current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 4gn3_B mol:protein length:113 OBody AM1L10, from PDB1018

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110
# E-value Template Links and tools%idFirst AMGSVYPKKTHWTAEITPNLHGTEVVVAGWVASLGDYGRVKIVKVSDREGGAAVSVYLEYGKTPDHLFKVFAELSREDVVVIKGIVEASKAAADMHNGVEIFPSEIWILNKAKLast
1 2.000e-41UniRef50_V4JHI5 Uncharacterized protein (Fragment) n=6 Tax=root TaxID=1 RepID=V4JHI5_9GAMM  ali  22  17....PNSMRSHYCGGLDSHSIDQQVRLCGWVHRRRDHGGVIFVDLRDRNGLVQVVFDPDQ----PEMFELAEQIRSEYVLAVEGRVRARPENPNIPTGIEVLASSLEVLNSAE 125
2 1.000e-40UniRef50_V9G505 Aspartyl-tRNA synthetase n=3 Tax=Terrabacteria group TaxID=1783272 RepID=V9G505_9BACL  ali  25  2.......KRTHHCGHLTTAHIGETVTLNGWVQTRRDLGGVLFIDLRDRSGIMQIVFNPD---FSGEALALADKVRSEYVVAVTGKVVKRDPNPNLPTGIEVQVTSIEVLNAAK 108
3 1.000e-40UniRef50_A0A2D0N3C3 Aspartate--tRNA ligase n=33 Tax=Bacteroidetes TaxID=976 RepID=A0A2D0N3C3_9BACT  ali  31  2.......YRTHNCGELRAEHIGQTVTLSGWVQRDRDKGFMMFVDLRDRYGITQLLFSEEK--TSKELFEKARTLGREFVIQVTGTVIERSKNKELPTGVELEVKELSILNPAK 107
4 3.000e-40UniRef50_A0A0P1MXH2 Aspartate--tRNA(Asp/Asn) ligase n=6 Tax=cellular organisms TaxID=131567 RepID=A0A0P1MXH2_9BACT  ali  24  3.....FKKRTHTCGELRATDVGKTVTLNGWVDRRRDLGGLIFIDLRDRYGKTQIVFSPQHNL---EAYQIAKELKSEYVISVTGKVERRPENPSLPTGIDVLVDEVQILSKSE 111
5 3.000e-40UniRef50_D9S4F5 Aspartate--tRNA(Asp/Asn) ligase n=34 Tax=Bacteria TaxID=2 RepID=D9S4F5_FIBSS  ali  27  28.......KRTHNCGQLRKEDVGQTVTLAGWVDRRRDHGGVIFVDLRDKYGKTQIVFNPDY---NADVLKTAEQLRNEYVIYVTGKVYAREENEKLATGIEVKADKLEILNAA. 133
6 3.000e-40UniRef50_W1G7U7 Aspartyl-tRNA synthetase n=2 Tax=Enterobacteriaceae TaxID=543 RepID=W1G7U7_ECOLX  ali  25  2........RTEYCGQLRLSHEGQQVTLCGWVNRRRDLGSLIFIDMRDREGIVQVFFDPDR----ADALKLASELRNEFCIQVTGTVRARDVNAEMATGIEVLASDLTIINRS. 105
7 5.000e-40UniRef50_A9WGJ7 Aspartate--tRNA(Asp/Asn) ligase n=309 Tax=cellular organisms TaxID=131567 RepID=SYDND_CHLAA  ali  27  2.......YRSHTCGELRPAHAGQEVTLAGWVHRRRDHGDLIFIDLRDRYGITQVVFNSAH----PTAHEVAETVRSEYVLQVRGKVRIRPVNPDLATGIELEASEAQVLNPAR 107
8 6.000e-40UniRef50_A0A2J0MJ13 Aspartate--tRNA(Asp/Asn) ligase n=8 Tax=unclassified Candidatus Omnitrophica TaxID=1047005 RepID=A0A2J0MJ13_9BACT  ali  25  5........RTHTCGELNKTHAGKEVILCGWVHHRRDHGKLIFIDIRDRYGYTQVMFSPKD---SPDAHRIATGLRAEFVIRLKGLVNERPKNKTSTGEVELIAKELEILNPS. 109
9 8.000e-40UniRef50_Q65GR4 Aspartate--tRNA ligase n=101 Tax=cellular organisms TaxID=131567 RepID=SYD_BACLD  ali  26  4........RTYYCGEITEKAIGETVVLKGWVQKRRDLGGLIFIDLRDRTGIVQVVFNPD---VSKDALETAESIRSEYVLDITGKVVAREENPNLKTGIEIQAESVDVLSAAK 109
10 8.000e-40UniRef50_A0A2G9ML90 Aspartate--tRNA ligase (Fragment) n=2 Tax=root TaxID=1 RepID=A0A2G9ML90_9ARCH  ali  30  7........RTHTCNDLTKKEKGNETTLCGWVNTRRDHGGIIFIDLRDKYGLTQIVIDPEKC--SKDAFKTSEQLRREDVIQVTGKVELRKENPKLATGVEVFVSSIKVLAKSE 113
11 1.000e-39UniRef50_A0A2T2V490 Aspartate--tRNA ligase (Fragment) n=4 Tax=Bacteria TaxID=2 RepID=A0A2T2V490_9BACT  ali  26  13...DTHPPRTNTCGDLRAKHDGDEVVLKGWVDTRRDHGGLVFVDLRDRYGLTQVVFSPQDNQT---AYEIAGQLRREDVISVRGTVRPRGENTDLPTGIEVKADDLAVLNTSE 123
12 2.000e-39UniRef50_Q2S158 Aspartate--tRNA(Asp/Asn) ligase n=1056 Tax=root TaxID=1 RepID=SYDND_SALRD  ali  27  13...DSHPARTHTCGDLRAEDNGEAVVLKGWVDTRRDHGGLVFVDLRDRYGLTQVVFSPQDNQT---AYEVAGQLRREDVISVQGTVRPRGENPDLPTGIEVSADDLAVLNTSE 123
13 3.000e-39UniRef50_A0A2D4S6P3 Aspartate--tRNA ligase (Fragment) n=13 Tax=root TaxID=1 RepID=A0A2D4S6P3_9GAMM  ali  34  2........RSHYCGEITEKLDQQTVTFCGWVHRRRDHGGVIFLDVRDREGLVQVVFDPD----TVDAFNTADSVRSEYVVQITGLVRTRPENDNMTTGIEILGKEIQILNKA. 105
14 3.000e-39UniRef50_A0A2T2UNR0 Aspartate--tRNA(Asp/Asn) ligase n=11 Tax=Bacteria TaxID=2 RepID=A0A2T2UNR0_9BACT  ali  25  13...DTHGARTHTCGDLRSDHEGEDVTLKGWVDTSRDHGGLVFIDLRDRYGLTQVVFSP---QDNEDAYEAAGHLRREDVISINGTVRPRGENPDLKTGIEVNAQELNVLNVAE 123
15 3.000e-39UniRef50_A0A1H0DZ34 Aspartate--tRNA(Asp/Asn) ligase n=31 Tax=Bacteria TaxID=2 RepID=A0A1H0DZ34_9DELT  ali  31  15......WKRTHHCAELTLQNDGQEVCLMGWVQFRRDHGGLIFIDLRDREGLTQVVFAPE---VNKDALEKAHILRSEDVIAIKGLVRPRPKNPKLKTGIEVVVKDFKILNNSK 122
16 4.000e-39UniRef50_C1FAE8 Aspartate--tRNA(Asp/Asn) ligase n=43 Tax=Acidobacteria TaxID=57723 RepID=SYDND_ACIC5  ali  25  9.......QRTHTCGELRAAHAGETITIMGWVNRRRDHGNLIFLDLRDRYGITQVVLDKD---LSAEAHAKAEQARPEYVICATGKVRARSINPKMPTGIEIAATELLILNDSK 115
17 4.000e-39UniRef50_B5YDT0 Aspartate--tRNA(Asp/Asn) ligase n=9 Tax=Bacteria TaxID=2 RepID=SYDND_DICT6  ali  24  2.......RRTHYCGEINIKNVGEKVSLSGWVHRIRHHGGLIFIDLRDRSGIVQLVVDP---AISQESYNIADTLGNEWVISVEGKVRKRPENPKIPTGIEIEVEKINIENPSK 108
18 5.000e-39UniRef50_Q89MP9 Aspartate--tRNA(Asp/Asn) ligase n=3707 Tax=root TaxID=1 RepID=SYDND_BRADU  ali  24  1....MHRYRSHTCGALRESNIGETIRLSGWVHRVRDHGGVLFIDLRDHYGLTQCVVDPD-----SPAFSLAEKLRSEFVIKMDGKVRRRPENDDLPTGIEIYVSEIEVLGPA. 107
19 7.000e-39UniRef50_B7GFR1 Aspartate--tRNA(Asp/Asn) ligase n=1398 Tax=root TaxID=1 RepID=SYDND_ANOFW  ali  23  4........RTHYCGEVTDMAIGQTVRLKGWVQKRRDLGGLIFIDLRDRTGIVQIVFSPD---VSKEALQVAETIRSEYVLDVEGTVVQREENPNLPTGIEVHAMHVTILSEAK 109
20 1.000e-38UniRef50_A0A2E6BF71 Aspartate--tRNA ligase (Fragment) n=3 Tax=Proteobacteria TaxID=1224 RepID=A0A2E6BF71_9GAMM  ali  27  2........RSHYCGQLNEARIDETVSLCGWVHRRRDHGGVIFVDLRDRDGLCQVVFDPDR----ADTFAQAETLRNEFVVRVKGLVRARPENPDLPSGIEVLAHELEILSVAR 106
21 1.000e-38UniRef50_A0A2X3LZA0 Aspartyl-tRNA synthetase n=5 Tax=Enterobacteriaceae TaxID=543 RepID=A0A2X3LZA0_ECOLX  ali  26  2........RTEYCGQLRLSHVGQQVTLCGWVNRRRDLGSLIFIDMRDREGIVQVFFDPDR----ADALKLASELRNEFCIQVTGTVRARDENRDMATGIEVLASSLTIINRA. 105
22 1.000e-38UniRef50_A0A1W9RV59 Aspartate--tRNA(Asp/Asn) ligase n=2 Tax=unclassified Candidatus Omnitrophica TaxID=1047005 RepID=A0A1W9RV59_9BACT  ali  31  3........RTHTCGQLDRNNIGEEVTLCGWVASRRDHGKIIFIDLRDRYGKTQVVFLP----SFKDAYKKAKKLKNEDVIRIKGKVNPRPENPKSTGGVEVCGEELEILNSS. 106
23 1.000e-38UniRef50_A0A1B8P2B2 Aspartate--tRNA ligase n=14 Tax=root TaxID=1 RepID=A0A1B8P2B2_HALEL  ali  24  2........RSHYCGQLNETMVDQTVTLCGWVHRRRDHGGVIFLDMRDRDGIAQVVVDPD----TAEAFANADRARNEYVLRIVGRIRLRPENPNMPTGIEVLAKDVEVLNTA. 105
24 2.000e-38UniRef50_O32038 Aspartate--tRNA(Asp/Asn) ligase n=329 Tax=root TaxID=1 RepID=SYDND_BACSU  ali  25  4........RTYYCGDITEKAIGESVTLKGWVQKRRDLGGLIFIDLRDRTGIVQVVFNPD---VSKEALAIAEGIRNEYVLDIQGKVVAREENPNLKTGIEIHADGVNVLNAAK 109
25 2.000e-38UniRef50_Q8ZNV2 Aspartate--tRNA ligase n=1578 Tax=Bacteria TaxID=2 RepID=SYD_SALTY  ali  27  2........RTEYCGQLRLSHVGQQVTLCGWVNRRRDLGSLIFIDMRDREGIVQVFFDPDR----ADALKLASELRNEFCIQVTGTVRARDVNADMATGIEVLASSLTIINRA. 105
26 2.000e-38UniRef50_A0A1G1AMM5 Aspartate--tRNA ligase (Fragment) n=6 Tax=Bacteria TaxID=2 RepID=A0A1G1AMM5_9PROT  ali  25  2........RTHYCGELNSQHIGQTVTLCGWAHRRRDHGGVIFIDLRDRTGMSQIVIDPD----TPAAFALAETVRSEFVLKIICKVRHRPENPNIPTGVEMLAGEIEILNPS. 105
27 2.000e-38UniRef50_A0A1F8T7E8 Aspartate--tRNA ligase (Fragment) n=9 Tax=Bacteria TaxID=2 RepID=A0A1F8T7E8_9CHLR  ali  24  3........RTHTCGELRADHAGTEVTLCGWVHRRRDHGDLTFIDLRDRYGLTQIVASAKEGGP---AHAALKDVRSEWVLKVRGSVRARPEGSLATGDVEVLAASVEVLNESK 108
28 2.000e-38UniRef50_A0A2G9LPH5 Aspartate--tRNA ligase (Fragment) n=2 Tax=cellular organisms TaxID=131567 RepID=A0A2G9LPH5_9ARCH  ali  28  42.......RRTHTCGDLRNTDDGSAVVLNGWVHTRRDHGGVIFIDLRDRYGFTQVVFNP-----GTDFFSQAEKLRREDVIAVQGLVRPRPINPHLTTGIEVLAEALVILNKAE 146
29 2.000e-38UniRef50_Q74D56 Aspartate--tRNA(Asp/Asn) ligase n=426 Tax=root TaxID=1 RepID=SYDND_GEOSL  ali  28  8......WKRSHLCGTLTKADVGKQVTLMGWVMRRRDHGGLIFIDLRDREGLAQIVFDPAKA---PEAHREAEAVRNEYVVAIKGEVVPRPENPNMKTGVEILVTQCKLLNRSK 115
30 2.000e-38UniRef50_A0A1Q7ABX9 Aspartate--tRNA ligase (Fragment) n=5 Tax=Bacteria TaxID=2 RepID=A0A1Q7ABX9_9CHLR  ali  25  7.......YRTHTCGDLNKDAIGQQVTLAGWVNRRRDHGGLVFLDIRDRYGITQVICDPER---SAEAHRVASEVRSEYVVQVSGKVVPRAENPNLSTGIEVAAEHIEILSPSR 113
31 3.000e-38UniRef50_Q1I6E5 Aspartate--tRNA(Asp/Asn) ligase n=143 Tax=cellular organisms TaxID=131567 RepID=SYDND_PSEE4  ali  29  3........RSHYCGQLNESLDGQEVTLCGWVHRRRDHGGVIFLDIRDREGMAQVVFDPDR----AETFAAADRVRSEYVVQITGKVRKRPENTNMASGIEILGYQLNVLNEAE 107
32 3.000e-38UniRef50_Q1D3C3 Aspartate--tRNA(Asp/Asn) ligase n=33 Tax=Bacteria TaxID=2 RepID=Q1D3C3_MYXXD  ali  26  10.......KRTHTCGQLTATNVGEEVVLFGWVHNRRDHGGAVFIDLRDRDGLTQVVFEPDH----AEAHALAGSLRLEYCVGVRGKVVSRGKNPKMKTGIEVRASDLTIFNRSE 114
33 5.000e-38UniRef50_A0A011RN27 Aspartate--tRNA ligase n=1 Tax=Candidatus Accumulibacter sp. BA-94 TaxID=1454005 RepID=A0A011RN27_9PROT  ali  27  2........RTHYCGQVDARLVDQEVTLCGWAHRRRDHGGVIFVDLRDREGIAQVVCDPDR----ADMFRTAESVRNEFCLRVRGRVRARPVNANIPSGIEILCHEMEVLNPS. 105
34 5.000e-38UniRef50_A0A0F9V9V0 Uncharacterized protein (Fragment) n=3 Tax=root TaxID=1 RepID=A0A0F9V9V0_9ZZZZ  ali  28  10.......KRTHTCGQLRETDIDTEVRLCGWVRSYRDHGGVVFIDLRDREGLTQVVFDAESDDAAAEMYKLARALRNEWVIAAGGRVRPRRENPKLPTGIEVICSDLTVLNRS. 120
35 7.000e-38UniRef50_A0A1W9PQ95 Aspartate--tRNA(Asp/Asn) ligase n=4 Tax=Bacteria TaxID=2 RepID=A0A1W9PQ95_9BACT  ali  26  8......WKRSHTCGELRISDIGKDVILMGWVDRRRDHGGLIFIDLRDRYGKTQLVFNPE---VNATAHHKARNLKPEYVLAARGTVEKRPQNPKLSTGIEVAVAELRILNAAK 115
36 8.000e-38UniRef50_D8JUK4 Aspartate--tRNA(Asp/Asn) ligase n=15 Tax=Alphaproteobacteria TaxID=28211 RepID=D8JUK4_HYPDA  ali  23  7.....HRYRSHTCGALRKANVGETVRLSGWVHRVRDHGGVLFIDLRDHYGVTQVVADPD-----SAAFKAAEAVRSEWVIRVDGKVRDRPVNGELPTGIELYATEIEVLSAAK 113
37 8.000e-38UniRef50_A0A1D3RMC5 Aspartyl-tRNA synthetase @ Aspartyl-tRNA(Asn) synthetase n=2 Tax=Bacteria TaxID=2 RepID=A0A1D3RMC5_9BACT  ali  26  2........RTHKCGELNKENLGEAVELCGWVHRRRDHGGVIFIDLRDRAGLVQVVFNPE----SEETFALAESVRSEYVLRVEGVVRDRLENANMATGVEVLVNHVEVLNESE 106
38 9.000e-38UniRef50_A0A2N1UNR1 Aspartate--tRNA(Asp/Asn) ligase n=10 Tax=Parcubacteria group TaxID=1794811 RepID=A0A2N1UNR1_9BACT  ali  25  3........RTHTCGELNKKNIAQEIILSGWVYRRRDHGGLIFIDLRDRYGITQVVFQPE----NSTIFKIAEKLRSEWVIKITGEIRSRPKNSKLNTGIEVEVKNIEILSESK 107
39 1.000e-37UniRef50_W4UTQ6 Aspartyl-tRNA synthetase n=6 Tax=Bacteria TaxID=2 RepID=W4UTQ6_9BACE  ali  29  3........RTHTCGELRVSDVNKQVTLSGWVQRSRKMGGMTFVDLRDRYGITQLVFN---EEVNAELCERANKLGREFVIQITGTVNERSKNANIPTGVEIIVSELNVLNTA. 105
40 1.000e-37UniRef50_U2YN63 Aspartyl-tRNA synthetase / aspartyl-tRNA(Asn) synthetase n=2 Tax=Bacteria TaxID=2 RepID=U2YN63_9RHOB  ali  24  1....MHAYRTHTCAALTSDNVGDTVRLSGWVHRIRDHGGILFIDLRDHYGMTQVLCDPD-----SAAFADVEKLRSEWCIRIDGEVKARPENPKLPTGIEVFVRGVEVLGASK 108
41 2.000e-37UniRef50_W0GQZ8 Aspartate--tRNA ligase n=11 Tax=Mollicutes TaxID=31969 RepID=W0GQZ8_9MOLU  ali  26  2.......KRTHTCGELRLKDVNQEVILTGWVAKSRRMGGLIFVDLRDRSGISQIIFEPAQAD-----YELANSLRNEYVIAVRGTVVERKKNPQLPTGIEIKANKLEIFSKAQ 104
42 2.000e-37UniRef50_A5PE57 Aspartate--tRNA(Asp/Asn) ligase n=37 Tax=Sphingomonadales TaxID=204457 RepID=A5PE57_9SPHN  ali  29  1....MHAYRTHTCAQLTKDNVGETVRLSGWVHNKRDHGGVLFVDLRDHYGITQIVADSDSRALP-----VLEKLKLESVVTIDGTVKARDENKNLPTGIEVFAREIEIQSRAE 108
43 2.000e-37UniRef50_A0A2H5XB04 Aspartate--tRNA(Asp/Asn) ligase n=3 Tax=Bacteria TaxID=2 RepID=A0A2H5XB04_9BACT  ali  27  3........KTHHCGTLRPQHIGETVTVCGWVNRIRDHGGVVFIDLRDRSGVVQCVFDP--QDCPHEVVAAAREVGNEWVLKITGVVARRPENPRLPTGIEVRGRALEVLNPAK 109
44 2.000e-37UniRef50_A0A2E7NJH6 Aspartate--tRNA(Asp/Asn) ligase n=24 Tax=cellular organisms TaxID=131567 RepID=A0A2E7NJH6_9PLAN  ali  23  3........RTHTCGELRADHIGQTITLGGWVQNYRDHRGLVFIDLRDRYGITQVVFNLSHD---EQMQAVARALRSEDVIQVEGEVISRSENPKLATGIEIKTTRLHVFSKSK 107
45 2.000e-37UniRef50_A0A1F8TP55 Aspartate--tRNA(Asp/Asn) ligase n=3 Tax=unclassified Chloroflexi (miscellaneous) TaxID=189774 RepID=A0A1F8TP55_9CHLR  ali  25  3........RTHTCGELRADHAGTEVTLCGWVHRRRDHGDLTFIDLRDRYGLTQIVASAKEGGP---AHAALKDVRSEWVLKVRGSVRARPENASLATDVEVLAASVEVLNESK 108
