI80_9BACT  ali  24  117.RHLWLRSRKQWAIQRIRNVIIYAIYDYFAKEGFIKIDAPILT-------PNACEGTTTLFPVPYEGTKAFLSQSGQLYLEAAI-MAHGKVFDFGPTFRAE--KSKTRRHLTEFWMMDAEAAFVEHKENMKSQEKLIVAIVEEVLRRCSKELEIIENFPVISHQKAVDILHKEKFHSQKFDKPLFIEKYPKEIKAFYMKEDPSDNTRVLPEGFGEIIGGSQREDSYERLLDRIRQLKYPLEDYQWYLDLRRYGSV-PHSGYGLGLERLVTWICSLTHLRESIPFPRMMER.... 452
393 4.000e-90UniRef50_A0A0F7SQ69 Putative cytochrome c oxidase, subunit COX19 n=1 Tax=Phaffia rhodozyma TaxID=264483 RepID=A0A0F7SQ69_PHARH  ali  21  365.RAVSLRTADAHAIFRVTAAVTRAARGFLDSHDFLEIH-------SAKLQQGATESGASVFKVEYFGREAFLAQSPQLAKEMCIGADLERVYEIGPVFRAEN--SNTHRHLTEYTGVDLEMAISSYHEAMHMIDNMLKHIFRTVQKECAKEIDVVRKFPVLTFKQGVQLLMKEKYNTDYYILDKFPVAARPFYTMPDADNPEITNSFDVFVRGEEIISGGQRIHSAAVMKERLKKAHIAESSMSDYLEAFQA-AMPPHAGGGIGLERLVMLFLKLGNIRHATLFPRDPH..... 681
394 4.000e-90UniRef50_A0A016TDL4 Uncharacterized protein n=13 Tax=Bilateria TaxID=33213 RepID=A0A016TDL4_9BILA  ali  20  230.RHLVIRGENASRILRIRAAATRAMREHFYHAGYTEICPPTL-------VQTQVEGGSTLFALDYFGEQSYLTQSSQLYLETCIAS-LGDVYCIAQSYRAE--KSRTRRHLAEYAHVEAECAFITFEQLMDRIEDIVCDTVDRLMADNPEFKPPQRPFRRMTYTEAIQWLGEDRKMTDTIGVPILLNKFPAGIKSFYMARCQDDNEDLLMPGVGEIVGGSMRLWREEELHKAFIGAGIDPKNYFWYMDQRKYGAV-PHGGYGLGLERFICWLTNTHHIRDVCLYPRFIGRCAP. 569
395 4.000e-90UniRef50_A0A0G1DET5 Aspartate--tRNA(Asp/Asn) ligase n=73 Tax=root TaxID=1 RepID=A0A0G1DET5_9BACT  ali  22  122.RYLDLRRQRMLDNLLLRSRVTTYIRNYLTGRDFIEVETPILT----KTTPEGARDFIVPSRLQP-GNFYALPQSPQQYKQLLMVAGLEKYFQIARCFRDEDPRHD--RAYGEFTQLDIEMSFVQQEDILNLTEGLFTEMVGKL---FPEKHISQKPWPRLAHRDVLKKYGSDKPDLRRDRKFAWIIDFPKFAPSHHMFTAPHGQQHDLVLNGYEVGGGSVRIHEPQIQEQVFDLIGFTKEQFEHLLTAFKYG-VPPHGGIAPGIDRFLMTVLGEPSLREVMAFP......... 435
396 4.000e-90UniRef50_F7W3I4 WGS project CABT00000000 data, contig 2.24 n=17 Tax=Sordariomycetes TaxID=147550 RepID=F7W3I4_SORMK  ali  22  215IPHLRPRTPINAALLKMRSEAVAALTRFFADHDFTQTHPPILTSS----DCEGAGEVFTVAPASFFRNKKYLTVSTQLHLE-ALAQSVGNVWTLSPVFRAE--KSDTARHLSEFYMLEAEMSFVDLDEVMDLAEDMIRNMCEFLNREGRVGSDLVSPWPRLTYTDAIEFLQEDKFEHKPVWKPVFVTHYPRDIKAFYMREPTVECFDLLVPDLCEIAGGSMREHRLEPLLEAMKRHNIVAGEFDWYVDLRRWG-CAPHGGFGIGFDRLLCYLTGVQTIRDMVSFPRWVGRCDC. 588