46 3.000e-37UniRef50_A0A1F9XKY8 Aspartate--tRNA(Asp/Asn) ligase n=1 Tax=Elusimicrobia bacterium RIFOXYB2_FULL_48_7 TaxID=1797967 RepID=A0A1F9XKY8_9BACT  ali  31  2.......KRTKYCGAFCVKDIGQKVTVCGWVHSRRDHGGVLFVDLRDREGVVQLVFKPEFN----ELFKQAEGLHSEYVVSVTGTVGKRPENPKLPTGIEIIAETLEILNTS. 106
47 3.000e-37UniRef50_A0A1V5V3K7 Aspartate--tRNA(Asp/Asn) ligase n=1 Tax=bacterium ADurb.Bin236 TaxID=1866925 RepID=A0A1V5V3K7_9BACT  ali  28  9......WKRTHTCGDLRESDIGAEVCLMGWVNRSRDHGGVIFVDMRDRYGLTQAVFDPGAAG---DVFPVGESLRNEFVVAVKGKVRRRPENPKLATGIEVLVGEVKILSVSE 116
48 3.000e-37UniRef50_A0A1I3BZT6 Aspartate--tRNA(Asp/Asn) ligase n=14 Tax=Bacteria TaxID=2 RepID=A0A1I3BZT6_9LACT  ali  29  3.......KRTSYCGQVSKALLGQEVVLKGWVQKRRDLGDLIFIDLRDREGIVQVVFNP---VFSKEALETAENIRNEYVIEVRGKVVERSENKKIATGLEIEVSEVTVLNKAK 109
49 3.000e-37UniRef50_A0A1W9V0R3 Aspartate--tRNA ligase (Fragment) n=1 Tax=Anaerolineaceae bacterium 4572_5.1 TaxID=1971724 RepID=A0A1W9V0R3_9CHLR  ali  29  2.......YKTHTCGELRKSHIGETVTLAGWVHNFRNHGGVTFIDLRDRFGIVQVVGNPE---VNKELVP-LKEARSEWVLQVTGEVRPRAENPDLCTGIEIAVKSVKVLNKSK 107
50 3.000e-37UniRef50_A0A2M8NK05 Aspartate--tRNA ligase (Fragment) n=3 Tax=Bacteria TaxID=2 RepID=A0A2M8NK05_9CHLR  ali  28  3........KTHTCGELRPAHVGQTVKLAGWVNRYRDQGGVIFIDLRDRWGVVQVVIDV---ATAPEAHQIAGNLRSEYVMQVEGVVRARPENPELATGIEVEALSVVLLNSSK 108
51 3.000e-37UniRef50_K2EC35 Aspartyl-tRNA synthetase (Fragment) n=1 Tax=groundwater metagenome TaxID=717931 RepID=K2EC35_9ZZZZ  ali  28  2......SYRTKNCGELNKANVGEEVTLAGWVHRRRDLGGLVFIDLRDRYGLTQVIFNPDKMAD----FSLAEKLKYEYVISVTGRIEARDENKDLSTGIEMVATNIRILSEAK 108
52 3.000e-37UniRef50_A0A2H0VNK3 Aspartate--tRNA(Asp/Asn) ligase n=3 Tax=unclassified Chlamydiae TaxID=1704234 RepID=A0A2H0VNK3_9BACT  ali  21  1.MSTPQYKRTHDCGSLRKTDIDKKINLSGWVNRRRDHGGLIFIDLRDRYGVVQLVFDPK---ISETLHKEASKLRSEWVVSVSGTVSHRGENKLATGEIEVNVESLNIISVAK 113
53 4.000e-37UniRef50_Q39VY3 Aspartate--tRNA(Asp/Asn) ligase n=350 Tax=root TaxID=1 RepID=SYDND_GEOMG  ali  28  8......WKRSHYCGNLTKADVGREVILMGWILRRRDHGGLIFADLRDREGLAQIVFDPAKNT---DAHHKAEAIRNEYVVAVKGEVIPRPENSAMKTGVEVLVTECKILNRSK 115
54 4.000e-37UniRef50_A0A2E5AI44 Aspartate--tRNA ligase (Fragment) n=7 Tax=Bacteria TaxID=2 RepID=A0A2E5AI44_9RHOB  ali  18  1....MHAYRTHTCGQLRKAQMGETARLSGWIHRKRDHGGLLFVDLRDHYGLTQCVLEPDNPN-----FATLERMRAESVVTVTGKVVARTENPNLPTGIELLVEDLVVQSAAE 108
55 4.000e-37UniRef50_A0A2D6EVA5 Aspartate--tRNA(Asp/Asn) ligase n=1 Tax=Candidatus Woesearchaeota archaeon TaxID=2026803 RepID=A0A2D6EVA5_9ARCH  ali  24  2........RTHTCGELTEKEVDKEITLCGWLHSRRDHGGVIFIDLRDRYGLTQIVFDPVQ---SKEAHKAAEHWGREFVLRVTGKVRARPENKEITTGVEVLITKAEVLAES. 106
56 4.000e-37UniRef50_Q83BE5 Aspartate--tRNA(Asp/Asn) ligase n=4571 Tax=root TaxID=1 RepID=SYDND_COXBU  ali  29  2........RTHYADKVDSSLIDQTITLCGWVHRRRDHGGLIFIDLRDREGLVQVVCNPTESTV----FKVAESLRNEYVIKVTGKVHKRPENPHIPSGVEIAASDITLLNKSK 106
57 5.000e-37UniRef50_A0A2N5ZD83 Aspartate--tRNA ligase n=1 Tax=bacterium BM706 TaxID=2053465 RepID=A0A2N5ZD83_9BACT  ali  33  4.......KRTHYCGELTIKNKGENVLLNGWVQRSRDLGNLYFIQLRDREGIVQLVIDPERCN--EQTMQLFSDIKREYVLEVKGEVVPRNENPDMKTGIEVLVDDIKILNKAK 110
58 5.000e-37UniRef50_A0A2A5XBK2 Aspartate--tRNA ligase (Fragment) n=5 Tax=root TaxID=1 RepID=A0A2A5XBK2_9FLAO  ali  32  3........RSHHCGALSESDLNQEVTLAGWVQKVRNKGFIVWVDLRDRYGITQLVFDEKR--TSEAVFKKSAELGREDVIQIKGTVIEREKNPNLPTGIEILATELTLLNKAQ 107
59 5.000e-37UniRef50_B9M1C9 Aspartate--tRNA(Asp/Asn) ligase n=185 Tax=root TaxID=1 RepID=SYDND_GEODF  ali  29  8......WKRTHYCGTLTADDTGKEVVLMGWAHRRRDHGGLIFVDLRDREGLAQIVFDPD---NSAEAHHKAEAIRNEYVVAVKGKVIPRPVNTNLRTGVEILVSACKILSRSK 115
60 6.000e-37UniRef50_A0A1F5S2M4 Aspartate--tRNA(Asp/Asn) ligase n=5 Tax=root TaxID=1 RepID=A0A1F5S2M4_9BACT  ali  27  2.......YRTNTCGELNKSNAGDEVILSGWVNSRRDHGGLIFIDLRDRYGMTQISFDPE---VNKDAWHTAEEIRSEYVIKVKGDVVLRPENKKLYTGIEIKASGVEILNTSE 108
61 7.000e-37UniRef50_Q87QV2 Aspartate--tRNA ligase n=372 Tax=Bacteria TaxID=2 RepID=SYD_VIBPA  ali  27  2........RTHYCGHLNKSLAGQTVELCGWVNRRRDLGGLIFIDMRDREGIVQVVVDPDM----ADAYEVANTLRNEFCIKLTGEVRVRPENKDMATGVEILAKGLEIINRS. 105
62 7.000e-37UniRef50_A0A259M0W4 Aspartate--tRNA ligase (Fragment) n=2 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A259M0W4_9RHOB  ali  22  1....MHAYRTHTCGELRKSHVGETVKISGWLHRRRDHGGVMFIDLRDHYGLTQIVFNP-----GSPGFATVERLRAESVITVEGKVVARDVNANLATGIEVVGGEVSVQSEA. 107
63 7.000e-37UniRef50_A0A1E7GWV9 Aspartate--tRNA(Asp/Asn) ligase n=4 Tax=cellular organisms TaxID=131567 RepID=A0A1E7GWV9_9DELT  ali  32  3.......KRTHHCNELNIDDTGAEVVLAGWVQRRRDHGGVIFVDLRDREGITQVVFNPE---IDEDVHSQAQAIRNEFVLSVRGRVNPRPENPRLTTGIEVMVLELEILNRAK 109
64 7.000e-37UniRef50_A5FKJ2 Aspartate--tRNA ligase n=668 Tax=root TaxID=1 RepID=SYD_FLAJ1  ali  31  2.......YRSHNCGELNASNINTEVTLAGWVQKSRDKGFMNWVDLRDRYGITQLIF--DESRTDKTVFELAKTLGREFVIQVKGTVIEREKNKNIPTGIEILVSELTILNTA. 106
65 8.000e-37UniRef50_A0A142WZW4 Aspartate--tRNA(Asp/Asn) ligase n=1 Tax=Planctomyces sp. SH-PL14 TaxID=1632864 RepID=A0A142WZW4_9PLAN  ali  27  3........RTHTCGELRPFHAGQTVTLCGWVDKYRDHAGIVFIDLRDRYGKTQIKFDL---ADSSEIQQQARHLRHEDVVQVSGKVVQRPENPKLSTGVELLVNEFSLLNKSK 108
66 8.000e-37UniRef50_Q74IX4 Aspartate--tRNA ligase n=1487 Tax=root TaxID=1 RepID=SYD_LACJO  ali  33  3.......KRTDYAGNITSKYEGQEVTLYGWVQRVRNLGNLVFIDLRDREGIVQVVVNKD---SGEKLMEIADSLNNEDVIEVKGKVVKRSVNPEMKTGVEVDATEIDVLNKSK 107
67 1.000e-36UniRef50_A3TTX8 Aspartate--tRNA(Asp/Asn) ligase n=22 Tax=Alphaproteobacteria TaxID=28211 RepID=A3TTX8_PSEBH  ali  25  1....MHAYRSHTCAELTAVNVGQTVRLSGWVHRIRDHGGVLFIDLRDHYGVTQVLCDPD-----SPVFSEVEKVRSEWCIRIDGEVKARDENPKITTGIEVFIRDMEVLGAAK 108
68 1.000e-36UniRef50_A0L667 Aspartate--tRNA(Asp/Asn) ligase n=156 Tax=Bacteria TaxID=2 RepID=SYDND_MAGMM  ali  27  2.......KRTHYCNDVRESQIGETVVLEGWINRRRDHGGVIFVDLRDRTGLVQVVFSPE---LFAEPHAQAHTLRSEYVIRATGKVTARSENPNMDTGIEVVVEDLTILNSS. 107
69 1.000e-36UniRef50_A0A1G1Q925 Aspartate--tRNA(Asp/Asn) ligase n=18 Tax=root TaxID=1 RepID=A0A1G1Q925_9BACT  ali  26  3........RTHTCGELRREDGKKTATLCGWVSSRRDHGKLIFIDIRDRYGITQVVFVP---SVSKEAHSIAEKLGPEFVIKVTGEVVVRPINKDVPTGVEICASELEILNESQ 108
70 1.000e-36UniRef50_A0A270QAP4 Aspartate--tRNA ligase (Fragment) n=1 Tax=Flavobacterium sp. IR1 TaxID=2026304 RepID=A0A270QAP4_9FLAO  ali  31  2.......YRSHTCGELRIEDKNQEVTLAGWVQKIRDKGFMAWVDLRDRYGITQLIFDEER--TPKEMMERATELGREFVIQVKGKVIEREKNPNLPTGIEILVSELQIL.... 103
71 1.000e-36UniRef50_A0A1Q7DKP8 Aspartate--tRNA(Asp/Asn) ligase n=2 Tax=Bacteria TaxID=2 RepID=A0A1Q7DKP8_9BACT  ali  28  4........RTHRCGELTKAHVGQTVVLNGWVHGRRDHGTVMFIDLRDRQGITQVVFNAER---NPAAHQQAHALRGEYVISVRGVVARRPENPDLATGIEVTVESAEILNEAR 109
72 1.000e-36UniRef50_A0A257TRG0 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C (Fragment) n=6 Tax=root TaxID=1 RepID=A0A257TRG0_9BACT  ali  26  11.......KRTHTCGELRANNINDVVTLNGWVDGRRDLGGVIFIDLRDRYGKTQVVFAPQH---NESVYQTAKQLRSEDVLAVVGKVERRPENKSLPTGIEVLGDDLVILSEAE 117
73 1.000e-36UniRef50_A0A1F6MAS0 Aspartate--tRNA ligase (Fragment) n=7 Tax=Bacteria TaxID=2 RepID=A0A1F6MAS0_9BACT  ali  27  2.......YRTHTCGELAVSHVGQRVILSGWVHKRRDLGGLIFVDLRDRFGLTQVVFHPDRVKN----FAVVEGLKYEYVIKISGEVVRREEKELATGEIEVQAAEVEVLGAAK 107
74 1.000e-36UniRef50_K2N842 Aspartate--tRNA(Asp/Asn) ligase n=21 Tax=Alphaproteobacteria TaxID=28211 RepID=K2N842_9RHIZ  ali  27  1....MHRYRSHSCAELRKSDVGANVRLSGWVHRVRDHGGLLFIDLRDHYGLTQIVADPDSPS-----FKTAETVRGEWVIRVDGEVKARTVNANLPTGVEIFAREIEVLSAAK 108
75 2.000e-36UniRef50_A0A058ZN10 Aspartate--tRNA(Asp/Asn) ligase n=165 Tax=root TaxID=1 RepID=A0A058ZN10_9RHOB  ali  24  1....MHAFRSHTCAELNKSNVGETVRLSGWVHRVRDHGGLLFIDLRDHYGVTQVMADPD-----SPVFAEIEKVRSEWCIRIDGNVKARDENPKIPTGVEVFIRDIEVLGAAE 108
76 2.000e-36UniRef50_A0A1W1HGT0 Aspartate--tRNA(Asp/Asn) ligase n=8 Tax=Bacteria TaxID=2 RepID=A0A1W1HGT0_9DELT  ali  29  9.......RRTHTCGELNTKDAGKETVLMGWVQRRRDHGGVIFIDLRDRYGITQIVFNPEFNEGS---HEKAQVLRSEFVIGVKGEVKARPDNEKMETGIEVFINELKIFSHAK 115
77 2.000e-36UniRef50_A0A2G6CBG5 Aspartate--tRNA ligase n=3 Tax=root TaxID=1 RepID=A0A2G6CBG5_9BACT  ali  28  2.......YRTHTCGELSAKHAGQQITLAGWVNKIRNLGGMTFIDLRDRYGITQVVCDPEK------VQQDLSGIKSEFVLQITGEVIARPINKEMKTGIEINPTAIKILSKSK 105
78 2.000e-36UniRef50_A0A2U3L3C0 Putative Aspartate--tRNA ligase n=1 Tax=Candidatus Sulfopaludibacter sp. SbA4 TaxID=2043165 RepID=A0A2U3L3C0_9BACT  ali  25  15.......RRTHSCGVLRAADEGQTVVLMGWVHRRRDHGGVVFIDLRDRDGITQVVVHEDAD---PAVHGRAEQVRPEYVIAVEGKVAPRAVNPNLATGIEVVASKVWILNESR 121
79 2.000e-36UniRef50_Q9Z7P2 Aspartate--tRNA(Asp/Asn) ligase n=41 Tax=root TaxID=1 RepID=SYDND_CHLPN  ali  23  3.......YRTHRCNELTSNHIGENVQLAGWVHRYRNHGGVVFIDLRDRFGITQIVCREDEQ---PELHQRLDAVRSEWVLSVRGKVCPRMENPNLATGIEVEVASFEVLSKSQ 109
80 2.000e-36UniRef50_A0A1L8PBK6 Aspartate--tRNA(Asp/Asn) ligase n=27 Tax=Bacteria TaxID=2 RepID=A0A1L8PBK6_9LACT  ali  26  2.......KRTEYCGKITKAYEEETVTVTGWVQKRRDLGGMIFIDLRDREGIIQVVFNSDK---NPEALEIAEKIRSEYVIAVEGKVVLRQVNKEIATGIEIMADKVEILNEAK 108
81 2.000e-36UniRef50_A0A2K8KD26 Aspartate--tRNA(Asp/Asn) ligase n=17 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A2K8KD26_9RHOB  ali  24  1....MHAYRSHTCADLTAAHVGETVRLSGWVHRIRDHGGVLFIDLRDHFGITQVL-----ADSDSAAFKDIEKLRAEYCIRIEGTVKARDINSKLKTGIEVYARSMDVLGAA. 107
82 2.000e-36UniRef50_A0A258D2Y5 Aspartate--tRNA(Asp/Asn) ligase n=2 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A258D2Y5_CAUVI  ali  23  1....MHAYRTHNCGALRASDTGAAVRLSGWIHRKRDHGGLVFIDLRDHYGLTQLVLHPETPG-----FNVVERLRAESVIRVDGEVIARDVNPNLPTGIEIRVSAVEVLSEA. 107
83 2.000e-36UniRef50_J6CSE7 Aspartyl-tRNA synthetase n=4 Tax=Gammaproteobacteria TaxID=1236 RepID=J6CSE7_PASMD  ali  28  3........RTHYCGALNRDNIGQEVTLSGWVHRRRDLGGLIFIDMRDREGIVQVCFDP----LYQEALTTAASLRNEFCIQIKGEVIARPINKNMATGVEVLAKSLSIYNSAE 107
84 2.000e-36UniRef50_O67589 Aspartate--tRNA(Asp/Asn) ligase n=3446 Tax=root TaxID=1 RepID=SYDND_AQUAE  ali  29  9.......KRTKYCGEVSEEDIGKEVKLAGWVHRKRHHGGVIFIDLRDREGIVQVVV---EEKTNPEAYEVADKLKSEYVIGVVGKVRKRPENPKLKTGVEVVADRILVFNTSE 115
85 2.000e-36UniRef50_A0A1R0IHN9 Aspartate--tRNA(Asp/Asn) ligase n=6 Tax=Sulfobacillus TaxID=28033 RepID=A0A1R0IHN9_SULTH  ali  31  4........RTHYAAEINETLEGQTVTVAGWVHRRRDHGGLIFIDLRDRSGLVQIV----ADPTQEENFRELDRVRLEYVLAVQGTVKRRPENKELASGVEISPERVEILAEAK 108
86 3.000e-36UniRef50_A0A1F3RED5 Aspartate--tRNA ligase (Fragment) n=1 Tax=Bacteroidetes bacterium RIFCSPLOWO2_12_FULL_31_6 TaxID=1797363 RepID=A0A1F3RED5_9BACT :  ali  28  2.......YRTHTNGELRIEQVGQQVTLCGWVQKIRDFGGMTFVDLRDRYGITQLVFNDTQKPM-------VSSLGREFVVQVTGKVAERQKNLNIATGIEIIVSTLTVLNKSK 102
87 3.000e-36UniRef50_K9CWC3 Aspartate--tRNA(Asp/Asn) ligase n=110 Tax=Bacteria TaxID=2 RepID=K9CWC3_SPHYA  ali  23  1....MHAYRTHNCGALREADVGANVRLSGWVHRKRDHGGVLFIDLRDHYGLTQIVAKADSEPL-----RILDGLRAESVVTIDGTVVARPENPKMATGIEVVADKVTVLSTA. 107
88 3.000e-36UniRef50_A0A1S9CW45 Aspartate--tRNA(Asp/Asn) ligase n=9 Tax=Bacteria TaxID=2 RepID=A0A1S9CW45_9GAMM  ali  27  2........RSHYCGQLNLAHIDKEVEVCGWVHHQRDHGGVIFIDLRDCEGLVQIVFDP----STPASFSVAERVRSEYVLGVKGRVRPRPENPSLSTGVEILAQGIQILNSAE 106
89 4.000e-36UniRef50_A0A2E4CU27 Aspartate--tRNA ligase (Fragment) n=10 Tax=Proteobacteria TaxID=1224 RepID=A0A2E4CU27_9SPHN  ali  23  1....MHAYRTHNCAQLRESDVGEDVRLSGWVHRKRDHGGVLFIDLRDHYGITQIVADED-----SEALGLLDSLKSESVITIDGVVKARSENANLPTGIEVFAKSATVQSAAE 108
90 4.000e-36UniRef50_A0A2A2RYB8 Aspartate--tRNA(Asp/Asn) ligase n=30 Tax=Bacteria TaxID=2 RepID=A0A2A2RYB8_9BACT  ali  30  2.......KRTHHCNELRPEHAGQTVTLTGWCHSRRDLGGVLFIDLRDREGRTQTVFDP--QDLSKEVFDTATHLHAESVIEIIGKVRVRPANDKIRTGVEVLVKELRVLNHA. 108
91 5.000e-36UniRef50_A0A2N2Z409 Aspartate--tRNA ligase (Fragment) n=4 Tax=Bacteroidetes TaxID=976 RepID=A0A2N2Z409_9BACT  ali  26  2.......YRTHTCGELRISNAGEQVTLAGWVQRIRKMGGMSFIDLRDRYGITQLVVD---DSVSHELNQVAEKLGREYVIQATGVVAERSKNSKIPTGIEIKISAMNVLNAS. 105