397 5.000e-90UniRef50_A2FRT6 Asparaginyl-tRNA synthetase family protein n=1 Tax=Trichomonas vaginalis TaxID=5722 RepID=A2FRT6_TRIVA  ali  21  306.RHLVLRSEFASTTMKVRDHLTRIIRENFYKHDCTEVVCPCL-------VQTQCEGGATLFGLDFYGQKAYLTQSSQLYLETC-CASMGDVFCIEPSFRAE--KSKTPRHLCEFTHIEAEYPFIDFDELMSRIEDMVIAVVNGLLEHNPDLKPLKKPFKRITHKEALEKWKDDRTLVDTIGELCFMTKFPAAIKAFYMKRCPEDNCDLLVPGVGEIVGGSMRLECYDELMNAYLVNGLDPAPYYWYVDQRRYGHF-PHGGFGLGTERLVRWILKIGHIRETCLYPRIMNRA... 622
398 5.000e-90UniRef50_A0A0C9R925 NARS_0 protein (Fragment) n=34 Tax=Eumetazoa TaxID=6072 RepID=A0A0C9R925_9HYME  ali  20  270.RHIMIRGENTSKILKIRSVVIQAFRSHFFDRGYNEVNPPTL-------VQTQVEGGSTLFKLQYFGEEAYLTQSSQLYLETCLP-ALGDVFTVSQSYRAE--QSRTRRHLAEYTHIEAESPFITFDDVCDVVDRILKSPWGSVRELNPEFKPPKKPFRRMNYADAIKWLKEERKMTDTINEPIMLCRFPLAIKSFYMARCPEDSNDVLLPNVGEIVGGSMRIYNYEELLEGYKREGIDPTPYYWYTEQRIYGT-QPHGGYGLGLERFLCWLLNRYHIREVCLYPRFLDRCKP. 585
399 6.000e-90UniRef50_A0A075HLK1 Aspartate--tRNA(Asp/Asn) ligase n=67 Tax=Archaea TaxID=2157 RepID=A0A075HLK1_9ARCH  ali  23  166IRAIDLRRNTLQQVFKARSNVLKSIRQYFYDQNFTEINTP-------KMIATATEGGAALFPIFYYNKEAFLAQSPQLYKEQL-TMSFEKVFEIAPIFRAEP--SRTNRHLSEAISIDFEEAYVDYNDVMSRIEQIIKQTILSMQEFSKDDVEFTIPIPRYTYSDLLEKWGDDLYPAQLNKGFYFIKDWPPFYVKVSNDNPKISESFDLMYGDLELSSGSTRIAKKSELEDRMKNKGMKIDTFGYHLGVFDYG-VPPHAGCGIGLERLMMALTGIDNIRDTTFYPRDVDR.... 468
400 6.000e-90UniRef50_A0A2T0FDU9 Asparagine--tRNA ligase, cytoplasmic n=1 Tax=Wickerhamiella sorbophila TaxID=45607 RepID=A0A2T0FDU9_9ASCO  ali  18  239.RHLALRGDALTSIMKVRAALLKSIRSVYEDEGITEVTPPCLVQSM-------VEGGSTLFKLDYYGQNAYLTQSSQLYLETCVP-ALGDVYCIQESFRAE--RSHTRRHLSEYTHIEAELGFLTFEELLGHVERMFVSLVDKVLKDNPKFEPPQLPFMRMTYVDALEWLNEERKMTDTINKPILLTRFPVEIKSFYMEKCKDDPRDVLMPNVGEVMGGSMRISKLDELMAAFKRENMDPAPYYWFSDVRKYG-AFPHGGYGLGTERILAWLCDRFTVRDCSLYPRFP...... 550
401 6.000e-90UniRef50_U5H8P9 Asparaginyl-tRNA synthetase n=3 Tax=Microbotryum TaxID=34416 RepID=U5H8P9_USTV1  ali  17  265.RHLVLRGETASTVLKVRAALLQSFRDSYANLGLLEVTPP-------CMVQTQVEGGSTLFSFDYYGAPAYLTQSSQLYLETCLPS-LGDVFCVAESFRAE--KSHTRRHLSEYTHVEAELAFLTFNELLDHLEEVICQTVDRVLAEPKSFQAPQRPFMRMDYRDAIKYLNDERKMTDQIGKPIFLVGFPKEIKSFYMQRIKGDEVDLLMPNVGEIVGGSMRMDNLEELMSALKHEGIDPAPYYWYTDQRKYGTS-PHGGYGLGLERLLAWMCNRYTVRDCSLYPR........ 581
402 7.000e-90UniRef50_A0A1W9N713 Aspartate--tRNA(Asp/Asn) ligase n=20 Tax=Spirochaetes TaxID=203691 RepID=A0A1W9N713_9SPIO  ali  22  116.RMISLRNPKLLAIFRIQAVCVQAFGDFFRSEGFTEI-------KSSKIIGGGSEGGTNLFPLDYFGKKAYLAQSPQLYKQAMVAAGLERVFEIGHAYRAE--KHETPRHINEYVSLDVEMGFIDSEPLIELERRFMAYLFETVRRDNARELDVPNPIPIVSYDEAKDIVKKDWAQKEHGIAMVFINDFPRRKRPFYYPRDQKTMSFDLLFRGLEITTGGRRIHEYPMLLEALPKYGLKESDLGAYMDIFKYG-CPPHGGFALGLERITQKILGLANIKEATLFPRDRQRVAP. 427
403 8.000e-90UniRef50_A0A1V8T4A5 Uncharacterized protein n=7 Tax=leotiomyceta TaxID=716546 RepID=A0A1V8T4A5_9PEZI  ali  19  351.RIIDLRTTAAQSIFKIQSGICEAFRTHLSSLGFIEIHTPKLQ-------GAASESGASVFKVDYFGRPAFLAQSPQLGKQMAIASDLRRVFEVGPVFRAEN--SNTHRHLTEFTGLDLEMEIEHYHEILRTLDSTFKAIFSHLYTNFRHEIDWLEKTPIIPFAEAIRMLNEEKLGTDYYVLDKFPASARPFYAMPDPHNPGLTNSFDIFCRGQEILSGGQRIHDAAELIKKMEALKMDPKSMEEYLSGFEW-AAPPHGGGGIGLERILMLILQLGDIRHATLFQRDPR..... 671
404 8.000e-90UniRef50_A0A0E9NDM1 Uncharacterized protein n=2 Tax=Saitoella complicata NRRL Y-17804 TaxID=698492 RepID=A0A0E9NDM1_9ASCO  ali  21  156..HLRPRTSSTSALLRLRSKTMSALNNFFDTQSFTQTHPPILTSS----DCEGAGEVFSISTSTFFGHSTYLTVSTQLHLE-ALAHGLGRVWCVCPAFRAET--SLTNRHLAEFWMLEAEVAFVEQGELMTLTEEMIRHVAKGLLENNDTKIDLPSRWRRMSYTTAVNIWGEKWLAGEFVKGPVFVHDYPASLKPFYMLPATVACFDLLVPEMGELVGGSLRQHDAAALESQIEKAGMKAEEMAWYVELRKWGSV-PHGGFGMGFDRFLAYLGGVENLREVVAFPRWAKHC... 507