92 5.000e-36UniRef50_A0A1G2ZYF4 Aspartate--tRNA(Asp/Asn) ligase n=3 Tax=Bacteria TaxID=2 RepID=A0A1G2ZYF4_9BACT  ali  23  3........RTHTCGELGAQHVGQKVTLCGWVDRQRDHKGVLFIDLRDRHGKTQIVFGPE---ASAALQTAARALRGEYVIQVTGQVASRPENPKLATGIELRATGLVLLNKSR 108
93 5.000e-36UniRef50_A0A288GU49 Aspartate--tRNA ligase n=2 Tax=root TaxID=1 RepID=A0A288GU49_9BACT  ali  27  3........RTHTCGELTSAHAGQTVTLCAWISSLRNMGGLVFVDLRDRYGVTQVTLDP--AIVGQELVDKAASYSNEYVLKVTGEVILRPENPDMVTGIEIRATDIQLVSESK 109
94 5.000e-36UniRef50_A0A238Z7D2 Aspartate--tRNA(Asp/Asn) ligase n=10 Tax=Rhodobacteraceae TaxID=31989 RepID=A0A238Z7D2_9RHOB  ali  23  1....MHAYRTHTCADLSAANVGDTVRLSGWVHRVRDHGGILFIDLRDHYGITQVLCDPD-----SPVFAQVEKVRSEWCIRIDGVVKARDVNPKLPTGIEVFVRDIETLGAA. 107
95 5.000e-36UniRef50_A0A0B0I392 Aspartate--tRNA ligase n=8 Tax=root TaxID=1 RepID=A0A0B0I392_9BACL  ali  25  3........RTHQCGSLTTGHIGETVTLNGWVQTRRDLGGVLFIDLRDRSGIVQIVFNPAY---SGEALAIADKVRSEYVLAVTGKVVKRDINPNLATGIEVQITEIEVLNGAK 108
96 7.000e-36UniRef50_Q028M3 Aspartate--tRNA(Asp/Asn) ligase n=9 Tax=Bacteria TaxID=2 RepID=Q028M3_SOLUE  ali  28  14.......RRTHMCGELRASNAGQKVLLMGWAHRRRDHGAVIFVDMRDRTGHTQAIF---HEDVDPAIHKRAEEVRAEYVIAVEGVVSLRSVNPNMPTGVEVVASKIWILNESR 120
97 8.000e-36UniRef50_A0A2R7YAZ5 Aspartate--tRNA ligase n=1 Tax=Desulfurococcaceae archaeon NZ3(B) TaxID=1973259 RepID=A0A2R7YAZ5_9CREN  ali  38  2.......KRTHWCGELRREHVGLEVVVNGWVHALRKVGRIVFLVVRDRSGLVQAVVTPKNPN-----YSLVSELSLESVVAIKGVVRLRPVNPEMPTGIEIDVKEVQVLNPAK 106
98 8.000e-36UniRef50_A0A1W9V8N4 Aspartate--tRNA(Asp/Asn) ligase n=3 Tax=Spirochaetaceae TaxID=137 RepID=A0A1W9V8N4_9SPIO  ali  30  5.......KRTVTCGQLTAKNEGQTVILNGWVHRNRDHGGIHFINLRDRYGETQIVVDEDAA---EALKEKAGSLKFEYCVAIEGIVRARPENPDMVTGIEVSVKNISILNSCK 111
99 9.000e-36UniRef50_Q4L6X5 Aspartate--tRNA ligase n=1042 Tax=root TaxID=1 RepID=SYD_STAHJ  ali  27  2......SKRTTYCGLVTEELLNQKVTLKGWVHNRRDLGGLIFVDLRDREGIVQIVFNPD---FSEEALSVAETVRSEYVVEVEGTVTKRDVNSKIKTGVEVQVSNISIINKSE 109
100 1.000e-35UniRef50_D4W4C1 Aspartate--tRNA ligase n=17 Tax=Bacteria TaxID=2 RepID=D4W4C1_9FIRM  ali  24  3........RTHNNGELRLENVGQVVELKGWVAKSRNLGGLVFIDLRDRYGMTQLVANPE--TVSPEVLEVANKVRNEYVIAVKGIVAERQKNPNMPTGIEVVLEQLTIISEAE 107
101 1.000e-35UniRef50_A0A2V8SSD0 Aspartate--tRNA ligase n=2 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8SSD0_9BACT  ali  32  9.......ERTHTCGELRESHVGEQVVLMGWVAKKRDFGVFTFIDLRDREGVTQIVVSSE---TFPDAHAKAKNLRGEFVIAVKGEVVSRAEGKLATGDIEIKVSELLILNDAK 115
102 1.000e-35UniRef50_A6GWB6 Aspartate--tRNA ligase n=189 Tax=cellular organisms TaxID=131567 RepID=SYD_FLAPJ  ali  26  2.......YRSHNCGELNATHINKEVTLAGWVQKSRDKGFMNWVDLRDRYGITQLMF--DESRSDKTVFELAKTLGREFVIQVKGTVIEREKNKNISTGIEILVTQMTILNSS. 106
103 1.000e-35UniRef50_A0A2E3Q444 Aspartate--tRNA(Asp/Asn) ligase n=25 Tax=cellular organisms TaxID=131567 RepID=A0A2E3Q444_9BACT  ali  32  3.......KRTHSCQALRPGNIGETVVLAGWVNTYRDHSKLVFIDLRDREGLTQIVF--DTADVPTEVVEAAQGLRREDVIAVRGTVRERGANPKLATGIEVLASELEILNKAE 110
104 1.000e-35UniRef50_A0A2D8UW28 Aspartate--tRNA(Asp/Asn) ligase n=10 Tax=Bacteria TaxID=2 RepID=A0A2D8UW28_9BACT  ali  31  3.......KRTIHCNEIRTEHIDQVVTLNGWVHSRRDLGGVLFIDVRDREGRTQTVFDPS--DVXSDVFDQAASLHSESVVAVTGKVRRRPENSKXPTGVEIMVXELEVLNAA. 109
105 1.000e-35UniRef50_A0A2E4E060 Aspartate--tRNA(Asp/Asn) ligase n=58 Tax=cellular organisms TaxID=131567 RepID=A0A2E4E060_9BACT  ali  28  3.......KRTHTCGELRKEHIGESVSLNGWVNTVRLHGQVIFIDLRDRYGKTQIVFNSEDYDGD---FDTIKKLSMEDVLSIKGKVQSRGENPDMPTGIEVIVEAMELLSE.. 107
106 1.000e-35UniRef50_Q6FEH6 Aspartate--tRNA(Asp/Asn) ligase n=1051 Tax=root TaxID=1 RepID=SYDND_ACIAD  ali  24  3........RTHYCGSLTEAQIDQTVTLCGWVHRRRDHGGVIFLDMRDRDGLVQVVIDPD----TPEAFATADKVRSEFVLKITGRVRRRTENSNMVSGIEVLGKEIEVLAQSE 107
107 2.000e-35UniRef50_A0A2E8U1M8 Aspartate--tRNA ligase (Fragment) n=2 Tax=Proteobacteria TaxID=1224 RepID=A0A2E8U1M8_9PROT  ali  26  1....MHPYRTHTCGELREDHIDQTVRLSGWIHRKRDHGNLVFVDLRDHFGLTQCVID-----VSSDLFPVVEGARPESVLTVTGPVVARTVNANINTGVEVRIREIVVENPA. 107
108 2.000e-35UniRef50_B8EN55 Aspartate--tRNA(Asp/Asn) ligase n=8 Tax=Alphaproteobacteria TaxID=28211 RepID=SYDND_METSB  ali  23  1....MHRYRSHTCGDLRETDALQPTRLSGWCHRIRDHGGVLFIDLRDHYGITQCVVDPDSG-----AFPLAEKLRSEWVVRIDGLVRQRPENIEMPTGIEVYVTEIEVLGAA. 107
109 2.000e-35UniRef50_A0A2W4M0W2 Aspartate--tRNA ligase (Fragment) n=1 Tax=Proteobacteria bacterium TaxID=1977087 RepID=A0A2W4M0W2_9PROT  ali  30  9.......KRTHDCGALRAADIGKEVVLFGWVQNRRDHGSIVFVDLRDREGITQIVFDPE---TSPDAHRIADQLRSEWVIGIRGVVRSRGENPNLATGIEVSVVEATIFNKAE 125
110 2.000e-35UniRef50_A0A1Y5HKY5 Aspartate--tRNA(Asp/Asn) ligase n=9 Tax=Proteobacteria TaxID=1224 RepID=A0A1Y5HKY5_9RHOB  ali  21  1....MHAYRSQTCAELNKSNVGDTVRLSGWVHRVRDHGGLLFIDLRDHYGITQIIADPD-----SPVFAELEKLRSEWCIRIDGSVMARDENKAIPTGIEVFIRDLEVLGKSE 108
111 2.000e-35UniRef50_A0A177GFC2 Aspartyl-tRNA synthetase n=2 Tax=root TaxID=1 RepID=A0A177GFC2_9PROT  ali  21  1....MHPYRTHSCSALRAQDAGTTARLSGWVHSKRDHGGLLFIDLRDETGITQIVIPA-----GDPAMELAENTRVESVITVTGDVVRREENPDLATGIEVRAREFVVQSAA. 107
112 2.000e-35UniRef50_A0A258CTK6 Aspartate--tRNA ligase (Fragment) n=1 Tax=Rhizobiales bacterium 32-66-8 TaxID=1970550 RepID=A0A258CTK6_9RHIZ  ali  22  1....MHRYRSHTCGALTDADVGASVRISGWCHRIRDHGGVLFVDLRDHYGLTQVVIDPD-----SPAFTAAEKIRSEWVVRFDGKVRLRPENTELPTGIEIYATELEVLGPS. 107
113 2.000e-35UniRef50_A0A254QH29 Aspartate--tRNA ligase (Fragment) n=1 Tax=Armatimonadetes bacterium Cent15-Ar3 TaxID=1987502 RepID=A0A254QH29_9BACT  ali  20  2....SFRSRTHTCGELRASNAGETVILNGWIHRVRDLGGLWFADMRDRTGLVQIALDPEKFPNRAE-------IRPECCLEVEGVVTLRDENSEMPTGIEVVLTSYNLLSPAK 107
114 2.000e-35UniRef50_A0A1G0A0C3 Aspartate--tRNA ligase (Fragment) n=3 Tax=cellular organisms TaxID=131567 RepID=A0A1G0A0C3_9SPHN  ali  27  1....MHAYRTHNCGALTKGQVGETVRLSGWVHNKRDHGGVLFVDLRDHYGITQVVADSDSPALP-----VLEKLKLESVVTIDGTVKARAENPNLPTGIEVFAREVTVQSRAE 108
115 2.000e-35UniRef50_C8W9R3 Aspartate--tRNA(Asp/Asn) ligase n=75 Tax=Terrabacteria group TaxID=1783272 RepID=C8W9R3_ATOPD  ali  26  24.........THTCGELRAEHIGQTVTLTGWVWRRRDFGGLIFVDLRDREGLTQILFDPD---VNADVFATAETIRPEWPVLITGTVQHRSEGQTVTGEVEVLASKIDVLNTS. 127
116 2.000e-35UniRef50_A0A1F3LVN2 Aspartate--tRNA ligase n=3 Tax=root TaxID=1 RepID=A0A1F3LVN2_9BACT  ali  27  2.......YRTHSCGELRINNVGEQVTLAGWVQRIRKMGGMSFIDLRDRYGITQLTID---ESASKDLNTAAEKLGREFVIQAKGVVTERSKNSKLPTGVEIKLTDITVLNAS. 105
117 3.000e-35UniRef50_A0A2E7F793 Aspartate--tRNA ligase (Fragment) n=4 Tax=Bacteria TaxID=2 RepID=A0A2E7F793_9PROT  ali  21  3GESDLHPYRSHTCGELRMDNAGITARLSGWVHRKRDHGNLLFIDLRDHYGLTQCVI-----EIDADNFETAEAIRPESVVTVTGRIERRSINPDLQTGIELRISEIQVESAA. 113
118 3.000e-35UniRef50_Q8FT19 Aspartate--tRNA(Asp/Asn) ligase n=2877 Tax=root TaxID=1 RepID=SYDND_COREF  ali  27  3........RTHLSGELRKENAGQSVTLTGWVARRRDHGGVIFIDLRDRSGIAQVVFR------NEDVAERAHALRSEFVLQVTGVVEKRPENPNLASGVEVSVTDFTVLNES. 104
119 3.000e-35UniRef50_A0A2H0XXI6 Aspartate--tRNA(Asp/Asn) ligase n=6 Tax=Bacteria TaxID=2 RepID=A0A2H0XXI6_9BACT  ali  29  2.......YRSRNCGGLKKNDVGQQVTLAGWVHRRRDHGGLIFIDLRDRSGLAQIVFNQE----NKALHDQAGKLRSEFVVSITGTVVARAVNKNIPSGIEMVATELTILNTAK 107
120 3.000e-35UniRef50_A0A2E5XSR3 Aspartate--tRNA ligase n=7 Tax=Bacteroidetes TaxID=976 RepID=A0A2E5XSR3_9FLAO  ali  28  3........RTHNCGALRLEQVGKEVTLSGWVQRTRNLGGMTFVDLRDRYGITQLAFNMD---TNVDLCSQARKLGREFVIQVTGKVIERSKNNNIPTGIEIEVSNLNILNAAK 106
121 3.000e-35UniRef50_A0A1W9TL28 Aspartate--tRNA ligase (Fragment) n=2 Tax=Bacteria TaxID=2 RepID=A0A1W9TL28_9BACT  ali  24  4.......KRTHKCGELDIKNVDEIVVLNGWVERIRDLGGIKFGLLRDRYGKVQFIIDPE----NKEIYELAKKIGNEYVIAIKGKIRKRPINKNMKTGIEMLVEDLEILSESE 109
122 4.000e-35UniRef50_Q73MC2 Aspartate--tRNA(Asp/Asn) ligase n=41 Tax=Spirochaetes TaxID=203691 RepID=SYDND_TREDE  ali  22  5.......QRTVTCGGLNKDFAGKTVVLNGWIHRKRDHGGITFLNLRDRYGLTQVVVD---DDASEDLKALAVSLKQEFCIAVEGLVRPRPINKEMATGIEVKALKIEVLSKSE 111
123 4.000e-35UniRef50_A0A2A4ST98 Aspartate--tRNA(Asp/Asn) ligase n=1 Tax=Candidatus Peregrinibacteria bacterium TaxID=2030811 RepID=A0A2A4ST98_9BACT  ali  21  2.......YRSHTCNELRKSDAGSTVKLSGWVQKRRDLGDCIFLDLRDRYGITQIMFDKK---VSPEAHAAAEDLRAEWVIMIDGDVKARQENKHHSGDIEIMAEKVTVLSKSE 108
124 4.000e-35UniRef50_I0IGJ6 Aspartate--tRNA(Asp/Asn) ligase n=1 Tax=Phycisphaera mikurensis (strain NBRC 102666 / KCTC 22515 / FYK2301M01) TaxID=1142394 RepID=I0  ali  29  1.MSS--TYRTHSCGALRPADSGSTVTLSGWVNNYRDHGGVRFVDLRDRDGLTQVVFHPEA----AAAHQTAQKLRHEDVITVTGEVVAREVNPKLATGVEVDASALRVLSKS. 108
125 4.000e-35UniRef50_A0A090PJS0 Aspartyl-tRNA synthetase n=7 Tax=root TaxID=1 RepID=A0A090PJS0_9FLAO  ali  31  2.......YRSHDCGSLRASDVNKEVTLAGWVQKSRDKGFMVWVDLRDRYGVTQLIFDEER--TDKALLERAQKLGREFVIQVKGTVIEREKNAKMSTGVEILVKELNILSESK 107
126 4.000e-35UniRef50_A0A0N0Z8F7 Aspartate--tRNA ligase n=17 Tax=Bacteria TaxID=2 RepID=A0A0N0Z8F7_9BACI  ali  25  2.......ERTYYCGEVPETAVGERVVLKGWVQKRRDLGGLIFIDLRDRTGIVQVVASPD---VSVEALAAAERVRSEYVLSVEGTVVARPENPNIATGIEIQAERIEIINEAK 108
127 5.000e-35UniRef50_A0A1N6QIF1 Aspartate--tRNA(Asp/Asn) ligase n=6 Tax=Bacteria TaxID=2 RepID=A0A1N6QIF1_9SPIO  ali  28  5.......KRTHTCGALGVADTGKTVRLNGWVHRTRDHGGVHFLNLRDRYGITQVVINED---APEALRTLAASLRMEYCIALEGVVLERPENPSMITGIEVSASRIEILNTSE 111
128 5.000e-35UniRef50_A0A2V6EHX3 Aspartate--tRNA ligase (Fragment) n=4 Tax=Verrucomicrobia bacterium TaxID=2026799 RepID=A0A2V6EHX3_9BACT  ali  30  2.......YRTHNCNSLRKGDIGKEATLAGWVHVSRDHGGVIFIDLRDREGLTQVVFRPEE---NAELAKQAHSLRSEDVIQVSGKVAPRTENPKLATGIELIPHQLKILNRA. 107
129 5.000e-35UniRef50_A0A2E2NB84 Aspartate--tRNA(Asp/Asn) ligase n=11 Tax=Bacteria TaxID=2 RepID=A0A2E2NB84_9BACT  ali  26  4........RTHTCGALRPSNVGETVTLNGWVNSYRDHGGLIFIDLRDRYGLTQIVF--DKEDASQDLLEAADKLRNEDIIAIRGKVRTRDPNPKLATGIEIVGDELVVLTKA. 109
130 5.000e-35UniRef50_A0A1F9M7Y6 Aspartate--tRNA(Asp/Asn) ligase n=5 Tax=Bacteria TaxID=2 RepID=A0A1F9M7Y6_9DELT  ali  29  3SMGGL--KRTHHCNALTHAEVGKEIILMGWVLRRRDHGGVIFIDLRDRWGLTQVVFNPE---INAEVHAKAHGIRSEWVLAIRGLVEARPENPKLATGIEVRVLELRILNQSK 114
131 7.000e-35UniRef50_A0A0K2JHF4 Aspartate--tRNA ligase n=7 Tax=cellular organisms TaxID=131567 RepID=A0A0K2JHF4_SPIKU  ali  30  2.......KRTHTCGELTLKNVKAKVVLSGWVAKNRRLGGIIFLDLRDRTGITQVVVQPEHPQ-----YAMIKTIRNEFVISVEGIVIERKKNLELPTGIEIAAKQVTILSKAE 104
132 7.000e-35UniRef50_A0A0P7BYF0 Aspartate--tRNA ligase n=4 Tax=FCB group TaxID=1783270 RepID=A0A0P7BYF0_9BACT  ali  29  3........RTHTCGELRLSNAYETVTLCGWVQKSRDKGGLVWVDLRDRYGITQ--LMAEEGVSSEAVLDQVRELGREFVVKVTGKVKEREKNEKISTGIEILIETLEILNPAK 107
133 7.000e-35UniRef50_A0A060Q9U3 Aspartate--tRNA(Asp/Asn) ligase n=28 Tax=Bacteria TaxID=2 RepID=A0A060Q9U3_9PROT  ali  23  1....MHQYRTHFCNALRADDAGRTVRLSGWIHSKRDHGGLLFIDLRDNYGVTQIVVPSEG-----ALLEQAERLRVESVITVTGEVVVREENPSLPTGVEVRASGIDVQSRAE 108
134 7.000e-35UniRef50_W4TQA9 Aspartyl-tRNA synthetase n=3 Tax=Actinobacteria TaxID=201174 RepID=W4TQA9_CUTAC  ali  27  3........RTHDAGTLRASDIGKEVTLAGWVGHRRDHGGVAFIDLRDASGLAQVVIRDEILESSG-----AHDLRNEYCIRVTGVVEARPENPNLPTGIEVAITELEVLNPS. 105
135 8.000e-35UniRef50_A0A1Y0L1J0 Aspartate--tRNA ligase n=1 Tax=Spiroplasma clarkii TaxID=2139 RepID=A0A1Y0L1J0_9MOLU  ali  30  2.......KRTHTCGELNLKNVGTKVILQGWIAKIRKMGALTFIDLRDRYGITQLVI-------GEKLSSSLASLKPEYVIEVSGLVIERKKNPDLATGIEIEVNEIVIINKSE 102
136 9.000e-35UniRef50_D4MPG4 Aspartyl-tRNA synthetase n=8 Tax=Bacteria TaxID=2 RepID=D4MPG4_9FIRM  ali  26  9.......KRSHRCTELSTENIGENVTVMGWVQKSRNKGGIIFVDLRDRSGLLQIIF--EEADCGSESFAKAEKLRSEFVIAVTGKVEARSVNENLKTGIEIRANALRILSESE 115
137 9.000e-35UniRef50_B5YJP5 Aspartate--tRNA(Asp/Asn) ligase n=167 Tax=root TaxID=1 RepID=SYDND_THEYD  ali  25  3........RDKYCAEVKEEEIGKEISLCGWVFRRRDHGGLIFIDLRDRTGIIQVVFSPE---ISIEMHQKAHGLRSEYVIAVKGILKKRPENPELITGVELWAKELEILSFSK 108
138 9.000e-35UniRef50_A0A2D5EQC0 Aspartate--tRNA(Asp/Asn) ligase n=1 Tax=Myxococcales bacterium TaxID=2026763 RepID=A0A2D5EQC0_9DELT  ali  25  265.......KRTHSCGELREEHIGQEVVLFGWVHNRRDHGGCIFIDLRDRDGLTQIVFDP------ADAFPDADRARSEWCLGVRGKVRDRGRNPRLATGIEIVVEEMAVFNKA. 372