405 9.000e-90UniRef50_A0A1S4EB27 probable asparagine--tRNA ligase, mitochondrial n=1 Tax=Diaphorina citri TaxID=121845 RepID=A0A1S4EB27_DIACI  ali  23  36..HLRSRTKSFASLLRLRSFMTQYTHQYFHQQGFVNIHTPILTS----NDCEGAGEVFTVIPDSFFGEKAYLTVSGQLHLE-AMARSLSKVYTLNPTFRAENSKS--RLHLAEFYMIEAELAFLDIHDLCNTIEQFIKSVLNRVLESHEEELDLQNPFIRMSYSAAVTILHELFLVKYTNNVPIFIINWPKHVKPFYMKRSGEDPDQVLCPLVGEVCGGGLREDDYSILQSTLYEQGLQ-EKLDWYLELRKFGNV-PTGGFGVGLERFVQVVLGQENIKDVIPYPRYPHHCKL. 385
406 1.000e-89UniRef50_A0A1G4ASR5 Asparaginyl-tRNA synthetase n=1 Tax=Colletotrichum orchidophilum TaxID=1209926 RepID=A0A1G4ASR5_9PEZI  ali  22  149MPHLRPRIPLNAAILRLRSEAVALLTQFFASRDFIQTHPPIITSS----DCEGAGEVFNVHTGSFFRSPKYLTVSTQLHLE-ALAQSLGHVWTLSPTFRAE--RSDTSRHMSEFYMLEAEMSFVDLDEVMNLVEDMLRSLATGLYQTREDDLVPIDEWPRITYADAIKLLKAEKPTWESGLHPVFVTHYPREIKAFYMPSDTVDCFDLLVPDLCEIAGGSMREHRLTDLLATMTARGMGSSDLDWYVDLRRWGS-NPHGGFGLGFDRLLSYLVGVPNVRDVVAFPRWFGRCDC. 533
407 1.000e-89UniRef50_A0A136KGZ4 Aspartate--tRNA ligase n=12 Tax=Bacteria TaxID=2 RepID=A0A136KGZ4_9BACT  ali  23  119.RPLSLRNLKIQAVFKIQATLVRAYREYLTNLGFTEFFGPNIIGAS-------SEGGAELFKVDYFGSDAMLSQSAQLYKQIA-VGAYERVFALMKCYRAE--KSNTRRHLTEATQFEFEMGFIDFSEVMDMLEGVVKFMISEIATNNDQELKLLGAFPRVTFKDALQIFGIDYAREQFGTDFIFVTHFTAFYAKPNEDNPEVTNYFDLLCREIEIVSGGQRINDHDELVESLKLKGLNPDSFQDYLSIFKFG-MPPHGGFGMGMERFTMMALGLDNIRMATLFPSDTRRIA.. 434
408 1.000e-89UniRef50_S8CCQ5 Uncharacterized protein n=1 Tax=Dactylellina haptotyla (strain CBS 200.50) TaxID=1284197 RepID=S8CCQ5_DACHA  ali  23  202IPHLRPKSSTFKSLLSLRSAAMHHLTNFFYDRSFLQTHPPVLTSS----DCEGAGEVFAVTRKPFFKDPVYLTVSSQLHLE-AQALASKNVWCLAPTFRAE--KSDTARHLNEFYMLEAEMAFTDDRQVTGLVEDMIRSLVERLSNDRDGELDIDGEWTTITYTDAVEEWGVNLQSEHEPHRPVFVTDYPAAIKPFYMLPNEVACFDLIFPQVGEIVGGSMREHRYEFLKRAMDEKGMNTEQLSWYLELRRWG-CAPHGGFGLGFDRLLAYLAGMENIRETVAFPRWYDRCLC. 554
409 1.000e-89UniRef50_M8CF62 Aspartyl-tRNA synthetase, cytoplasmic n=14 Tax=Eukaryota TaxID=2759 RepID=M8CF62_AEGTA  ali  21  76.....................TSKFREHLSSKDFIGIHTPKLIS-------GSSEGGAAVFKLEYNGKSACLAQSPQLHKQMAICGGFRRVFEVGPVFRAED--SNTHRHLCEFVGLDAEMEIMHYFEVCDIVDGLFVEIFRHLNENCKRELERQYPFERLSYEEGIQMLKEEKYDTEFFILYRYPLAARPFYTMPCYENPAYSNSFDVFLRGEEIISGAQRIHEPELLAKRAAEHGIGKSSIKSYVDSFRYG-APPHGGFGVGLERVVMLFCGLSNVRLASLFPRDPQRLSP. 375
410 1.000e-89UniRef50_A0A0V8QDB2 Aspartate--tRNA(Asp/Asn) ligase n=6 Tax=Bacteria TaxID=2 RepID=A0A0V8QDB2_9FIRM  ali  19  113LRPVTLRNIRERAKFKIQEGIVRGFRDFLYQEGFTEIRTPKLGAR-------GAEGGSNLFRLDYFGKKAVLAQSPQFYKQM-MVGVYDRVFETGPVFRAE--KHNTKRHLNEYTSLDFEMGYISFEDIMTMETGFLKYTMELLQKEYAKELNILREIPRVRFDDA-KRLVSEKYNEEYASDFVFVTHYPPFYAMDDPEDTTFTLSFDLLFKGMEITTGGQRIHDYKMLMEKIEKRDMTSEGMETYLMAFKYG-MPPHGGLGIGLERFTMQLLGEDNVREATMFPRDLNRLEP. 427
411 1.000e-89UniRef50_A0A0G0YLZ2 Aspartate--tRNA(Asp/Asn) ligase n=32 Tax=root TaxID=1 RepID=A0A0G0YLZ2_9BACT  ali  23  125.RPFTLRNTRNRAIFKVQHEILQAYRSFLVDKGFTEFEAP-------KIVGDDAEGGGNIFRIEYFDRWAYLATSPQLYKQIL-VGVFERVFSIGNVFRAE--LHSTSRHINEYTSLDVEMGFITDHDIMRLEEEFMHHLYTALEKNCKAELTIFKNFPSMKLKEALERWLSKYAKEHFKSDYLFVTHYPPFYTYEDENDKGYTKSFDLLFRGVEVTTGGQRIHTYDELIEKMKAKNLVPENFSFYLQTFKSG-MPPHGGWGMGLERLTQKILGLENVKEATLFPREINRIDTL 442
412 2.000e-89UniRef50_A0A1G3QS40 Multifunctional fusion protein n=4 Tax=unclassified Spirochaetes TaxID=1130380 RepID=A0A1G3QS40_9SPIR  ali  25  650.RVVAVRNPEVLNTFRLQAEIVRLFSEYLRDRNFTEIKTPKIISS-------GTEGGTNIFKVMYFGRTAYLAQSPQFYKQIMVGSGLERVFEVGPVFRAE--HHDTIRHLNEYVSMDFEMGFIDEQDVIDLHEELLRHLFAGLKERGRELFDFPDRIPRIHYLEALEIIGSEKILCDHFEKFVYVVGYPIKKRPLYTMPDEYTRSFDLLYRGIEITTGGQRIHDYQMLRENMLAFGCNPSEFRHYLETFKYG-MPPHGGLGMGLERLTMKIMDLKNIREASLFPRDINRI... 960
413 2.000e-89UniRef50_A0A0G0UQT6 Aspartate--tRNA ligase n=11 Tax=Bacteria candidate phyla TaxID=1783234 RepID=A0A0G0UQT6_9BACT  ali  20  122.RWLDLRKPEKTRIFQVWTELEKGFRKYWHENNFVQLYPPAFMS-------TASETGADVFTVNYFDRKAYLAQSPQFYKQMGMASGFERVFMVAPVFRAE--LSFTTRHLTEFTGWDFEISYIDHNDVMDAEEGMIVEGFKSVLEKFPDTSVPERPFPRITMIEAKEILEEERVICEHNHDFVFITEYHKSKSAFYHMRSDFSRRADLLYKGIEVTTLAQREHRVDVLIKQAEDKGMSLEPLKDYINFFRYG-CPPHGGAGIGPGRFVMKILDLPNVREATYLPRDVKRLNP. 430