139 1.000e-34UniRef50_Q92J82 Aspartate--tRNA(Asp/Asn) ligase n=283 Tax=Bacteria TaxID=2 RepID=SYDND_RICCN  ali  23  1....MHKYRTHNCNELQISDVETEVKLSGWVHRRRDHGNLVFIDLRDHYGITQIVFTDQ----NPQLMEDASRLRYESVITVRGTVVARSENNTLPTGVEVLAVEFSVESAA. 108
140 1.000e-34UniRef50_A0A1F9DUY5 Aspartate--tRNA ligase (Fragment) n=5 Tax=root TaxID=1 RepID=A0A1F9DUY5_9DELT  ali  26  9......WKRSHDCGSLRRGDAGKEALLMGWVNSRRDLGNLIFIDLRDRGGITQIVFDP---QMNEEAHNKAHILRNEWVVAVRGKVSPRQENPDMSTGIELQVTELKILNK.. 114
141 1.000e-34UniRef50_A0A2N2HFG8 Aspartate--tRNA ligase (Fragment) n=1 Tax=Deltaproteobacteria bacterium HGW-Deltaproteobacteria-20 TaxID=2013748 RepID=A0A2N2HFG8  ali  25  10......WKRTHFCGDLRGTDAGKQVILFGWVQTRRNLGGCVFVDLRDREGVTQVVFDPSTEPRDPQLVALAEQIRPEWVIAIRGVVVSRGENPKMPTGIEVRVLEAEVFNRAE 128
142 1.000e-34UniRef50_A0A0G2HJJ7 Aspartate--tRNA(Asp/Asn) ligase n=2 Tax=Candidatus Synechococcus spongiarum TaxID=431041 RepID=A0A0G2HJJ7_9SYNE  ali  28  2........RTHYCGELRSTHGHQQVTLCGWVDRCRDHGGVVFIDLRDRTGTVQVTVDPEG---STEVFRQAEQLRNETVLRISGRVRLRPENAKLATGVEVVATALAVLN... 104
143 1.000e-34UniRef50_I3ZXB9 Aspartate--tRNA ligase n=14 Tax=Bacteroidetes TaxID=976 RepID=I3ZXB9_ORNRL  ali  27  2.......YRTHTNGALNLSHKGERVELSGWVQGIRDKGFLMWIDLRDRYGITQLVL--DEARTDKSLFEKARKLGREFVIKVSGEVLEREKNPNIPTGIEILIDSLEILNAAK 107
144 1.000e-34UniRef50_Q7NRP0 Aspartate--tRNA(Asp/Asn) ligase n=127 Tax=cellular organisms TaxID=131567 RepID=SYDND_CHRVO  ali  30  2........RTDYCGLIDKKYLGQTVTVKGWAHRRRDHGGVIFIDLRDREGLVQVVIDPD----TPEAFKLADSSRGEYVLSITGIVRERPAGKMISGEIEILAKEIEILNAA. 105
145 1.000e-34UniRef50_S7KFC9 Aspartate--tRNA(Asp/Asn) ligase n=5 Tax=Chlamydia TaxID=810 RepID=S7KFC9_CHLPS  ali  21  3.......YRTHHCNELSRKNLNETVRLSGWVHRYRNHGGVVFIDLRDRFGITQIVCREEE---SPELHQLVDTVRSEWVLSVEGKVCGRPENPNLVTGIEVEIEKLEILSRAQ 109
146 1.000e-34UniRef50_C0R2C9 Aspartate--tRNA(Asp/Asn) ligase n=591 Tax=Bacteria TaxID=2 RepID=SYDND_BRAHW  ali  24  4........KSAYNGILTKDDIGKEVKLAGWVLRRRDHGGVIFVDLRDRTGFVQIVFNPE---ISKEAHNDAQDLRSEYVISVEGKIRARSINPKIPTGIEVMVEKMELLNTSE 109
147 1.000e-34UniRef50_A0A2D5AZR2 Aspartate--tRNA(Asp/Asn) ligase n=2 Tax=Planctomycetes bacterium TaxID=2026780 RepID=A0A2D5AZR2_9BACT  ali  28  2....KNWRRTRTCGELNSESIGESVVLNGWVHARRDHGGIYFVDLRDRYGITQLVL---GGNISEAV-----KLSAEDVIAVRGKVVARDENKQRPTGIEIDVEELEILSKS. 105
148 1.000e-34UniRef50_A0A090PQH4 Aspartyl-tRNA synthetase n=6 Tax=Bacteria TaxID=2 RepID=A0A090PQH4_9FLAO  ali  30  2.......YRSHDCGSLRASDVNKEITLAGWVQKSRDKGFMVWVDLRDRYGVTQLIFDEER--TDKALLERAQKLGREFVIQVKGTVIEREKNAKMSTGVEILVKELNILSESK 107
149 1.000e-34UniRef50_X1KAT8 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X1KAT8_9ZZZZ  ali  26  3........RTHTCGQLTVKDVGAKVTLCGWVASRRDHGKIIFIDLRDRYGITQIVFAPDKRQVYPHVYEKAKELGNEYVTLIQGEVNRRPENRKLPTGIEVFAAQLTIINSS. 119
150 2.000e-34UniRef50_A0A1A9VJW5 Pyruvate dehydrogenase E1 component subunit alpha n=1 Tax=Glossina austeni TaxID=7395 RepID=A0A1A9VJW5_GLOAU  ali  22 1169SKTNMNCYKTHTCNELRKNDVGKEVTLSGWLYRKRDHGNLIFVDLRDFHGITQLVFNNDK-----DFFDEISNLKSESVITVTGVVKARTVNSSIATGIEVVVSNLHVESEVE 1280
151 2.000e-34UniRef50_A0A090X1E7 Aspartyl-tRNA synthetase n=3 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A090X1E7_9FLAO  ali  31  2.......YRSHDCGSLRASDVNKEVTLAGWVQKSRDKGFMVWVDLRDRYGVTQLIFDEER--TDKALLERAQKLGREFVIQVKGTVIEREKNAKMSTGVEILVKELNILSESK 107
152 2.000e-34UniRef50_A0A1H0CD93 Aspartate--tRNA(Asp/Asn) ligase n=83 Tax=Bacteria TaxID=2 RepID=A0A1H0CD93_9RHOB  ali  24  1....MHAYRSHTCAELTKENVGDTVRLSGWVHRVRDHGGVLFIDLRDHYGVTQVLCDPD-----SPVFNAVEKVRSEWCIRIDGVVKARPENAKIPTGIEVYIRDMEVLGAA. 107
153 3.000e-34UniRef50_A0A1W9SPI2 Aspartate--tRNA ligase n=1 Tax=Bacteroidetes bacterium 4572_128 TaxID=1971633 RepID=A0A1W9SPI2_9BACT  ali  24  2.......YRTNNCGELNINFVNKEVKLSGWVQKIRNLGGMTFIDLRDKYGITQLVFDIE---TNENLCEKARKLGREYVISVEGKVAERSKNKKIFTGIEIIVNKLIILNASE 106
154 3.000e-34UniRef50_Q03F52 Aspartate--tRNA ligase n=321 Tax=root TaxID=1 RepID=SYD_PEDPA  ali  29  2.......KRTTYAGLVNEQYTGQTVTLKGWVQKRRDLGQLIFIDLRDREGIVQLVFSSE---FSADALKIADQLRNEYVLEITGIVKQRKENPKMKTGIEVEVQQAKILNSAK 108
155 4.000e-34UniRef50_A0A1D2R243 Aspartate--tRNA(Asp/Asn) ligase n=2 Tax=unclassified Candidatus Altiarchaeales TaxID=1849260 RepID=A0A1D2R243_9EURY  ali  37  2........RTHYSKQVTPDLAGEKVTLCGWAHESRDMGKIKFLILRDREGVIQVL--GKKGETKEEMLSAIDSISRESVVKVTGIVKASKMAP---GGVEVLPESIEVISEA. 100
156 4.000e-34UniRef50_A0A1M3KY43 Aspartate--tRNA ligase n=2 Tax=Bacteroidetes/Chlorobi group TaxID=68336 RepID=A0A1M3KY43_9BACT  ali  26  2....TFEQRTTTCGELRPEHAGTSVTINGWINARRDFGGLIFLDIRDRYGITQAVIQSE---THPDLAARAKELRSEWVVWIRGTVRMREPNPRIPTGVEVLAEDFGVINEAE 109
157 4.000e-34UniRef50_A0A2E7DFC8 Aspartate--tRNA(Asp/Asn) ligase n=4 Tax=Bacteria TaxID=2 RepID=A0A2E7DFC8_9PROT  ali  22  1....MHRYRTHTCNDLRPENVGETARLSGWIHRRREHGQLVFLDLRDHFGITQCVVDIE-----DQTFESVERTRVESVVTITGRVVRRDMNPRLPTGVELRIDSFEIQSSA. 107
158 5.000e-34UniRef50_A0A2A4X247 Aspartate--tRNA(Asp/Asn) ligase n=1 Tax=Candidatus Aerophobetes bacterium TaxID=2030807 RepID=A0A2A4X247_9BACT  ali  24  8.......KRTCNCGALRKEDVGKSVALSGWVHKRRDLGGLIFIDLRDRWGLTQIIFHPETAESS---YALAKTLRHEWVIHIKGEVRAREENKDHATGIEVSALHLHVLSESK 114
159 5.000e-34UniRef50_A0A087TX18 Aspartate--tRNA ligase, mitochondrial (Fragment) n=1 Tax=Stegodyphus mimosarum TaxID=407821 RepID=A0A087TX18_9ARAC  ali  24  26...NSFTWRTHTCGELNTAHVGQEVIICGWISYQRLDK---FIILRDQYGLTQVIF-KENDNSNK---KFLQSLSLESVVQVKGIVQKRPRKELRTGEIEVEVTDINLLNAS. 131
160 5.000e-34UniRef50_A0A1Z8LF63 Aspartate--tRNA(Asp/Asn) ligase n=6 Tax=Bacteria TaxID=2 RepID=A0A1Z8LF63_9BACT  ali  28  3.......KRTHLCNDLRKTDDGSTVVLAGWVNTYREHSKLVFIDLRDRHGLTQIVFDV--ADSPSEIVELAQGLRREDVIAIRGTVRVRGANPKLDTGIEVLATELEVLNKAE 110
161 5.000e-34UniRef50_A0A2M8D8T1 Aspartate--tRNA ligase (Fragment) n=1 Tax=Acidobacteria bacterium CG_4_9_14_3_um_filter_49_7 TaxID=1973888 RepID=A0A2M8D8T1_9BACT  ali  24  6........RTHTCGELNRHHVDETVILDGWINSHRDLGSLVFLDLRDRWGITQVTFN--EDDTAPDVFQHAKALRDWDVIRVSGKVRPRPVNKYMETGIEVEAKTMTLLNKTE 112
162 5.000e-34UniRef50_A0A1F2W8E0 Aspartate--tRNA ligase (Fragment) n=1 Tax=Actinobacteria bacterium RBG_13_35_12 TaxID=1797196 RepID=A0A1F2W8E0_9ACTN  ali  23  11........RTNLCGEINKEFKGREVTLSGWVNKRRDHGKLIFLDLRDFSGIVQLIFNP---NINKNSYNTAKDIRSEYVIRINGKVRMRSKNPSIPTGIEIVVKDIIILGRSK 116
163 5.000e-34UniRef50_C3YTL2 Uncharacterized protein (Fragment) n=1 Tax=Branchiostoma floridae TaxID=7739 RepID=C3YTL2_BRAFL  ali  25  3...SSYSLRSHTCGELRAVHAGEDVTLCGWVQFQRKQ---LFVTLRDSYGVIQLVLPQDKKH--ADMKQTLAHLPPESVVCVQGIVQLRPINKAMSTGVEVAVSKVEMVNKSK 111
164 5.000e-34UniRef50_A0A1Y4DWG9 Aspartate--tRNA(Asp/Asn) ligase n=1 Tax=Collinsella sp. An268 TaxID=1965612 RepID=A0A1Y4DWG9_9ACTN  ali  22  11AATNPHSLHTRTAGELRAENIGEEVTLTGWVWRRRDHGGLIFCDLRDRTGMTQCTFDPEHAAG--EAFHTAETMRPEWPILVHGTVIARDVNPKLPTGIEVLVDRVEVLNRSK 128
165 5.000e-34UniRef50_A0A2V8SZY7 Aspartate--tRNA ligase n=2 Tax=Bacteria TaxID=2 RepID=A0A2V8SZY7_9BACT  ali  30  12.......ERTHSCGELRASDAGREVVLMGWVAVRRDFGPLTFIDLRDRDGLTQVVFDAEDA---PDAHARAKEVRGEYVVAVRGQVVLRQENPKLPTGVEMQAREILVLNEAR 118
166 5.000e-34UniRef50_A0A2N2C978 Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase GatCAB subunit C (Fragment) n=6 Tax=root TaxID=1 RepID=A0A2N2C978_9FIRM  ali  22  7......TRRTNKCGTLRKENINERATVMGWVQKKRNLGSLVFIDLRDISGLVQVVFD---EELDKDAFDKASEVKSEYVITITGKVREREKNDSMPTGIEIYGEEIKILSQSE 112
167 6.000e-34UniRef50_A0A1I3P806 Aspartate--tRNA(Asp/Asn) ligase n=32 Tax=Bacteria TaxID=2 RepID=A0A1I3P806_HALDA  ali  27  6............CGSLRKDNIEQEVTLKGWVQKRRDLGGLIFIDLRDRSGVVQVVFNPE---TSGEALKTAENVRSEYVLEVKGHVVARDVNPNLGTGIEVAAEDVTILNKAK 107
168 6.000e-34UniRef50_A0A1Q8BJ06 Uncharacterized protein n=1 Tax=Crenarchaeota archaeon 13_1_20CM_2_51_8 TaxID=1805093 RepID=A0A1Q8BJ06_9CREN  ali  27  9.......RRTHMCGALRASDAEKKAVLMGWVNRRRDLGNLIFIDVRDRTGITQVVFHKE---NNPALHQKAGELRNEYVIAAIGAVKLREINKNIGTGIELIAEELRILNEAK 115
169 6.000e-34UniRef50_A0A1U7GNS4 Aspartate--tRNA(Asp/Asn) ligase n=22 Tax=Bacteria TaxID=2 RepID=A0A1U7GNS4_9BACT  ali  31  2.......KRTHTCGDLTKANVGEEVALNGWVDAWRDFGGLVFIDVRDRFGVTQVVFEPE---AGADLQAQARELRSEYVVGIRGKVAPRKENPKLKTGVEVRATELVVYNAS. 107
170 6.000e-34UniRef50_A0A2G2V530 Uncharacterized protein n=2 Tax=Capsicum TaxID=4071 RepID=A0A2G2V530_CAPBA  ali  24  72.....WVSRNQYCGELTENDVGKRVRLCGWVALHRIHGGLTFVNLRDQTGIVQITTLPDD---FPDAHSTMNGLRLEYVVAIEGVVWPRPVNKKMKTGIEVAAEDIRVLNA.. 178
171 7.000e-34UniRef50_Q741M7 Aspartate--tRNA(Asp/Asn) ligase n=272 Tax=root TaxID=1 RepID=SYDND_MYCPA  ali  24  3........RSHAAGSLRSSDAGQQVTLAGWVARRRDHGGVIFIDLRDASGITQVVFR------DPDVLKQAHRLRAEFCVAVTGLVEIRPENPEIATGIEVNASSLTVLGES. 104
172 7.000e-34UniRef50_C9LKX4 Aspartate--tRNA(Asp/Asn) ligase n=8 Tax=Bacteria TaxID=2 RepID=C9LKX4_9FIRM  ali  28  4.MAGMH--RSCGCGRVTEKDCGKELTLAGWVNTRRDHGGLIFIDLRDRSGIVQVVMSPQY---GEDAFHKAEDVRSEYVLAIRGIVRERSVNPKMQTGIEVVVSEMRVLNKAK 114
173 7.000e-34UniRef50_UPI00098DBAB8 aspartate--tRNA ligase, chloroplastic/mitochondrial-like n=2 Tax=Cajanus cajan TaxID=3821 RepID=UPI00098DBAB8  ali  24  72.....WVNRTALCGELTLNDVGKKVQLCGWVALHRVHGGLTFLNLRDHTGIVQVTTLPDE---FPDAHSAINDLRLEYVVAIEGVVRSRPINKKMKTGIEVAANRVQVLN... 177
174 8.000e-34UniRef50_C7PP18 Aspartate--tRNA ligase n=35 Tax=Bacteroidetes TaxID=976 RepID=C7PP18_CHIPD  ali  30  2.......YRTHTCGELRLEHQGTQVSLSGWIQTIRKFGSITFVDLRDRYGITQLLFGESFNDQLD-----AQPLGREFVIQAKGTVTERSKNPNIPTGIEITISEFTILNAAK 104
175 1.000e-33UniRef50_X1BXT5 Uncharacterized protein (Fragment) n=2 Tax=marine sediment metagenome TaxID=412755 RepID=X1BXT5_9ZZZZ  ali  27  1....MNLKRTHTCGQLRKGDVGQEVILNGWINSRRDHGGLVFIDLRDRYGKTQVVFDGEQ---TPEAFATAKHLGMEDVIAVRGKVVPRP....................... 83
176 1.000e-33UniRef50_A0A0F9RSN9 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=A0A0F9RSN9_9ZZZZ  ali  28  2....SYLIRNKNCADISEKNIGQDVIINGWVNKRRDHGGLIFLDVRDRSGLIQVVADPEV----KDAFAVAHKLRSEYVIAVKGKVQIRPENPELKTGVEVAVEEIQLLSKS. 109
177 1.000e-33UniRef50_A0A0G9GJQ0 Aspartate--tRNA ligase (Fragment) n=3 Tax=Lactobacillales TaxID=186826 RepID=A0A0G9GJQ0_LACPN  ali  29  2.......KRTTYAGLINEDYLGQTVTLQGWVQKRRDLGSLIFIDLRDREGIVQLVFSQE---FSADALAVADQLRGEYVIEVQGTVVNRNVNDRMKTGVEVEIHDAKILNKAK 108
178 1.000e-33UniRef50_A0A196Q356 Aspartate--tRNA(Asp/Asn) ligase n=16 Tax=Rhodobacteraceae TaxID=31989 RepID=A0A196Q356_9RHOB  ali  23  1....MHAYRSHTCADLNISNKGDAVRLSGWVHRVRDHGGILFIDLRDHYGMTQVLCDPD-----SPVFKDMEKVRSEWCIRIDGEVKARDINTKIPTGIEVFVRDIEVLGSA. 107
179 1.000e-33UniRef50_A0A1W4WKH8 aspartate--tRNA ligase, mitochondrial n=14 Tax=Neoptera TaxID=33340 RepID=A0A1W4WKH8_AGRPL  ali  19  69..TNKFTERTHTCGELRIANVGQTVTLCGWLEYQRMNK---FIVLRDSYGRTQLIIKENDTEPS----KCLESLPYETILKVQGTVQARPENSQQTGEIEVVIQSLEILNKA. 175
180 1.000e-33UniRef50_A0A142XGX7 Aspartate--tRNA(Asp/Asn) ligase n=2 Tax=Gemmata TaxID=113 RepID=A0A142XGX7_9BACT  ali  25  4......WQRTHTCEQLREEHVGQTITLNGWVLTVRDNGHQIFTDLRDRYGLTQVVFNKADD---ADLFAQAKELKSEWVVSVTGLVRKRARADISTGEIEIEAKTLRVLN... 108
181 1.000e-33UniRef50_Q7UFY6 Aspartate--tRNA(Asp/Asn) ligase n=405 Tax=root TaxID=1 RepID=SYDND_RHOBA  ali  25  3........RTHTCGALRKSDVGSPVTLCGWVDSKRDHGGAVFIDLRDRYGLTQVVIGPPEAN--EALIKQAGHVPNESVILIRGVVADRKTNAKLETGIEVRSEHFEILSASE 109
182 2.000e-33UniRef50_UPI000BA82A2E aspartate--tRNA ligase, mitochondrial-like isoform X3 n=1 Tax=Limulus polyphemus TaxID=6850 RepID=UPI000BA82A2E  ali  22  52...NSFTWRTHTCGELRSEHVGQQVTLCGWVQFHR-MGK--FITLRDGYGVTQLII-PEKSPVGYLM----KNLSLESVLKVEGTVVQRPQNKKMATGIEVEVVTADVLGKSK 157
183 2.000e-33UniRef50_X8AKH1 Aspartate--tRNA ligase n=18 Tax=Bacteria TaxID=2 RepID=X8AKH1_MYCAV  ali  22  3........RSHAAGSLRSSDAGQQVTLAGWVARRRDHGGVIFIDLRDASGITQVVFRA------EDVLAQAHRLRAEFCVAVSGVVEIRPENPEIATGIEVNATALTVLGES. 104