414 2.000e-89UniRef50_A0A2E5SUH2 Asparagine--tRNA ligase n=62 Tax=cellular organisms TaxID=131567 RepID=A0A2E5SUH2_9FLAO  ali  26  128.RHLYLRTGRMTTMLKIRSSVFGAIHSFFRDRDFIEYQAPNF-------VAGAVEGGSTLFEVPYFGRKAYLTQSWQLYAEAAMP-ALERLYTIAPSFRAE--KSRTRRHLTEFWHAEMEIAWADNNDVMDHGEALVRHIARTLLTERPAELEVIRRFPRIRYDEAVERLKSEKILTADFDVPHFLTHYPKVAKPFYHRQDPDNQDYVLPEGYGEIIGGGERTWSESEILKRIDDEGTPRDPYEFYIDIRRYGGV-PHGGFGLGVDRVCAWLAGADHIRETIPFPRDSRRV... 439
415 2.000e-89UniRef50_R4XC25 Uncharacterized protein n=1 Tax=Taphrina deformans (strain PYCC 5710 / ATCC 11124 / CBS 356.35 / IMI 108563 / JCM 9778 / NBRC 8474) T  ali  23  141..HLRPRTQFNSSLLRIQSYMLHTLSSFFQTKNAIQVLPPVMTSS----DCEGAGETFQISKEDFFGMKTNLIVSSQLHLE-ALAMGVGKVWTLVPTFRAE--RSTTARHLAEFRMLEAELCFTNLHDVMDITESLIRNLTQGIIQHNAENIELGTPWTRIRFSEAVRILETEKFLAKYFNGPVFVTNYPAVQKPFYMLPAEDECFDLLVPSMGELCGGSLRDDNLDSLLHKMRIAGMNEGDLTWYTDLRRYGSV-PHGGFGLGWERLVGYLCGVNNVREIAAFPRWVNHC... 468
416 2.000e-89UniRef50_A0A0L0VDX2 Uncharacterized protein n=4 Tax=Puccinia striiformis TaxID=27350 RepID=A0A0L0VDX2_9BASI  ali  22  230IPHLRVRTQQISALMRIRSTMFHEASSSLQAHHFFRSETPIIT----FNDCEGAGEVFSVKPQHFFGREAFLTVSAQLHLE-ALSASLGRVYSFGPTFRAE--KSQTNRHLAEFWMLEAEISFIDLETLMNVLESLLKSVIRNLHQSSSQDLDPQQPWPRITYTEAVKIWGEKWLAGSYAQGPIFVTDYPASFKPFYMRQPTAACFDLLVPGVGELVGGSLRESNLNKLHENIIQKGMMSDKFQWYLELRKFGN-PATGGFGIGWERLLSWITGVENVRECIAFPRVTG..... 594
417 2.000e-89UniRef50_A0A1U7LQJ0 Putative asparagine--tRNA ligase, mitochondrial n=1 Tax=Neolecta irregularis DAH-3 TaxID=1198029 RepID=A0A1U7LQJ0_9ASCO  ali  24  124..HLRSRTSLFSIILRLRSKITTQLHSFFSSNNFIHTHPPVITSS----DCEGAGETFGIRPENFFSTSANLSVSCQLHLE-ALSMGVNRVWSLNPTFRAEG--SVTSRHLAEFWMLEAEMSFINLETVMSLVEGLIKNVTGKLIEDEAKEFELMGEWKRISYADAIEILHSEHEKYLATNGPIFITDYPRSLKPFYMSSTTVAGFDLLFPTIGELAGGSLREHSYERLEQRMKEDGI---DIPWYLELRKWGTV-PRGGFGVGFERLLMFLVAQENVRDVISFPRWRGNC... 442
418 3.000e-89UniRef50_A0A132A147 Aspartate-tRNA ligase, cytoplasmic-like protein n=1 Tax=Sarcoptes scabiei TaxID=52283 RepID=A0A132A147_SARSC  ali  20  207.RILDLRTTTNQAIFRFEAGVVELYRRSLIKRGFVEIHTP-------KIIPAASEGGANVFEVTYFKGSAYLAQSPQFYKQMAIAADFEKVFTIGAVFRAED--SNTHRHLCEFVGLDFEMAFMHYHEVLDMIGELFVELFKGLQKEYSKEIEPSEPFQRINYCEAVQLLGDEKYGTDFYILDKFPLAVRPFYTMPDPNNPKYSNSYDLFMRGEEIMSGAQRIHDPNFLLERIKHHGIDPEKMRGYIDAFKYG-AQPHAGGGIGLERVTMLFLDV................... 507
419 4.000e-89UniRef50_A0A2D6AEV1 Aspartate--tRNA(Asn) ligase n=3 Tax=cellular organisms TaxID=131567 RepID=A0A2D6AEV1_9EURY  ali  25  1..........MNAMFHLRGKILQFGREALINEGFFETHTP-------KIVATATEGGTDLFPMMYFDTPAFLNQSPQLYKQLCMSGGLERVFEIGPAFRAE--KHDTYRHLNEFISFDIECSWANDDDVMGVLERMIHHMWKSIAEDPEEVIVPELPFPRLSYCDAIEEWGDDIDAEEDLPQFYFLPRWPMDLKPFYIHHVDGSRGFDLNFGRDELTSGGQREHRIDVLIENLKKMDLDPKEFEFYVAGFRHG-VPPHAGWGLGVERILMKLTGAKNVRETVLFPRDRRRVSP. 317
420 4.000e-89UniRef50_A0A2R5GIM3 Asparagine--tRNA ligase n=1 Tax=Aurantiochytrium sp. FCC1311 TaxID=2023137 RepID=A0A2R5GIM3_9STRA  ali  23  438..HLRPRSNLMGAVLRVRSKASLEVHKFFAENDFTQIHTPVLTSI----DCEGAGDMFPVDQ----GELAFLTVSGQLHLEP-FACSLSKVYTFGPAFRAEN--SHTTKHLSEFWMLEPEVAFHDLEDSMALAEDCVKHIIGNVVDAHADDLDRDKPFLHMTYDEAIDILGMDLQTEHERGQPLFVTHYPAHCKAFYMKPDRVNCFDLLIPRIGELVGGSEREDDFERLDARVGPH--SREHMQWYLDLRRYGSV-PHAGWGLGFERLVQFVTGVSNIRETSAMPRWAGSV... 769
421 4.000e-89UniRef50_A0A135VYF6 Aspartate--tRNA(Asp/Asn) ligase (Fragment) n=1 Tax=Candidatus Thorarchaeota archaeon SMTZ1-83 TaxID=1706445 RepID=A0A135VYF6_9ARC  ali  23  1..........................EYLEANGFVEIHTP-------KIVAEATEGGANLFEIKYFDKKAYLAQSPQFYKQLMLLAGFGRVFEIAPVFRAE--KHNTRRHVNEYTSFDYEMAWITVDDVMKMEEQMLHYSFKKTAQASATELEPKVPFKRIRYEEVIERLLGEIFPREFGTEMVFITHYPLELRPAYTMDEGMTESFDLTYKGMEITTGGQRIHLYDLLVERFKAKGFNTDDFAFYLDPFKYG-APPHGGLGLGVERLTMQLLGIENIREATLLPRDRDRI... 288