184 2.000e-33UniRef50_A0A2D8LCU8 Aspartate--tRNA(Asp/Asn) ligase n=6 Tax=Chloroflexi TaxID=200795 RepID=A0A2D8LCU8_9CHLR  ali  22  2.......YRDYYCGEPTENLVNKEITLSGWINKRRDHGGLLFIDLRDRTGLIQVVFDPENLKPSEINWNQF---RSEWIIKVKGLVKLRPKNPNLNTGIELIAKSYEVINXSK 108
185 2.000e-33UniRef50_A0A2R5LCB7 Putative aspartyl-trna synthetase translation (Fragment) n=1 Tax=Ornithodoros turicata TaxID=34597 RepID=A0A2R5LCB7_9ACAR  ali  19  24.HVNKHTWRTHTCGQLRTEDVGKHVTLCGWIQFKRMDK---FLVMRDAYGSTQIIIPEDEQASS----KLLQSVPLESVVQITGKVIERPKNKNLSTGIEVVCQQVKVLNAAK 132
186 2.000e-33UniRef50_UPI0009467F8F aspartate--tRNA ligase n=1 Tax=Hydrotalea flava TaxID=714549 RepID=UPI0009467F8F  ali  28  2.......YRTHTCGELNSNDVQKNVTLAGWVQTIRKFGSITFVDIRDRYGITQLLFNESLNDTLE-----ANPLGREFVIQAKGMVQERSKNPQLATGIEVVVTEFSILNKS. 103
187 2.000e-33UniRef50_A0A2E1VT50 Aspartate--tRNA(Asp/Asn) ligase n=2 Tax=Planctomycetes bacterium TaxID=2026780 RepID=A0A2E1VT50_9BACT  ali  25  1.MSTSASWRTHRCGDLRAEHIGEKVQLCGWAANRRDHGGVFFVDLRDRAGLVQLIADED---APAEAGPALDALHAEDVIQITGTVRPRQKNEDRDTGVEVLVETVQVLSHAQ 113
188 2.000e-33UniRef50_A0A2V6WS47 Aspartate--tRNA ligase n=1 Tax=Candidatus Rokubacteria bacterium TaxID=2053607 RepID=A0A2V6WS47_9BACT  ali  23  8......WKRTHTCGELRGTDADRAVTLMGWAFRRRDHGGLIFVDLRDRDGVTQCVFNPAEAGAAHA---RAEGVRSEFVLAVRGVVARRPENPRLPTGIEIQVRELRILNEAR 115
189 2.000e-33UniRef50_A0A1V5PV09 Aspartate--tRNA(Asp/Asn) ligase n=2 Tax=Bacteria TaxID=2 RepID=A0A1V5PV09_9ACTN  ali  23  21........RTVLCGELRNDSVGTDIKVCGWVNRRRDHGKLIFIDLRDFSGIIQVVTDS---NINEAVYNIAKDIRTEYIVAVEGKVSARPENRDLPTGIEIKADKISVLSQSK 126
190 2.000e-33UniRef50_A0A1F6QFM1 Aspartate--tRNA(Asp/Asn) ligase n=1 Tax=Candidatus Melainabacteria bacterium RIFCSPLOWO2_12_FULL_35_11 TaxID=1801609 RepID=A0A1F6  ali  28  10.....HLKRSHFCSDLKESDIGKIITVAGWVDTTRDLGGIIFIELRDHTGRFQIVADPAK---NKDVHKVFEHLRNEFVVIVKGPVTRRPENPNLPAGVEMYPAEIELLNRSK 118
191 2.000e-33UniRef50_Q2W3D5 Aspartate--tRNA(Asp/Asn) ligase n=5 Tax=cellular organisms TaxID=131567 RepID=SYDND_MAGSA  ali  18  279....MHVYRSHTCGQLKAADAGIQARLSGWVHRKRDHGNLLFVDLRDHYGITQCVID-----VSSPVFAALDKARPESVITVTGKVVKRSINPRLPTGIELQVAEVEIQSIA. 385
192 3.000e-33UniRef50_A0A2D6P3D1 Aspartate--tRNA(Asp/Asn) ligase n=10 Tax=cellular organisms TaxID=131567 RepID=A0A2D6P3D1_9ARCH  ali  25  7........RSHSCNELNEGDVKKSVSLGGFVHSNRDHGGLIFVDLRDRYGITQIVFDPK----NKKLFSDAEKLRREDVIVVSGKVRERPKNSSIKTGIEVLIDKIENISKAE 111
193 3.000e-33UniRef50_Q6F1A0 Aspartate--tRNA ligase n=48 Tax=Bacteria TaxID=2 RepID=SYD_MESFL  ali  25  2.......KRTHNCNQLNISNVNQEVTLKGWIKKIRKMGQITFIDLRDFYGITQIVVGENKQ-------ELINNLKPEYVISITGKVIERKKNADIPTGIEIEVKNIELINKSE 102
194 3.000e-33UniRef50_A0A1F5RPS5 Aspartate--tRNA(Asp/Asn) ligase n=1 Tax=Candidatus Eisenbacteria bacterium RBG_16_71_46 TaxID=1817856 RepID=A0A1F5RPS5_9BACT  ali  26  15......WRRSHTCGALTAADGGRPATLMGWVHRTRDHGGVLFVDLRDRYGITQVVFRPETG--GAELLARAEGLGNEWVIAARGPVARRPINPELATGVELEARELKVLSTA. 122
195 3.000e-33UniRef50_A0A293M393 Aspartyl-tRNA synthetase (Fragment) n=1 Tax=Ornithodoros erraticus TaxID=265619 RepID=A0A293M393_ORNER  ali  18  43...NKHTWRTHTCGQLRNEDVGKLVTLCGWLQFKRMDK---FVVMRDAYGTTQIIIPEDEPAGS----KLLESLPLESVIQVTGTVIERPKNENLPTGIEVVCQQVKVLNAAR 149
196 3.000e-33UniRef50_A0QWN3 Aspartate--tRNA(Asp/Asn) ligase n=132 Tax=Bacteria TaxID=2 RepID=SYDND_MYCS2  ali  25  3........RTHAAGSLRPADAGQTVTLAGWVARRRDHGGVIFIDLRDASGVSQVVFREG------DVLAAAHRLRAEFCVAVTGVVEVRPENPEIPTGIEVNATELTVLGES. 104
197 3.000e-33UniRef50_Q7NJA4 Aspartate--tRNA(Asp/Asn) ligase n=255 Tax=cellular organisms TaxID=131567 RepID=SYDND_GLOVI  ali  20  2........RSDYCGTLRSEHIGKTVSLYGWIDGWRDHGGVIFLDLRDYTGIVQIVADPQR---TPESYHLASSLRNEYVVRVEGRVSARPENPRLSTGVEVYADTLAVLNRAE 107
198 4.000e-33UniRef50_A0A0H5CK44 Aspartate--tRNA(Asp/Asn) ligase n=12 Tax=Bacteria TaxID=2 RepID=A0A0H5CK44_9PSEU  ali  23  3........RTHEAGTLRAEHAGQTITLTGWVARRRDHGGVIFIDLRDASGVAQVVFREG------EMAERAHRLRAEFCVKVVGEVAARPENPEIPTGIEVLVTELQVLSES. 104
199 4.000e-33UniRef50_A0A1Q3MHP2 Aspartate--tRNA ligase n=1 Tax=Armatimonadetes bacterium 55-13 TaxID=1895717 RepID=A0A1Q3MHP2_9BACT  ali  20  3.....FLQRTHACGSLRAEHAGQQVALNGWAHKVRDLGGLCFIDFRDRTGLVQLVLDPNSLPN-------LSEIRHETCLSVSGEVRVRDENPKMPTGIEIIVTGYTVLGPAK 107
200 4.000e-33UniRef50_A0A291IRK7 Aspartate--tRNA ligase n=1 Tax=Mesoplasma lactucae ATCC 49193 TaxID=81460 RepID=A0A291IRK7_9MOLU  ali  21  3........RTNNCGDLTLANVGEKVTLQGWIKKIRKLGGLTFIDLRDIHGITQLVIDENHE-------ALIQDLKPEYVIQVEGIVKERKKNLNIPTGIEVEVNDLKIINKSE 102
201 4.000e-33UniRef50_A0A1Z8PEV0 Aspartate--tRNA(Asp/Asn) ligase n=14 Tax=Bacteria TaxID=2 RepID=A0A1Z8PEV0_9BACT  ali  25  2.......KRTHTCGDLRDSDAGASVRLCGWVNTYREQGKLVFLDLRDRAGLTQVVC--DLEDSDSELVEIARGLRREDCIGVEGKVRMRDANDKLETGVELVAERIQVFSKSK 109
202 4.000e-33UniRef50_A0A1Z9Q4B1 Aspartate--tRNA ligase (Fragment) n=2 Tax=Cyanobacteria TaxID=1117 RepID=A0A1Z9Q4B1_9CYAN  ali  26  2........RSNGCGDLRETNINHSVQLCGWVDRRRDHGGVIFIDLRDRSGTVQITVDPD---LGAEAFAVAEHLRSETVLQVNGKVRARPANDKLATGVEVLASGITVLNSVK 107
203 5.000e-33UniRef50_Q7V3X1 Aspartate--tRNA(Asp/Asn) ligase n=65 Tax=cellular organisms TaxID=131567 RepID=SYDND_PROMM  ali  24  2........RSNGCGELRSKHIASNVKLCGWVDRCRDHGGVIFIDLRDRSGTIQITVDPDQGT---ELFASAESLRNETVLQITGLVRPRPINSKLSTGIEVLANGLEVLNP.. 105
204 5.000e-33UniRef50_Q6G330 Aspartate--tRNA(Asp/Asn) ligase n=181 Tax=Bacteria TaxID=2 RepID=SYDND_BARHE  ali  24  1....MHRYRSHHCAALRKCDVGIKARLSGWVHRVRDHGGILFVDLRDHFGITQIVADP-----ASPAFKIIEKVRSEWVIRVDGEVRARSINTSLPTGIEIFAKEVEILSKS. 107
205 5.000e-33UniRef50_A0A1Y5FI78 Aspartate--tRNA ligase (Fragment) n=3 Tax=Bacteria TaxID=2 RepID=A0A1Y5FI78_9GAMM  ali  24  2........RSSYCGLLDTTFLDQEVTLCGWVDRRRDHGGVIFIDLRDREGIVQIVCDPDSG----EHFNTADSVRGEYVLRIRGRVRARSVNPQMKTGIEVYATDVEILNASE 106
206 5.000e-33UniRef50_A0A0T9APR3 Aspartyl-tRNA synthetase (Aspartate-tRNA ligase) n=20 Tax=root TaxID=1 RepID=A0A0T9APR3_STREE  ali  24  2.......KRSMYAGRVREEHIGQEITLKGWVGRRRDLGGLIFIDLRDREGIMQLVINPEK--VSAEVMATAESLRSEFVIEVTGQVAAREQNDKLPTGVELNVTALIVLNTAK 107
207 5.000e-33UniRef50_A0A2H0XH73 Aspartate--tRNA(Asp/Asn) ligase n=2 Tax=unclassified Bacteria (miscellaneous) TaxID=49928 RepID=A0A2H0XH73_9BACT  ali  23  2........RTHTCGELRAKNSGENVTLQGWIDAIRDHGKMVFISLRDRYGVTQVVLA------DAELIEKGKKLGGEYVVEVEGMVRERPRNPSLETGIEVVASRIKLISSS. 103
208 5.000e-33UniRef50_A0A2D9Z0A8 Aspartate--tRNA(Asp/Asn) ligase n=13 Tax=Bacteria TaxID=2 RepID=A0A2D9Z0A8_9BACT  ali  29  3.......KRTHNCGDIRSSDIGNTIVLNGWVNKVRLHGQVVFIDLRDRYGKTQIVFDADEYAGD---FEIIKKISMEDVLSIKGIVRSRIENPNLATGIEILVSEFIMLNES. 108
209 5.000e-33UniRef50_A0A2X4UIJ2 Aspartate--tRNA ligase n=3 Tax=Enterobacterales TaxID=91347 RepID=A0A2X4UIJ2_9GAMM  ali  27  2........RTNYCGQLNIAHEGQKVTLCGWVNRRRDLGGLIFIDMRDREGIVQVFFDPER----KDIFEKASELRNEFCIQITGTVRARPR...................... 80
210 6.000e-33UniRef50_A0A1Z9FNN9 Aspartate--tRNA(Asp/Asn) ligase n=185 Tax=Bacteria TaxID=2 RepID=A0A1Z9FNN9_9RICK  ali  22  7.......YRTHYCGNLSSSNVDEIVKLSGWMHSIRDHGGLIFIDLRDQLGVAQIVIDQ-----NSPLFKKVEALKLESVITISGKVILRSKNDKIKTGIEVLVNDLDIISKSE 111
211 6.000e-33UniRef50_A0A2N2F5S8 Aspartate--tRNA(Asp/Asn) ligase n=1 Tax=Candidatus Dependentiae bacterium HGW-Dependentiae-1 TaxID=2013760 RepID=A0A2N2F5S8_9BACT  ali  25  25.......ERTVSCGAVTAAQLEKTVALCGWVHKRRDFGSLIFVDLRDRSGLVQLVFNP---TTCPEVHKAAHVLRSEFVIAVRGMLTPRAINPDMPTGWEVQVESLTVLNKAK 131
212 6.000e-33UniRef50_UPI0009514DC8 aspartate--tRNA ligase, mitochondrial-like n=1 Tax=Bos indicus TaxID=9915 RepID=UPI0009514DC8  ali  22  42...SSFVARTNTCGELRSSHLGQEVTLCGWIQFRRQN---IFLVLRDFHGLVQVVIPQDESAAS--VKKILCEAPMESVVQVSGTVISRPKNPKMPTGIEIKVKTAKLLNSCK 150
213 6.000e-33UniRef50_X8DPA1 OB-fold nucleic acid binding domain protein n=5 Tax=Actinobacteria TaxID=201174 RepID=X8DPA1_9MYCO  ali  26  3........RTHDAGSLRESNAGQRVTLAGWVARRRDHGGVIFIDLRDASGVAQVVFRED------AVLEQAHRLRAEFCVEVTGVVEVRPENDEIATGIEVNAAELKVLNES. 104
214 7.000e-33UniRef50_A0A0F8Y8S1 Uncharacterized protein (Fragment) n=5 Tax=root TaxID=1 RepID=A0A0F8Y8S1_9ZZZZ  ali  28  3.......KRTNTCGDLRAANVGESVIVCGWVKSYRDHGNLVFIDLRDRYGLVQLVFNPE---TQPEIHKTARDLRCEWVIAAKGTVSKRTENPKMVTG-EIE........... 96
215 7.000e-33UniRef50_A0A068NTQ4 Aspartate--tRNA(Asp/Asn) ligase n=1 Tax=Fimbriimonas ginsengisoli Gsoil 348 TaxID=661478 RepID=A0A068NTQ4_9BACT  ali  21  3.....FVQRTKTCGELRAAHAGEQVSLNGWAHRVRDLGGVLFVDLRDRTGLVQLTLDPNLFPNRNE-------IRSESCLSVTGEVRERAENPRMSTGIEVIVTSYSILGPAK 107
216 7.000e-33UniRef50_A1RSC5 Aspartate--tRNA(Asp) ligase n=13 Tax=Thermoproteaceae TaxID=2267 RepID=A1RSC5_PYRIL  ali  59  1....MYPKKTHWTSDITTDLHGREVTLAGWVWELRDLGKVKFIVLRDREGFVQLTL--KVGKTPEHVFRVFSELNREDVIVVKGVVETSKIAKR---GVEVFPTDITILNKAK 104
217 7.000e-33UniRef50_A0A1W9PGA5 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C (Fragment) n=4 Tax=Bacteria TaxID=2 RepID=A0A1W9PGA5_9THEM  ali  27  3........RTHTCGELRKADAGKKVKLCGWVHRIRDLGGIKFIVLRDRYGQTQVVVSP-----NSPCYETVERLKREYVILVEGIVRERPKNPSLPTG............... 90
218 8.000e-33UniRef50_A0A2V7XHJ3 Aspartate--tRNA ligase n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V7XHJ3_9BACT  ali  27  319........RTHYAGTLRPEHVGQTVTLMGWAAARRDLGGVIFIDLRDREGVCQVVARPE---VSEEAHDAADHVRGEYVLAVVGEVAARSVNPKIPTGVEVNAREIRVLSEAR 424
219 8.000e-33UniRef50_A0A2V9K2L1 Aspartate--tRNA ligase n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V9K2L1_9BACT  ali  27  6.......QRTHFCGEVHKSHAGQNVFLAGWVYRRRDLGNLIFLDLRDHTGLTQVVVNRE---VSAVAHSRAEEVRGEFIVGVEGEVVLRPENSQIPTGVEVRARTLLILNEAK 112
220 8.000e-33UniRef50_A0A2E2YLT1 Aspartate--tRNA(Asp/Asn) ligase n=4 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2E2YLT1_9CHLR  ali  27  3........KSHGCGEIRLSHVGQKVQLAGWVHRRRDHGGVIFIDLRDASGRVQIVI---RSXSIPDTTKEIANVRDEYVLMVIGEVHERSRNDDLPTGIEIKVEEVEVLNSSK 108
221 8.000e-33UniRef50_A0A0B3B407 Aspartate--tRNA(Asp/Asn) ligase n=1 Tax=Archaeon GW2011_AR21 TaxID=1579379 RepID=A0A0B3B407_ARCG8  ali  22  2.......KRTHNCGALSEKDIGKKAILQGWIARRRDHGELTFFELRDRYGATQVVFNAEK---NKKVHEEAKKVGKEFVVQVEGKAEKRPENPKLSTGIELIADSLKILNSCE 108
222 9.000e-33UniRef50_A0A2H6GTL3 Aspartate--tRNA(Asp/Asn) ligase n=9 Tax=unclassified Bacteria TaxID=2323 RepID=A0A2H6GTL3_9BACT  ali  29  2.......ERTLIID--TPKLIGETVKLAGWVNTRRDHGKLIFIDLRDRSGIIQTVIIPDK----KNAHKTAKEIRSEYVIEIEGLVKERPKNEKAPGGVEIEVEEIKILSKTE 105
223 9.000e-33UniRef50_R7QPH9 Aspartyl-tRNA synthetase n=1 Tax=Chondrus crispus TaxID=2769 RepID=R7QPH9_CHOCR  ali  23  38........RSHTCGQLRASHVGEQVRLHGWAHAVRDRGGVLFVLLRDRYGVVQVTI---GDQSPKEAVETGKNIRLEYVVGVEGTVTRRDVNLEMKTGIEIVATDVKIVSRTK 143
224 1.000e-32UniRef50_M1VCV1 Aspartate--tRNA ligase, mitochondrial and chloroplast n=1 Tax=Cyanidioschyzon merolae (strain 10D) TaxID=280699 RepID=M1VCV1_CYAM1 :_  ali  31  101........RTHVCGALRSEHVGCTVTVCGWAHTIRDRGGVTFLLLRDRHGIVQVTIDA---ASPEALRTQVKTIRRESVVRVRGTVRARDVNASMPTGVEIAAHVIEVLNRA. 205
225 1.000e-32UniRef50_A0A2E1ZWQ6 Aspartate--tRNA(Asp/Asn) ligase n=3 Tax=Chloroflexi TaxID=200795 RepID=A0A2E1ZWQ6_9CHLR  ali  26  7............CGSLQIKDAGTEAILAGWVARRRDHGGLTFIDLRDSSGTIQIVIENNKINLPE---KDINQIRNEWVLGVKGIVTERQENPNMPTGIEVSVTELEILNESQ 108
226 1.000e-32UniRef50_A0A2D7HVH3 Aspartate--tRNA(Asp/Asn) ligase n=5 Tax=Bacteria TaxID=2 RepID=A0A2D7HVH3_9DELT  ali  32  10GMGTL--RRSHSCGEIDASRVGDEVVVAGWAHRRRDHGGVIFVDLRDQKGLVQIVFRPE---TSTEAHQSAGDVRSEWVLLVRGVVEARSVNSKMVTGIEINVHELRILNSA. 120
227 1.000e-32UniRef50_A0A235BZ28 Aspartate--tRNA(Asp/Asn) ligase n=1 Tax=candidate division WOR-3 bacterium JGI_Cruoil_03_44_89 TaxID=1973748 RepID=A0A235BZ28_9BA  ali  23  2........RTHTCGELREKNSGENVTLQGWIDAIRDHGKMVFISLRDRYGVTQVVLA------NTELIEKASEFGGEYVVQVEGMVRERPSGSLDTGGIEVVASQMKLLSPS. 103