422 4.000e-89UniRef50_A0A1Z5STV4 Uncharacterized protein n=16 Tax=cellular organisms TaxID=131567 RepID=A0A1Z5STV4_HORWE  ali  17  340.RIIDLRTTTSQAIFKVQSGICQMFRHHLDSLGFIEIHTPKLQGV-------ASESGASVFKLDYFGRPAFLAQSPQLGKQMAIAADMRRVMEIGPVFRAEN--SNTHRHLTEFTGLDLEMAITHYHELLRVLDSTFKAIFEYIYTKYRPEVEVVKETPIIPFAEAIRMLNEEKLKTDYYILDKFPTSARPFYAMADPERPEVTNSFDIFVRGQEILSGGQRIHDAPALIAKMQSMKMKPETMEEYMSGFEWG-APPHGGGGIGLERILMLMLKLGDIRHASMFARDPR..... 660
423 5.000e-89UniRef50_A0A1S8VWQ2 Asparagine-tRNA ligase n=4 Tax=Eukaryota TaxID=2759 RepID=A0A1S8VWQ2_9FUNG  ali  16  217.RHLVLRGETASSILRVRALMLKGFRTFFDSRFITEVTPPLM-------VQTQVEGGSTLFEFNYYEEAAYLTQSSQLYLETCLPS-IGDSYCITESFRAE--KSHTRRHLSEFTHCELELAFITFDDLLSVMEDMVVSVVDSVKKLNPDFKAPKKPFRRMQYGEAIKWLNDERRMTDTIGEPILLCRFPAEIKGFYMKRCSEDPVDLLMPNVGEIVGGSMRISDLDELMAGYKREGIDPTPYYWFTDQRKYGTTE-HGGCGLGVERLLAWLLNRFSVREVCLYPRFMGRC... 540
424 5.000e-89UniRef50_A0A2D6NVT6 Aspartate--tRNA(Asp/Asn) ligase n=1 Tax=bacterium TaxID=1869227 RepID=A0A2D6NVT6_9BACT  ali  20  155.RPITLRHEKVKAIFRVSNTVVRAYAEVMREMGFTEIKTP-------KILGAASEGGSNFFTIDYFGRKAFLAQSPQFYKQI-TAGVFERVFEIGPVFRAEP--HFTTRHVNEYISLDAEIGFIDHEDVMNILNKAVKYIFSEIKKDNKSELELYKKIPKIKLADMREIIRKKYKYEKYNSDFLFLTHYPPFYTMPDEKNPKETKSFDLIYAGVEMVTGSQRIHDYDMLVANIKKWGLKPKDFKFYLQAFKY-AMQPHGGWGMGLERIVYQLLDLKSIKQAVLFPRDVKR.... 466
425 5.000e-89UniRef50_A0A0G0LUV6 Aspartate--tRNA(Asp/Asn) ligase n=17 Tax=unclassified Bacteria TaxID=2323 RepID=A0A0G0LUV6_9BACT  ali  19  119.RPLTLRAFSQKAIFKVQAEILSAWRDFFKELDFTEINTP-------KIVGAGAEGGAEMFEVKYFKKKAYLAQSPQLYKEI-MAGVFERVFETAFVYRAEP--HSTSRHINEYMSLDIEMAFINWTDLIDLHQDLVKYIIDRLKKNSKKEFDLLGKIPTIKLREAQEILEKEYGEKKWGSEFIFITHYPPFYTMDDPKNPEETLSFDLLFKGLEVTTGSQRLHRYEDHIAKMKKRGMSTEGFEDYLNVFKYG-MPPHGGFCQGLERLTARFLDLDNVKEASLFPRDMNRLKP. 433
426 5.000e-89UniRef50_A0A1F5GZN0 Aspartate--tRNA(Asp/Asn) ligase n=9 Tax=unclassified Bacteria TaxID=2323 RepID=A0A1F5GZN0_9BACT  ali  23  119.RYLDLRRQRMQKNLRLRHKILTMVRDFLNSKNFVEIETPYLS----KTTPEGARDFIVPSRLNP-GKFYALAQAPQQYKQLLMLSNFEKYYQIARAFRDEDMRAD---RQFEHTQIDIEMAYVSREDITSLIEELML-----ILAQKLKLKIVKKPFPVFTYGEAIKQFGNDKFDLRNEKEFAWVVDFPKDLKNRK