228 1.000e-32UniRef50_A0A2D7JDJ3 Aspartate--tRNA ligase (Fragment) n=15 Tax=Bacteria TaxID=2 RepID=A0A2D7JDJ3_9SYNE  ali  24  2........RSNGCGDLREQNIDQQVQLCGWVDRRRDHGGVIFIDLRDRSGTVQITVDPD---LGAEAFAVAEHLRSETVLXVNGKVRGRPTNDKLATGVEVLASGISVLNSVK 107
229 1.000e-32UniRef50_Q061X9 Aspartate--tRNA(Asp/Asn) ligase n=20 Tax=cellular organisms TaxID=131567 RepID=Q061X9_9SYNE  ali  28  2........RSNGCGDLRKDSIDAVVQLCGWVDRRRDHGGVIFIDLRDRSGTVQITVDPD---LGAEAFAVAEHLRSETVLQVHGKVRARPANDKLATGVEVLASEIVVLNK.. 105
230 1.000e-32UniRef50_A0A1V5CC76 Aspartate--tRNA ligase n=3 Tax=root TaxID=1 RepID=A0A1V5CC76_9DELT  ali  20  2........RDKQCGAVSRDDIGNTLTLSGWVFRRRDHGGLIFIDLRDVTGIVQVVFSPE---ISPDAHERAGDIKQEFVISITGKVRKRPENPNVPTGVEVYADTFQVLNTCK 107
231 1.000e-32UniRef50_A0A2T2SN35 Aspartate--tRNA ligase (Fragment) n=1 Tax=Bacteroidetes bacterium QH_2_67_10 TaxID=1919095 RepID=A0A2T2SN35_9BACT  ali  24  15...DPHPPRTGTCGALRMKDIGDAAVLKGWVDTRRRFGGMVFIDVRDRGGLTQVVFSEE--ELDEETYQAAQQLRREDVISVKGSVQERHENDELATGVEVHAADLAVLSVAE 124
232 1.000e-32UniRef50_A0A1X6QQN4 Aspartate--tRNA ligase n=1 Tax=Entomoplasmatales bacterium EntAcro10 TaxID=1941208 RepID=A0A1X6QQN4_9MOLU  ali  22  5.......YRTNNCGSLTKNDLKQNVILSGWIHAIRVKKNAIFLDLRDRYGLTQIVI-----KSDEPNFDNLKKLKVESVIQVTGQVVARQVNPKLATGIEVVAKKVKILSEAK 107
233 1.000e-32UniRef50_L5KZM3 Aspartyl-tRNA synthetase, mitochondrial n=1 Tax=Pteropus alecto TaxID=9402 RepID=L5KZM3_PTEAL  ali  22  44...SSFIARTNTCGELRSSHLGQEVTLCGWIQYRRQN---IFLVLRDSHGLVQIVIPQDESAAS--VKKILCEAPMESVVQVSGTVISRPENPKMPTGIEIKVKTAQLLNSCK 152
234 1.000e-32UniRef50_UPI000B90AE9C aspartate--tRNA ligase, mitochondrial-like isoform X5 n=1 Tax=Acanthaster planci TaxID=133434 RepID=UPI000B90AE9C  ali  20  43...NSFSWRTHSCGELSAAQVGQSVKLCGWIQHKR----FDFLTLRDAFGVTQVVLPKKDEESLPKM-ETLEKVHLESVIMVQGMVQFRPENPKMPTGIEVVASDIKVLNPSK 152
235 2.000e-32UniRef50_A0A1G3MS52 Aspartate--tRNA(Asp/Asn) ligase n=3 Tax=Bacteria TaxID=2 RepID=A0A1G3MS52_9SPIR  ali  29  2.......KRSTTCGALSATDVGKTVVLNGWVHRKRDHGGISFINLRDRYGVTQVVVDAD---ASDSLKAVAAELRHEFCIAIEGVVRARPVNKDMATGIEVVAGQLQILTRC. 107
236 2.000e-32UniRef50_UPI000A348CA3 aspartate--tRNA ligase n=1 Tax=Campylobacter sp. P0187 TaxID=1895615 RepID=UPI000A348CA3  ali  21  2........RSHYCTDLDAQDIGKSVSLCGWANSYRDHGGVIFIDLRDRSGIIQLVCDP---ADSKSAHEIASKVRDEYVLRAKGKIRARGENPKLKTGIEVIIDELIIENES. 106
237 2.000e-32UniRef50_A0A2K9NNT7 Aspartate--tRNA ligase n=3 Tax=Oligoflexia TaxID=1553900 RepID=A0A2K9NNT7_9PROT  ali  27  11........RTHHCGELRDSDVGSTVVLCGWVNKYRNLGSLHFIDLRDKYGVTQLGFVNFKGNI-----EDLKKCSLESVILAKGVVQARPKNAQMDTGVEVQVEELTLLSKS. 113
238 2.000e-32UniRef50_UPI000833B6EC aspartate--tRNA ligase n=4 Tax=Leptotrichiaceae TaxID=1129771 RepID=UPI000833B6EC  ali  24  2.......YRTHKLNELRISNVGNTVKVSGWVDKVRDLGHFVFIDLRDRYGITQILVN---ENSPKEVLEKAKKLKNEYVIEVNGTVSERSKNPNLETGIEVLALDINVLSESK 106
239 2.000e-32UniRef50_A0A1V5CKW8 Aspartate--tRNA(Asp/Asn) ligase n=21 Tax=root TaxID=1 RepID=A0A1V5CKW8_9DELT  ali  23  3........RTHTCGELNISNVGHSVVLTGWVYRHRNHGGIIFIDLRDRYGHIQIKFDP---IVNEAIWSEVTKLRREWVIRVAGDVKFRPINPKIQTGIEIAAKDLMILGESK 108
240 2.000e-32UniRef50_A0A0D4CKW4 Aspartate--tRNA ligase n=24 Tax=Firmicutes TaxID=1239 RepID=A0A0D4CKW4_LACMC  ali  30  2.......KRTNYAGETSEQQIGQEVVVKGWVAKRRNLGGLIFIDLWDRSGIVQLVFDEK---IDPAAFEIANQVRNQYVIEAHGLVRARKENPDMKTGIEIEVKEASILAKSK 106
241 2.000e-32UniRef50_A0A2E4AIH2 Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase GatCAB subunit C (Fragment) n=1 Tax=Candidatus Marinimicrobia bacterium TaxID=202676  ali  32  4........RTHTCGELQSKDSGKSVILNGWVNTVRLHGQVVFVDLRDRYGKTQIVFNSEDYNGD---FEQVKKLSMEDVLSISGDVRDRDKNSDMPTGVEVFVTTMEILNYA. 108
242 2.000e-32UniRef50_A0A2W6D6S8 Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase GatCAB subunit C (Fragment) n=1 Tax=Pseudonocardiales bacterium TaxID=2201155 RepID=  ali  26  3........RTHEAGTLRASHAGQSVTLAGWIATRRDHGGVTFIDLRDASGVAQVVLREAG---------LAHNLRNEWVVAVTGEVRERPVNPVIPTGVEVIATGLEVLNES. 101
243 2.000e-32UniRef50_A0A0I1WKT3 Aspartyl-tRNA synthetase n=21 Tax=root TaxID=1 RepID=A0A0I1WKT3_SHISO  ali  22  2........RTEYCGQLRLSHVGQQVTLCGWVNRRRDLGSLIFIDMR-----VQPALTRPHDPDRADALKLASELRNEFCIQVTGTVRARDENRDMATGIEVLASSLTIINRA. 105
244 3.000e-32UniRef50_A0A2V8ALB3 Aspartate--tRNA ligase (Fragment) n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8ALB3_9BACT  ali  30  42........RTHTCGALRADDVGAEVVLLGWAHRIRDLGGVTFIDIRDRAGISQVVVRE-----NEALMGVAKRLRSEFVIGVSGVVQRRSENPKLATGVEVLSRDIRILNEAK 145
245 3.000e-32UniRef50_A0A1V6C4P1 Aspartate--tRNA(Asp/Asn) ligase n=1 Tax=candidate division TA06 bacterium ADurb.Bin131 TaxID=1852827 RepID=A0A1V6C4P1_9BACT  ali  26  3........RTHTCGQINLDDVGKKVMLAGWVSSIRDHGNIIFFDLRDRYGITQIVCNLP--ELTPELLELVNKVRQEFVIQISGSVVARSVNPKISTGIEVILEDAKILNTS. 108
246 3.000e-32UniRef50_A0A182MM31 Uncharacterized protein n=20 Tax=Culicidae TaxID=7157 RepID=A0A182MM31_9DIPT  ali  19  18...NQFTTRSHNCGELRISHVGQEVTLCGWLEFSRMNK---FFTLRDGYGTVQSIIPEDVCHKFN-----LDQLAFESILRVTGTVQPRPDNKSLPTGIEIHVSQLEVLNEAK 123
247 3.000e-32UniRef50_A0A2I3TG46 Aspartyl-tRNA synthetase 2, mitochondrial n=11 Tax=Bilateria TaxID=33213 RepID=A0A2I3TG46_PANTR  ali  22  45...SSFVVRTNTCGELRSSHLGQEVTLCGWIQYRRQN---TFLVLRDFDGLVQVIIPQDESAAS--VKKILCEAPVESVVQVSGTVISRPENPKMPTGIEIKVKTAELLNACK 153
248 3.000e-32UniRef50_I1BM44 Uncharacterized protein n=3 Tax=Mucorineae TaxID=1344963 RepID=I1BM44_RHIO9  ali  23  513.....YPSRTHYCGDLRATNEGEKVVLCGWAQSSRSLSQLIFIPIRDHSGVTQLVF---RDNNNPQLKSQIQSLSAENVICVEGIVRKRPEGKQATGEIEVEIKTIYCLNPA. 621
249 3.000e-32UniRef50_A9FNM8 Aspartate--tRNA(Asp/Asn) ligase n=25 Tax=Deltaproteobacteria TaxID=28221 RepID=A9FNM8_SORC5  ali  25  9.......KRTHRCGDLREADIGKEVVLFGWVARRRDHGGCIFIDLRDRTGVTQIVFDRSEEKDLVDAHAAAERARSEWVIGVRGVVVSREVNDKIDTGIEVWVAEATIFNRAE 129
250 3.000e-32UniRef50_Q8ZYM8 Aspartate--tRNA(Asp) ligase n=10 Tax=Thermoprotei TaxID=183924 RepID=SYD_PYRAE  ali  82  1....MYPKKTHWTAEITPNLHGTEVVVAGWVWELRDIGRVKFVVVRDREGFVQVTL--KAGKTPDHLFKVFAELSREDVVVIKGIVEASKIAK---SGVEIFPSEIWILNKAK 104
251 4.000e-32UniRef50_A0A2D7ILA4 Aspartate--tRNA(Asp/Asn) ligase n=5 Tax=cellular organisms TaxID=131567 RepID=A0A2D7ILA4_9BACT  ali  28  3.......KRTHNCGEIRLSEIDESVILNGWVNKVRLHGQIVFIDLRDRYGKTQIVFDSDHYKGD---FELIKKISMEDVLSICGIVRKTAINPNLKTGIEILVSDFVMLNEA. 108
252 4.000e-32UniRef50_A0A1Z5L1A2 Methyltransferase (Fragment) n=1 Tax=Ornithodoros moubata TaxID=6938 RepID=A0A1Z5L1A2_ORNMO  ali  25  39...NRHTWRTHTCGQLRSEDVGKVVTLCGWVQFKRLTK---FLVVRDAYGSTQVLIPEDE----EASAKLVQSLPLESVVQITGKVIERPRNKDLSTGVEVVCQQVKVLNTAK 145
253 4.000e-32UniRef50_A0A1Z8NRF6 Aspartate--tRNA ligase (Fragment) n=1 Tax=Synechococcus sp. TMED20 TaxID=1986597 RepID=A0A1Z8NRF6_9SYNE  ali  20  3......WRRSNLCGTLRVENLGETVTIMGWCQTRRDHGGVIFIDLRDYTGICQVVFRKE---ASAKAHERADSIRSEFVMAVRGKVENRIENPKLPTGIEIIVHELNILSESQ 110
254 4.000e-32UniRef50_B7QK15 Aspartyl-tRNA synthetase, putative n=17 Tax=Bilateria TaxID=33213 RepID=B7QK15_IXOSC  ali  24  42SVLNRYTWRTHTCGELRPVHRGKQVTLCGWILFKRMDK---FLIVRDAYGITQVVIPDDEKAAST----LLESLPLESVVQITGEVVERPQNENLPTGIEVLCKELKALNNAK 151
255 4.000e-32UniRef50_A0A2K5R7R5 Aspartyl-tRNA synthetase 2, mitochondrial n=21 Tax=Eutheria TaxID=9347 RepID=A0A2K5R7R5_CEBCA  ali  22  45...SSFVVRTNTCGELRSSHLGQEVTLCGWIQYRRQN---TFLVLRDFHGLVQVIIPQDESAAS--VRKILCEAPMESVVQVSGTVISRPENPKMPTGIEIKVKTAELLNACK 153
256 4.000e-32UniRef50_B0S1N6 Aspartate--tRNA ligase n=19 Tax=Terrabacteria group TaxID=1783272 RepID=B0S1N6_FINM2  ali  22  3SMGNL--RRTHMCGELRLSDVNKEVILMGWVQKERNLGSLIFIDLRDNTGITQIAIKDD----NKEIFDKAKDVKSEYVLCVKGDVREREKNNNIPTGIEVIANELIVLDTA. 110
257 4.000e-32UniRef50_A0A1F5AKH4 Aspartate--tRNA(Asp/Asn) ligase n=7 Tax=Bacteria TaxID=2 RepID=A0A1F5AKH4_9BACT  ali  27  12......WKRTVYAGLVRPDHAGREVTLLGWVQRHRDMGGILFIDLRDREGLVQVVFSPDR----PELLEAARKVRPEYVVGVRGAVRLRAANPEMATGVEVEALDFTVFNASK 118
258 4.000e-32UniRef50_A0A1L4CY90 Aspartate--tRNA(Asp/Asn) ligase n=2 Tax=Bacteria TaxID=2 RepID=A0A1L4CY90_9PROT  ali  21  1....MQTLRSHNCSELNTTHLNQNVTLMGWVHSKRDLGGLIFIDVRDHYGITQVVIHPHM-----PFFAEASTVRQESVIQILGKVVKRENAKLSTGEIEVNASAFHIESPSE 107
259 4.000e-32UniRef50_I0GJD0 Aspartate--tRNA ligase n=1 Tax=Caldisericum exile (strain DSM 21853 / NBRC 104410 / AZM16c01) TaxID=511051 RepID=I0GJD0_CALEA  ali  31  3.......KRTVGAGEIDENLIGNVVIVNGWLHRKRNLGGILFLDVRDRSGIVQVVVNP--NDIPKEKFETIENLKVESVLAVKGTVKRRETNPKLKTGIEIQLSDFEIFSKAE 108
260 5.000e-32UniRef50_A0A1G1G5U9 Aspartate--tRNA(Asp/Asn) ligase n=2 Tax=Bacteria TaxID=2 RepID=A0A1G1G5U9_9BACT  ali  21  3........RDKGCGDIRESDTGSTLTICGWVFRRRDHGGLIFIDLRDRSGILQIVFSPD---ASGNAHKLAHDLRSEFVISVSGEIRRRPENPNMITGVEMYVNRIEVLNES. 107
261 5.000e-32UniRef50_Q2LPW5 Aspartate--tRNA(Asp/Asn) ligase 1 n=54 Tax=root TaxID=1 RepID=SYDN1_SYNAS  ali  24  20.....FSER-VFCGHLTPDHTGRRVLLAGWVDAFRDHGGLLFIHLRDRNGIIQIVFSPE--AASADVYRQAASLRAEYCVAVQGEVRKRTENPHIETGIEVFVSELTVLSESE 128
262 5.000e-32UniRef50_A0A2E8KLC7 Aspartate--tRNA ligase (Fragment) n=1 Tax=Planctomycetaceae bacterium TaxID=2026779 RepID=A0A2E8KLC7_9PLAN  ali  23  10........RTHTCGELRSNHLEENVTLCGWVDRVRDHKGVIFIDLRDRWGKAQIVIGPD---APTEVMERARAARSEWVLSASGRVGRRPEGKLLTGEIEVVCXNLEILNEA. 114
263 5.000e-32UniRef50_A0A255HD86 Aspartate--tRNA(Asp/Asn) ligase n=17 Tax=Actinobacteria TaxID=201174 RepID=A0A255HD86_9ACTN  ali  32  3........RTHAAGTLRSADLGQTVTLAGWVAKRRDHGGVAFIDLRDASGVCQVVVRDEYLES-----AGIHDLRNEFCVKVTGVVEARSVNPNLPTGVEIVIRELEVLNPA. 105
264 6.000e-32UniRef50_A0A1Y5F690 Aspartate--tRNA ligase n=1 Tax=Halobacteriovorax marinus TaxID=97084 RepID=A0A1Y5F690_9PROT  ali  23  9........RTHNCGELREDQVGQTVTLCGWVNKYRDLGALHFIDLRDKYGLTQLGFEQFEGDLT-----ILKDCALESVIKATGVVALRPKNKKMDTGVEIQVKSLEILSR.. 110
265 6.000e-32UniRef50_Q9PHM7 Aspartate--tRNA(Asp/Asn) ligase n=460 Tax=root TaxID=1 RepID=SYDND_CAMJE  ali  20  2........RSHYNTDLGISHVGQSVKLCGWVNSYRDHGGVIFIDLRDRSGIIQLVCDP---NDSKEAHEIASNARNEFVLITEGTIRPRGENPKLKTGIEVVVSKLTIENES. 106
266 7.000e-32UniRef50_Q5R5I5 Uncharacterized protein DKFZp469I0720 n=2 Tax=Hominidae TaxID=9604 RepID=Q5R5I5_PONAB  ali  22  45...SSFVVRTNACGELRSSHLGQEVTLCGWIQYRRQN---TFLVLRDFDGLVQVIIPQDESAAS--VKKILCDAPVESVVQVSGTVISRPENPKMPTGIEIKVKTAELLNACK 153
267 7.000e-32UniRef50_A0A1X2HS27 tRNA synthetases class II-domain-containing protein n=3 Tax=Mucoromycota TaxID=1913637 RepID=A0A1X2HS27_SYNRA  ali  25  61....PYPARTHQCGQLRASHDGQRVVLCGWVQSQRSLSQLIFLPIRDASGTTQLVYRAEST-TDPALKASLQRLTNESVICAEGIVRTRPRNPQQATGIEVELTAVYCLNPA. 172
268 7.000e-32UniRef50_A0A0U3FUK1 Aspartate--tRNA ligase n=13 Tax=Terrabacteria group TaxID=1783272 RepID=A0A0U3FUK1_EUBLI  ali  21  4......TYRNALCGELNTEFVGQTVKLCGWTDTRRNLGGVLFIDLRDRSGKVQLVVN---EEVSVEAFAEAEKVRNEYVLCIEGEVVNRDVNPKMATGIEVMVKSLTILDTA. 110
269 7.000e-32UniRef50_A0A1J5C167 Aspartate--tRNA ligase n=3 Tax=Caldiserica TaxID=67814 RepID=A0A1J5C167_9BACT  ali  26  11.......KRNVKCGEISENEIGKTVIVNGWIHRKRDLGGLLFIDLRDRSGIVQVVVDPK--NISKEKSEEIQGLKNESVVGIEGKVKNREPNLNLPTGFEILLQAFEIFSKSE 116
270 7.000e-32UniRef50_A0A2E5VVB8 Aspartate--tRNA(Asp/Asn) ligase n=41 Tax=Bacteria TaxID=2 RepID=A0A2E5VVB8_9BACT  ali  25  3.......KRTHTCGDLRSSEINNQVILNGWVNKVRLHGQVVFIDLRDRYGKTQIVFDAD---AYDGEFEDINKISMEDVLSVKGLVRSRIENPNLSTGIEVIVSEFIMLNES. 108
271 7.000e-32UniRef50_Q5GTS0 Aspartate--tRNA(Asp/Asn) ligase n=71 Tax=cellular organisms TaxID=131567 RepID=SYDND_WOLTR  ali  23  1....MNYYKTHTCNELRKNDVEKEVTLSGWMYRKRDHGNLIFVDLRDFYGITQLVFNNDK-----DFFCKISDLKPESVITVTGIVKARTENISISTGIEVTVNNLQIESEVE 108
272 8.000e-32UniRef50_A0A087CJK7 Aspartate--tRNA(Asp/Asn) ligase n=2 Tax=Bifidobacterium pullorum TaxID=78448 RepID=A0A087CJK7_9BIFI  ali  31  448SMSQT-AYRTHHATEVTEALVGEQVTLAGWVDRRRDHGGVAFVDLRDSSGLVQVVINDE---------EMARPLRSEFVVRVIGAVRLRPENEHLATGVEVVARSIEILAKS. 553
273 8.000e-32UniRef50_A0A1V5QPE6 Aspartate--tRNA(Asp/Asn) ligase n=1 Tax=archaeon ADurb.Bin336 TaxID=1866922 RepID=A0A1V5QPE6_9ARCH  ali  21  2.......RRTHTCGELNSSNFGAKVILEGWADTIRNHGNITFIDLRDRYGVTQIVVDNTK---SDSIAQVTKSIRKEFVIHVEGLVRARPENKDLSTGIEVDVEKVFVVNSS. 107
274 8.000e-32UniRef50_A0A182IJ89 Uncharacterized protein n=1 Tax=Anopheles atroparvus TaxID=41427 RepID=A0A182IJ89_9DIPT  ali  19  375...NQFTNRSHHCGELRLEHVGQQVTLCGWLEFSRMNK---FFTLRDGYGIVQALIPEDRCQQLS-----LDGLSFESILRVTGSVQQRPENKSLPTGIEIHVSGLEVLNEAK 480
275 8.000e-32UniRef50_A0A1Y6CPJ8 Aspartate--tRNA(Asp/Asn) ligase n=1 Tax=Pseudobacteriovorax antillogorgiicola TaxID=1513793 RepID=A0A1Y6CPJ8_9PROT  ali  25  2...SKSWTRTHHLGEISERSIDETVTIMGWVHHRRDHGHVVFIDLRDRYGVAQLVLDP---AISPDAHQVAESCRHEYVLAAKGRVRRRPDNDSIRTGIEIEVHQAKILNPS. 111
276 9.000e-32UniRef50_E5GBH9 Aspartyl-tRNA synthetase n=1 Tax=Cucumis melo subsp. melo TaxID=412675 RepID=E5GBH9_CUCME  ali  23  81........RTALCGELSVDDVGKRVRLCGWVALHRVHGGLTFLNLRDHSGIVQVTTLPNE---FPDAHSAINDLRLEYVVAVEGTVRSRPVNVKMKTGIEVAAEHVQILN... 183
277 9.000e-32UniRef50_A0A1F6H152 Aspartate--tRNA ligase n=41 Tax=root TaxID=1 RepID=A0A1F6H152_9BACT  ali  27  7........RTLTIEAIEAS--GKKITVYGWVRLRRDHGKLIFLDIRDRTGIIQAVVNPK---VSQEAYKTAQTLRAEDVVEIAGKVNKRPEAELETGTIELEASSIEIISKAE 110
278 9.000e-32UniRef50_Q6PI48 Aspartate--tRNA ligase, mitochondrial n=31 Tax=Tetrapoda TaxID=32523 RepID=SYDM_HUMAN  ali  22  45...SSFVVRTNTCGELRSSHLGQEVTLCGWIQYRRQN---TFLVLRDFDGLVQVIIPQDESAAS--VKKILCEAPVESVVQVSGTVISRPENPKMPTGIEIKVKTAELLNACK 153
279 1.000e-31UniRef50_A0A1Y6BWH1 Aspartate--tRNA ligase n=1 Tax=Pseudobacteriovorax antillogorgiicola TaxID=1513793 RepID=A0A1Y6BWH1_9PROT  ali  24  3........RTHTAGQLTEQDVNKTVTLAGWVDRVRDLGQLFFLNLRDRYGLTQCV--YESSDSNDSTMSSLKSLANEYCVQVTGAVRKRDINSELSTGVEIVIETVKVLNTSE 109
280 1.000e-31UniRef50_Q9PCC5 Aspartate--tRNA ligase n=56 Tax=root TaxID=1 RepID=SYD_XYLFA  ali  35  2........RTHFCGLIDETLIGHTVTLAGWTDVARNLGGVCFIDLRDHEGIVQVTVDSRADQNNSELFKVASGLSYEDVLQVEGVVCARHVNDKIKTGVEVIATKIKILNKA. 108
281 1.000e-31UniRef50_Q8BIP0 Aspartate--tRNA ligase, mitochondrial n=79 Tax=Bilateria TaxID=33213 RepID=SYDM_MOUSE  ali  21  44...SSFVARTNTCGELRSSHLGQEVTLCGWIQYRRQN---TFLVLRDCHGLVQILIPQDESAAS--VRRILCEAPVESVVRVSGTVISRPENPKMPTGIEIKVKTAELLNACK 152
282 1.000e-31UniRef50_A0A109UVS7 Aspartate--tRNA(Asp/Asn) ligase n=10 Tax=Archaea TaxID=2157 RepID=A0A109UVS7_9EURY  ali  32  8......WRRTHYAKDATPEIAGSDVTIMGWVHEIRDLGGIIFVIIRDVTGRVQITAPSKK--VEAEILEDLRSFRKESVVAIKGAVQ---EAPKAPNGVEIIPKEIRVLNLA. 108
283 1.000e-31UniRef50_Q52428 Aspartate--tRNA(Asp) ligase n=467 Tax=root TaxID=1 RepID=SYD_THEKO  ali  38  2.......YRTHYSSEITEELNGQKVKVAGWVWEVKDLGGIKFLWIRDRDGIVQ--ITAPKKKVDPELFKLIPKLRSEDVVAVEGVVNFTPKAKL---GFEILPEKIVVLNRAE 102
284 1.000e-31UniRef50_A0A2V3IW26 Aspartate--tRNA(Asp/Asn) ligase n=1 Tax=Gracilariopsis chorda TaxID=448386 RepID=A0A2V3IW26_9FLOR  ali  26  40........RTHTCGQLRVSDVGSSVRLHGWAHAVRDKGGVLFVLLRDRYGVIQVIF---GDESPSHIVEAAKDIRIEYVVGVSGVVARRDENQDMETGIEVIANDVVIVSKTK 145
285 1.000e-31UniRef50_A0A2G8HZ59 Aspartate--tRNA ligase n=6 Tax=Oligoflexia TaxID=1553900 RepID=A0A2G8HZ59_9PROT  ali  23  9........RTHNCGELREDQVGQTVTLCGWVNKYRDLGALHFIDVRDKYGLTQLGFEQFKGDLS-----VLKDCALESVIKATGKVAMRPQNKKMDTGVEVQVESLEVLSR.. 110
286 1.000e-31UniRef50_Q3KRD0 Aspartate--tRNA ligase, mitochondrial n=251 Tax=Gnathostomata TaxID=35060 RepID=SYDM_RAT  ali  22  44...SSFVARTNTCGELRSSHLGQEVTLCGWIQYRRQN---TFLVLRDCHGLVQILIPQDESAAS--VRRTLCEAPVESVVRVSGTVIARPENPKMPTGIEIKAKTAELLNACK 152
287 1.000e-31UniRef50_A8ESW7 Aspartate--tRNA(Asp/Asn) ligase n=53 Tax=root TaxID=1 RepID=SYDND_ARCB4  ali  24  2........RTHYCTDVTEKLIGQTVTVAGWVNSRRDHGGIIFIDLRDKSGLVQLVADPQDC---KDALAIAETVRDEFVLIATGKVRARGENPNLITGIEIILENLVIENRSR 107
288 2.000e-31UniRef50_A0A0S7LUS4 SYDM (Fragment) n=3 Tax=Clupeocephala TaxID=186625 RepID=A0A0S7LUS4_9TELE  ali  22  44...SSLSFRTHTCGELRSHHVGEKVTLCGWVQYLR---QDLFVILRDFSGLTQLLIPQEDSAIS--VKAALCDLSVESVIKVTGTVRRRPENKAMPTGVEVLAENVEVFNTCQ 152
289 2.000e-31UniRef50_A0A1F5NZP8 Aspartate--tRNA ligase n=1 Tax=Candidatus Delongbacteria bacterium GWF2_40_14 TaxID=1817817 RepID=A0A1F5NZP8_9BACT  ali  25  3........RTNTCGELRKSDSGKYVVLSGWVHKYRNLGGLIFLDLRDRYGITQVMFDPK--NTADNVLKTADLCRNEYVVTVSGSVQIKPENKNLATGIEIAADGIIIENES. 106
290 2.000e-31UniRef50_A0A0G1VTT8 Aspartate--tRNA ligase n=2 Tax=unclassified Parcubacteria group TaxID=1794840 RepID=A0A0G1VTT8_9BACT  ali  26  3........RTWNIDIVNK--IGGEVQLYGWVHARRDMGKIIFIDLRDRTGIMQVVFAPKEVG---GAYEFAKALRSEYVVSIIGTVQKRTENPKLPTGVEILAADLKILNESK 106
291 2.000e-31UniRef50_A0A2G6M1N8 Aspartate--tRNA(Asp/Asn) ligase n=5 Tax=Bacteria TaxID=2 RepID=A0A2G6M1N8_9BACT  ali  22  4GIFSKEWKRSVRCGEIREEHQRQTVTVNGWVRKRRDLGGIIFIEVWDATGEVQVVFNPDRC---PQAHDRAKDLRSEFVVAVTGSVQSRPENDQMDTGHELLADDFVLLAPS. 116
292 2.000e-31UniRef50_UPI0005C38EE5 aspartate--tRNA ligase, mitochondrial-like n=1 Tax=Crassostrea gigas TaxID=29159 RepID=UPI0005C38EE5  ali  32  56...NNFSQRSHSCGEFRPSHIGEEVKICGWVQYKR----LMFLIVRDWSGTVQVLL-------PESMLGVLKDLPFESVVEITGIVHARKINQEMETGIEIQAKSIKVLN... 155
293 2.000e-31UniRef50_A0A1U8L0N1 aspartate--tRNA ligase, chloroplastic/mitochondrial-like isoform X1 n=10 Tax=cellular organisms TaxID=131567 RepID=A0A1U8L0N1_GOS  ali  20  71.....WVSRTAYCGDLSNQDVGSRVRLCGWVALHRVHGGLTFFNLRDHTGIVQITSLPGE---FPDAHEAIKDLRLEYVVSVDGFVRSRPVNKKMKTGIEVAAEHVQILNA.. 177
294 2.000e-31UniRef50_A0A1W9P703 Aspartate--tRNA ligase n=1 Tax=Candidatus Aminicenantes bacterium 4484_214 TaxID=1968529 RepID=A0A1W9P703_9BACT  ali  25  7......WKRTSYCGQLRSANEGQQVVLMGWVCGHRDLGNLLFVDLRDRAGIVQLVFSSE----DPSLLAQARKLGLEDCVGVKGRVRRREVNPQLSTGIEVVVADLKVFNQAQ 113
295 2.000e-31UniRef50_A0A2N1Q6R4 Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase GatCAB subunit C (Fragment) n=1 Tax=Tenericutes bacterium HGW-Tenericutes-3 TaxID=20  ali  26  2.......KYTHHNNELNINHLGQEVFLKGWVSKNRNLGGLMFIDLRDRFGITQLVVKPE-----NAFYETALKIKNEYVIEASGIVIGREKNKNIATGIEVEVTKLTILSAAE 104
296 3.000e-31UniRef50_F4JJT9 Aspartate--tRNA ligase, chloroplastic/mitochondrial n=41 Tax=malvids TaxID=91836 RepID=SYDM_ARATH  ali  23  72.....WVSRTELCGELSVNDVGKRVHLCGWVALHRVHGGLTFLNLRDHTGIVQVRTLPDE---FPEAHGLINDMRLEYVVLVEGTVRSRPVNKKMKTGVEVVAEHVEILNP.. 178
297 3.000e-31UniRef50_F5WS63 Aspartate--tRNA ligase n=23 Tax=cellular organisms TaxID=131567 RepID=F5WS63_ERYRF  ali  28  2.......ERTHHNGMLRIEHVGEHVELVGWVAKRRNFGSINFIDLRDRSGLVQLVVNHDE-------YPIVQELKNEFVISVSGTVRERDKNPKMDTGIEIEVTEVKIINKA. 101
298 3.000e-31UniRef50_A0A2G3BKM2 Uncharacterized protein n=1 Tax=Capsicum chinense TaxID=80379 RepID=A0A2G3BKM2_CAPCH  ali  23  79.....WVSRNQYCGELTGNDVGKRVRLCGWVALHRIHGDLTFVNLRDQTVIVQIITLPDD---FPDAHSTMNGLRLEDVVAIEGVVRPRPVNKKMKTGIEVAAEDVQVLNA.. 185
299 3.000e-31UniRef50_A0A0Q3XA57 Aspartate--tRNA ligase n=2 Tax=Aves TaxID=8782 RepID=A0A0Q3XA57_AMAAE  ali  22  42...NSFVTRTNTCGELRSAHVGQEVTLYGWIQYQR-QG--LFLVLRDFQGLIQVIIPQDEAHS--HVKNLLSNAPVESVVRVTGIVSPRPENPKMPTGIEVKAETAEILNSCK 150
300 3.000e-31UniRef50_W6A762 Aspartate--tRNA ligase n=11 Tax=root TaxID=1 RepID=W6A762_9MOLU  ali  25  2.......KRTHTCGQLNIANVNQTVTLQGWIAKVRKMGALTFVDLRDRYGITQLVI-------GEELNQFNDILKNEFVIEVTGKVIERKKNKDLTTGIEIEVLNIILINKTE 102
301 3.000e-31UniRef50_A0A2D6HF81 Aspartate--tRNA(Asp/Asn) ligase n=3 Tax=cellular organisms TaxID=131567 RepID=A0A2D6HF81_9BACT  ali  25  1.MSAADWRRTHTCGELRSERVGCKVTLNGWVDSRRDHGGIYFVDLRDRYGVTQVVLREEIADSIK--------LGPEYVLSVRGEVAARNRNEGLPTGVELIAERVEVLSTSE 108
302 3.000e-31UniRef50_A0A2V8G3J2 Aspartate--tRNA ligase (Fragment) n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8G3J2_9BACT  ali  28  11........RTHTCGQLTSAAVGQDVVLLGWVHRVRDLGALVFFDIRDRHGLTQIVAREDA----PSLVSDAKHLRPEHVVGVIGRVERRPENPKIKTGVEVVAREIRLLSEAK 115
303 4.000e-31UniRef50_Q46I98 Aspartate--tRNA(Asp/Asn) ligase n=84 Tax=cellular organisms TaxID=131567 RepID=SYDND_PROMT  ali  28  2........RNKTCGELRASAISANVQLCGWVDRRRDHGGVIFIDLRDRSGTIQITVDPDQGQ---DLFSIAESLRNETVLQINGLVRARPINTKIPTGVEVLAKNIKILN... 104
304 4.000e-31UniRef50_UPI000719B5C3 aspartate--tRNA ligase, mitochondrial-like n=1 Tax=Priapulus caudatus TaxID=37621 RepID=UPI000719B5C3  ali  22  53...NSFSYRTHHCSELKLADVGKHVKLCGWVQHQR-MG--LFVTLRDSHGVTQLVIPEDKVSLQQE----LSDLPLESVILVQGAVKPRPENKKIPTGVEVVLSEFQLLNPCR 159
305 4.000e-31UniRef50_A0A1H8I0K8 Aspartate--tRNA(Asp/Asn) ligase n=24 Tax=Bacteroidetes TaxID=976 RepID=A0A1H8I0K8_9BACT  ali  27  2.......YRTHTCGELRLEQAGRQVTLAGWIQTVRKHKTVTFVDLRDRYGVTQLLFGESLVIQLEE-----QPLGREFVIQVTGTVTERSKNPNMPTGIEITVSNFSILNAAK 105
306 4.000e-31UniRef50_Q976I3 Aspartate--tRNA(Asp/Asn) ligase n=35 Tax=Thermoprotei TaxID=183924 RepID=SYDND_SULTO  ali  38  2.......YRSHFIADVTPEYDGKEVIWAGWVHLLRDLGGKKFIILRDKTGLGQVVVDK-----NSSAFGISQELTQESVIQVRGIVKADKRAPR---GIELHAEEITLLSKAK 99
307 4.000e-31UniRef50_A0A0G0TH42 Aspartate-tRNA ligase (Fragment) n=4 Tax=root TaxID=1 RepID=A0A0G0TH42_9BACT  ali  26  9................TLENKGKKVKVSGWVHVRRDHGKIIFIDLRDRSGLLQVVFAPSKIEDGAVVYENAKKLRSEWVVSIEGTVNERPANSQLPTGIELFAEGLEILSESQ 109
308 4.000e-31UniRef50_A0A1F6IGB1 Aspartate--tRNA ligase n=2 Tax=Candidatus Levybacteria TaxID=1752719 RepID=A0A1F6IGB1_9BACT  ali  31  14................TPQLIGKKILLAGWIKTRRDHGKLIFFDLRDRTGLVQLVVNPK---VSGGSYKIAQDLRPEYVIGVIGEVKRRPENKDLHTGVEVEISEINILSRAK 111
309 4.000e-31UniRef50_A0A2D4SSE7 Aspartate--tRNA(Asp/Asn) ligase n=2 Tax=Proteobacteria TaxID=1224 RepID=A0A2D4SSE7_9DELT  ali  30  7........RTHRCGEIRKEHVGQTVTLHGWVHNCRDKSQVIFVVLRDRSGIVQATID---ETCAQELLLKARSLRLEYTVQIQGVVRARDINKDMDTGIEILTSSLQILSTTK 112
310 4.000e-31UniRef50_A0A1U8L0T2 aspartate--tRNA ligase, chloroplastic/mitochondrial-like isoform X3 n=2 Tax=Gossypium hirsutum TaxID=3635 RepID=A0A1U8L0T2_GOSHI  ali  20  71.....WVSRTAYCGDLSNQDVGSRVRLCGWVALHRVHGGLTFFNLRDHTGIVQITSLPGE---FPDAHEAIKDLRLEYVVSVDGFVRSRPVNKKMKTGIEVAAEHVQILNA.. 177
311 4.000e-31UniRef50_UPI000A2C095F aspartate--tRNA ligase, mitochondrial-like n=1 Tax=Parasteatoda tepidariorum TaxID=114398 RepID=UPI000A2C095F  ali  24  24SIVNKWTTRSHTCGELNLNHVGQEVTICGRKTFHRCDK---FVILRDKYGDTQVICQENENLT----KKYLNSLPLESFIEVKGTVLKRPINKKMPTGIEVVASEIKVLNEA. 132
312 4.000e-31UniRef50_A0A0L9THM7 Uncharacterized protein n=2 Tax=Phaseoleae TaxID=163735 RepID=A0A0L9THM7_PHAAN  ali  24  79........RTALCGELSSNDVGKRVQLCGWVALHRVHGGLTFLNLRDHSGIVQVTTLPDE---FPDAHSAINDLRLEYVVAIDGVVRSRPINKKMKTGIEVAARRVQVLN... 181
313 5.000e-31UniRef50_Q7TYA6 Aspartate--tRNA(Asp/Asn) ligase n=330 Tax=Bacteria TaxID=2 RepID=SYDND_MYCBO  ali  23  3........RSHAAGLLREGDAGQQVTLAGWVARRRDHGGVIFIDLRDASGIAQVVF---RDPQDTEVLAQAHRLRAEFCVSVAGVVEIRPENPEIATGIEVNATSLTVLGEC. 107
314 5.000e-31UniRef50_A0A2A5DDZ5 Aspartate--tRNA(Asp/Asn) ligase n=2 Tax=Planctomycetes bacterium TaxID=2026780 RepID=A0A2A5DDZ5_9BACT  ali  30  7.......WRSHACGELRAKDVGTEVVLAGWVANRRDHSVVRFVDLRDRYGIIQLVADED---APEAGMEGLSGLHPEDVLQVRGIVRMRQRNSDRPTGVEVLVHSVEKLSSA. 112
315 5.000e-31UniRef50_A0A194PXJ4 Aspartyl-tRNA synthetase, mitochondrial n=1 Tax=Papilio xuthus TaxID=66420 RepID=A0A194PXJ4_PAPXU  ali  21  472...NSFTYRTHTCGELRPIHNGESVTLCGWVQYQRMSK---FLLLRDSYGVVQCIVNNNQIN--------FNDIPLESIVKINGTVSLRPTNKMSTGEIEVLIDKLEVLNVA. 573
316 5.000e-31UniRef50_B2KBB9 Aspartate--tRNA(Asp/Asn) ligase n=2 Tax=Elusimicrobia TaxID=641853 RepID=SYDND_ELUMP  ali  26  3........RTNYCGDINKNYVNSVQVLCGWVNSYRDHGGVLFLDLRDRTGKVQVVVEPTNKD-----FELASTARTEYVLKVTGLVRLRQINPNNPTGIEVVAQEVEILNTS. 105
317 5.000e-31UniRef50_A0A2N0RR96 Aspartyl-tRNA synthetase n=4 Tax=Rhizophagus irregularis TaxID=588596 RepID=A0A2N0RR96_9GLOM  ali  20  42....TFPSRTHTCGDLRSSHVNQRVVLSGWAQRIRKLSELIFLPIRDSYGTTQLVYRSPSLADYTNLIEKLSQLSTESVICVEGVVIQRSINKNMPTGIEVEIDKLHCLNPA. 156
318 6.000e-31UniRef50_A0A1V0HPT8 Aspartate--tRNA ligase n=1 Tax=Candidatus Riesia sp. GBBU TaxID=1719125 RepID=A0A1V0HPT8_9ENTR  ali  27  9........RTNYCGEIDLSYIGRRVVLCGWVSSYRNINKIIFVNLRDCYGIIQITFS----NIDVNLFKKAKKLRNEYCIQVSGIIKKRKKNRNLLTGVELSVSSLKIINKS. 110
319 6.000e-31UniRef50_A0A2U0MAW5 Aspartate--tRNA ligase (Fragment) n=2 Tax=root TaxID=1 RepID=A0A2U0MAW5_KLEPN  ali  24  2........RTEYCGQLRQSHVGQQVTLCGWVNRRRDLGSLIFIDMRDREGIVQVFFDPDR----ADALKSAPALRNEFCIQVTGTVRAR........................ 78
320 6.000e-31UniRef50_A0A1A8QI03 Aspartyl-tRNA synthetase 2, mitochondrial (Fragment) n=7 Tax=Euteleostomi TaxID=117571 RepID=A0A1A8QI03_9TELE  ali  24  58...SSLSFRSHTCGELRSDHVGQKVTLCGWVQYLR---QDLFVILRDFSGLTQVLIPQEESANN--LKAALRGLAVESVVKVTGTVRKRPENKLMPTGIEILAQNLEVFN... 163
321 6.000e-31UniRef50_A0A2W4S1Z5 Aspartate--tRNA ligase n=1 Tax=bacterium TaxID=1869227 RepID=A0A2W4S1Z5_9BACT  ali  23  10........RSSLAGTLRRTDAGDRVRLAGWVHRRRDLGGLIFIELRDRSGRIQLSFGPDW--TPADALERARRLGAETVIAVEGDVVLRPVNPDLPTGIEVHVHSLEVLAEA. 115
322 7.000e-31UniRef50_D3Q628 Aspartate--tRNA(Asp/Asn) ligase n=1 Tax=Stackebrandtia nassauensis (strain DSM 44728 / NRRL B-16338 / NBRC 102104 / LLR-40K-21) TaxID  ali  27  432.......YRTYNAGEIRATDIEYPVCLAGWVARRRDHGGVEFIDLRDASGVVQVVFR------DGEAAELAKELRDEFCVQVNGVVARRPENPDLPTGIEIVADKLTILSRA. 534
323 8.000e-31UniRef50_A0A194R149 Aspartyl-tRNA synthetase, mitochondrial n=2 Tax=Papilio machaon TaxID=76193 RepID=A0A194R149_PAPMA  ali  23  56...NAFTYRTHTCGELRPMHNGKSVTLCGWVQYQRMSK---FLLLRDSYGVTQCIVNNNQIN--------FNDVPLESIVKINGTVSLRPINSKMSTGIEVVIDKLEVLNVA. 157
324 8.000e-31UniRef50_A0A150GX85 Uncharacterized protein n=2 Tax=Chlorophyta TaxID=3041 RepID=A0A150GX85_GONPE  ali  28  16....TWPSRSHGCGAVVLGDIGQRVTICGWVDRNRDMGGVQFFDVRDHTGLLQVQVICEPQSVPAEVSRAASRLRNEYVVCVTGILRARKDNPRIPTGLELLAESVTILN... 129
325 9.000e-31UniRef50_A0A288DMX0 Aspartate--tRNA ligase n=1 Tax=candidate division SR1 bacterium RAAC1_SR1_1 TaxID=1394709 RepID=A0A288DMX0_9BACT  ali  29  2.......YRTHTCGQLTGKNAGEAIVLSGWVNKVRNLGGMTFIDLRDRYGITQVTYDPSRHTFP------LPDLKSEYVVKISGTVVARPINKDMPTGIEISPTAIEVLSDCK 105
326 1.000e-30UniRef50_A0A2E2UNQ4 Aspartate--tRNA ligase n=1 Tax=Trueperaceae bacterium TaxID=2026798 RepID=A0A2E2UNQ4_9DEIN  ali  25  3........RSHGCGELSEEQVGSTVNLLGWVNSRRDLGGLIFLEIRDSTGMVQVVVEP-----GEKTFDAAEVLRNEYVVEIAGVLRLRPEKQRSTGGVEVVADSVSTLSEAE 106
327 1.000e-30UniRef50_A0A0N8W8K5 Aspartate--tRNA(Asp/Asn) ligase (Fragment) n=2 Tax=Bacteria TaxID=2 RepID=A0A0N8W8K5_9BACT  ali  24  9.......KRTIYAGHVRLNQVNQSVQVMGWVHRRRDLGGLIFIDLRDVTGLIQIVFRPE----NPKAHKKAGVLRNEYVIAVKGKIIPRDINRTLPTGIEIEADELLILNDSE 114
328 1.000e-30UniRef50_A0A1U8HF04 aspartate--tRNA ligase, chloroplastic/mitochondrial-like n=1 Tax=Capsicum annuum TaxID=4072 RepID=A0A1U8HF04_CAPAN  ali  24  66.....WVSRNQYCGELTENDVGKRVRLCGWVALHRIHGGLTFINLRDQTGIVQITTLPDD---FPDAHSTMNGLRLEYVVAIEGVVRPRPVNKKMKTGIEMS-SNIILLNR.. 171
329 1.000e-30UniRef50_A0A1W9RP72 Aspartate--tRNA ligase n=1 Tax=Candidatus Latescibacteria bacterium 4484_7 TaxID=1970771 RepID=A0A1W9RP72_9BACT  ali  33  14......WKRTHHCGELNKNLIGERVVIAGWVKKVRELGFLSFLDLWDKTGLVQLVAERDNGK----LHELFTSLRAEDVVACAGVVRERPINADMATGVEIVAENLIVLNRS. 119
330 1.000e-30UniRef50_P59422 Aspartate--tRNA ligase n=5 Tax=Enterobacterales TaxID=91347 RepID=SYD_BUCBP  ali  22  2........RTNFCGTLNVSHVGKTIKLCGWVNKFRNLKEILFIDIRDQTGIIQVLFSKK----SELLFKKAADLRNEFCIQVLGIVQERTKNKNSTGEIEIFALELKIFNKSQ 106
331 1.000e-30UniRef50_A0A225E9G9 Aspartate--tRNA(Asp/Asn) ligase n=3 Tax=Bacteria TaxID=2 RepID=A0A225E9G9_9BACT  ali  22  99......WQRTLTCGDLRDTHVGQTVTLNGWVLTTRNFNNQIFIDLKDRYGLTQVVFEDD----SAELYATANKLRKEFCVSVRGVVRPRKERADIATGVEVKAEKVEVLNAC. 204
332 1.000e-30UniRef50_UPI00038A5F02 OBody AM1L10 n=5 Tax=Pyrobaculum aerophilum TaxID=13773 RepID=UPI00038A5F02  ali  100  1AMGSVYPKKTHWTAEITPNLHGTEVVVAGWVASLGDYGRVKIVKVSDREGGAAVSVYLEYGKTPDHLFKVFAELSREDVVVIKGIVEASKAAADMHNGVEIFPSEIWILNKAK 113
333 1.000e-30UniRef50_K7GFF0 Aspartyl-tRNA synthetase 2, mitochondrial n=13 Tax=Bilateria TaxID=33213 RepID=K7GFF0_PELSI  ali  22  45...SSFVARTNTCGELRSAHVGQEVALCGWIQYQR-QG--LFLVLRDFQGLIQIIIPQDEAHS--HVKKVLYDAPVESVVRVTGTVISRPENPRMPTGIEVKVKTAEVLNSCK 153
334 1.000e-30UniRef50_A0A1F9DPZ4 Aspartate--tRNA ligase (Fragment) n=2 Tax=Bacteria TaxID=2 RepID=A0A1F9DPZ4_9DELT  ali  22  1....MNWRERIYCGDLKPSHIGTDVLLMGWVDAIRDHGNVLFIHLRDIRGIVQIVFSDK----DKEVYDKAILLREEFVVEVRGRVALREENPNLDTGIEVFADQLKILSRSK 109
335 1.000e-30UniRef50_A0A2A4JII1 Uncharacterized protein n=3 Tax=Noctuidae TaxID=7100 RepID=A0A2A4JII1_HELVI  ali  25  77...NTFTYRTHTCGELRPEHQGKKVTLCGWVQFSRLSK---FLLLRDAYGLTQCIVNNDSVN--------LSNIPLETVVKIEGVVALRPKNQTMATGVEVVIHKLDILN... 176
336 1.000e-30UniRef50_A0A0G1CWP2 Aspartate--tRNA(Asp/Asn) ligase n=3 Tax=Parcubacteria group TaxID=1794811 RepID=A0A0G1CWP2_9BACT  ali  27  3........RSHTCGELTTKHIDQVVELAGWVNSTRDHGGLIFIDLRDRFGLTQCTFNPEKANP---AWKIAETVRPEFVVKIKGTVTARPVNPNLKTG............... 92
337 1.000e-30UniRef50_H3NN86 Aspartate--tRNA ligase n=3 Tax=Firmicutes TaxID=1239 RepID=H3NN86_9FIRM  ali  29  2.......KRTMYNGHLRAQHIGDEVELYGWVQKTRDLGPIVFVDLRDKTGISQIVF---KKEDNEELYNKAKELKIEYVISVKGKVFEREKNAEMLTGVEVIANELTILDKA. 105
338 1.000e-30UniRef50_K1RHA7 Aspartyl-tRNA synthetase, mitochondrial n=4 Tax=Bilateria TaxID=33213 RepID=K1RHA7_CRAGI  ali  31  40...NNFSQRSHSCGEFRPSHSGEEVKICGWVQYKR----LMFLIVRDWSGTVQVLL-------PESMLGVLKDLPFESVVEITGTVHARKINQEMQTGIEIQAKSIKVLN... 139
339 1.000e-30UniRef50_T1J196 Uncharacterized protein n=4 Tax=Arthropoda TaxID=6656 RepID=T1J196_STRMM  ali  23  58..ANSFTYRTHTCGELNLGHEGKKVTICGWLQYQR-MG--LFATLKDTYGIMQLLI-------PPENIEAINLLRVESVLKVSGVVTKRPENPKMATGIEIVVEDITMLNKCK 165
340 2.000e-30UniRef50_A0A2I0MBS3 Aspartyl-tRNA synthetase 2, mitochondrial (Fragment) n=9 Tax=Euteleostomi TaxID=117571 RepID=A0A2I0MBS3_COLLI  ali  22  2...NSFVTRTNTCGELRSAHVGQEVTLYGWIQYQR-QG--LFLVLRDFQGLTQVIIPQDEAHS--HVKQLLSNAPVESVVRVTGIVSPRPENLKMPTGIEVKAETAEILNSCK 110
341 2.000e-30UniRef50_A0A2E6VJS9 Aspartate--tRNA ligase (Fragment) n=2 Tax=Actinobacteria bacterium TaxID=1883427 RepID=A0A2E6VJS9_9ACTN  ali  26  2........RTHRCGDLRNEDIGKEVTLCGWVDRRREHGHLAFIDLRDRSGVIQVVVQG------------AADLRAEYVLQVKGKVRARPVNESLTGGIEVEGLEVTVLASSE 99
342 2.000e-30UniRef50_T1L3G9 Uncharacterized protein n=1 Tax=Tetranychus urticae TaxID=32264 RepID=T1L3G9_TETUR  ali  17  34...NRFTLRQHNCGDLKESDIGKKVTLHGWIKHIRTHGSAVFLVVNDAYGDTQLIF--------KQSHAPISKLPIGSVIKAEGTVTKRPENNKMKTGIEVLVDQFEVINK.. 137
343 2.000e-30UniRef50_V9IE96 Aspartyl-tRNA synthetase n=1 Tax=Apis cerana TaxID=7461 RepID=V9IE96_APICE  ali  22  56...NKFVSRTHTCGELTIQNIGENVHLYGWLEFSRINK---FLILRDSYGSTQLIIPEHK----KDLQEIAKKLTFESVLSIEGKVLKRPENKFMKTGIEVEIKSIKVLNMA. 161
344 2.000e-30UniRef50_UPI000BE1E9F3 aspartate--tRNA ligase, mitochondrial-like isoform X1 n=4 Tax=Varroa TaxID=62624 RepID=UPI000BE1E9F3  ali  19  76...NDFTGRSHTCGQLGASDVGSRVVLCGWVSFKR----LFFLLLRDSYGVTQVVFDKDLHS------NLVKSLGLESVIQVEGVVRRRPESQTSTGEIEVLAEQITVLNNAQ 179
345 2.000e-30UniRef50_A0A2V7PIB8 Asparagine--tRNA ligase (Fragment) n=2 Tax=Gemmatimonadetes bacterium TaxID=2026742 RepID=A0A2V7PIB8_9BACT  ali  32  2......PDR-HWIEEL-PQHAGQTVSVRGWVTTTRSSGKIAFVVVRDGTGLLQAVLSKK--DLPADVWDAFGKLTQETSVEVTGVVRAEPRAP---GGVELQASELRILGPS. 100
346 2.000e-30UniRef50_A0A1W9P4A9 Uncharacterized protein (Fragment) n=1 Tax=Candidatus Aminicenantes bacterium 4484_214 TaxID=1968529 RepID=A0A1W9P4A9_9BACT  ali  24  4......WQRTHYCGHLRAQDEGREVVLCGWVQRQRDLGNLLFIDLRDREGVVQLVFS----SANSPLLEEARRLGLEDCLGVRGKVRRRAPNPRLATG............... 94
347 2.000e-30UniRef50_K3WJ49 Uncharacterized protein n=19 Tax=Oomycetes TaxID=4762 RepID=K3WJ49_PYTUL  ali  21  22AISSAF--RTHTCGDLCADHAGERVRLSGWVDAIRPFGPISFISLRDRHGITQLVLEKNLLESADAV---ISKIRPESVIRVEGVVRARPRNDNLATGIEVVVDDITELN... 132
348 2.000e-30UniRef50_A0A2H0VFI7 Aspartate--tRNA(Asp/Asn) ligase n=42 Tax=cellular organisms TaxID=131567 RepID=A0A2H0VFI7_9BACT  ali  29  9................TLKQTEKEVTIKGWVAVRRDHGKLIFLDIRDVSGLIQVVVNPK---VSKDSHKTAEKLRSEFVVAITGKINKRPENKDLETGVEMIATKIEILSEAK 106
349 3.000e-30UniRef50_A0A2E6W810 Aspartate--tRNA ligase (Fragment) n=1 Tax=Legionellales bacterium TaxID=2026754 RepID=A0A2E6W810_9GAMM  ali  19  3....PNKYRSVYAKDLTKDREGESVDLSGWVHRVRDHGGVIFIDLRDYTGLTQIVCNPDQ----ADVFQAAERCRAEYVIQVHGLLRTRPENKDLASGMELVCDALTILN... 108
350 3.000e-30UniRef50_A8F7R7 Aspartate--tRNA ligase n=28 Tax=Bacteria TaxID=2 RepID=SYD_PSELT  ali  28  3........RTHTCGELTIKDVGKKVILAGWIDRIRDLGGVKFLMLRDRYGQTQIILSQNCQI----------NLRRESVVQIEGVVQKRPENKDLLTGIEVFAEKVNVFSSPE 101
351 3.000e-30UniRef50_A0A0G0FWZ9 Aspartate--tRNA(Asp/Asn) ligase n=482 Tax=root TaxID=1 RepID=A0A0G0FWZ9_9BACT  ali  22  9................TAKHIGERVRIQGWVNTRRAHGKILFIDLRDGSGILQVVFAP----LNKEVYDLAEQLRPEWVVEIVGQIVKRPENPKIETGVEMSAESLKVLAKAE 105
352 3.000e-30UniRef50_H2XL44 Uncharacterized protein n=2 Tax=Ciona intestinalis TaxID=7719 RepID=H2XL44_CIOIN  ali  25  1...SKFSYRSHTCGELRIKNAGEAVSLCGWLEYKRK----DFLVLRDSFGSVQILITGYEDKN-----QTFQNVKPESVVKVTGKVTTRPENPNMITGIEIIPDNIEILNKCK 105
353 3.000e-30UniRef50_A0A177TA90 Uncharacterized protein n=4 Tax=Ustilaginomycotina TaxID=452284 RepID=A0A177TA90_9BASI  ali  24  41AHSGYLPPRSHSCGELSEKHDGEQVRIAGWILARRVSKTLSFHPLRDSTGTVQVVTSTDGESSSNSLGDELASLPTESVIIIDGIVRKRPENPGMQTGIEVELSSFKLLNPAR 167
354 3.000e-30UniRef50_A0A1Y0GYP7 Aspartate--tRNA ligase n=1 Tax=Armatimonadetes bacterium Uphvl-Ar1 TaxID=2004467 RepID=A0A1Y0GYP7_9BACT  ali  27  2....SFSQRTIFCGELRADHVGQTVTINGWAHKVRDLGGLLFVDVRDRTGLAQVIFPENTKA----------EIRSETVLSVTGTVRMRDEASQPTGDVEIAVSSFEILNQS. 103
355 3.000e-30UniRef50_A0A2E9GK53 Aspartate--tRNA(Asp/Asn) ligase n=9 Tax=Bacteria TaxID=2 RepID=A0A2E9GK53_9CHLR  ali  20  12............CGQVNLENVDQVINVAGWVDSWRDHGSLLFLDLRDSTGTIQIVFDK---GVNSDNHEIASSIRNEWVIQVEGIVKKRIEGPNISTGIELNAKKLTILNSSK 113
356 3.000e-30UniRef50_A0A136N2H8 Aspartate--tRNA(Asp/Asn) ligase n=1 Tax=Omnitrophica bacterium OLB16 TaxID=1617433 RepID=A0A136N2H8_9BACT  ali  23  16......PYRTWYAPELPSLPVGSEVRLAGWVHRCRDHGGIIFIDLRDPRGIIQLRITPD---SPGDCHAQASRVHPEWVIQVVGVIQPRPENPNLATGIEIEVTQVFILN... 120
357 3.000e-30UniRef50_A0A1F8SF19 Aspartate--tRNA(Asp/Asn) ligase n=5 Tax=Bacteria TaxID=2 RepID=A0A1F8SF19_9CHLR  ali  26  11......PYRTHTCGELRTDGAGASARLAGWVHRRRDYGKLIFIDLRDRHGITQ---VVVDAADAPDAHDVASRVRSEFVIAVEGVVANRQENPKLATGVELQARDVAILNEAK 118
358 4.000e-30UniRef50_A0A2K3K8Y9 Aspartyl-tRNA synthetase n=1 Tax=Trifolium pratense TaxID=57577 RepID=A0A2K3K8Y9_TRIPR  ali  23  79.....WVTRTHFCGELSSNDVGKKVRICGWVALHRVHGGLTFLNLRDHTGIVQVTTLPDDFPI---AHSAINDVRLEYVVAIEGVVRSRPINKKMKTGF.............. 172
359 4.000e-30UniRef50_A0A1Z9IX40 Aspartate--tRNA ligase (Fragment) n=4 Tax=Proteobacteria TaxID=1224 RepID=A0A1Z9IX40_9PROT  ali  20  1....MNKYRSNHXGELNEKFTXKNVTLSGWIHRKRDHGNLLFIDLRDHFGITQCVI-----ENNNENFSTLEKLKPESVITVLGKVVKREENLEXPTGIEINIQSIKILSHA. 107
360 4.000e-30UniRef50_A0A2H0ALK7 Uncharacterized protein (Fragment) n=4 Tax=root TaxID=1 RepID=A0A2H0ALK7_9BACT  ali  26  10..................DKLNEEIELAGWVDVRRDHGKIIFIDLRDRSGIVQLVFVPKE---NPEVYKLADTLRQEWVIKVKGKVSERPKNDNLKTGLEIQVTELEIITKAK 105
361 4.000e-30UniRef50_A0A0G0QL26 Aspartate--tRNA(Asp/Asn) ligase n=27 Tax=Parcubacteria group TaxID=1794811 RepID=A0A0G0QL26_9BACT  ali  29  7.MKSIFVKET-------KDMVGKEIELLGWVNVRRDHGKIIFVDLRDRSGVIQVVFVP----SNKEVYELAQKLRSEWVIRVKGKVNARPENPDIETGVEFEPTELEVLNES. 110
362 4.000e-30UniRef50_A0A288Q614 Aspartate--tRNA(Asp/Asn) ligase n=3 Tax=Lactobacillales TaxID=186826 RepID=A0A288Q614_9LACT  ali  26  2.......KRTNYAGLIDESYLEQTVTLQGWVQKRRDLGGLIFVDLRDREGIVQLAFSAEFGQ---DALAVAEKMRTEYVIEIEGVVKSRAVNDHLKSGIEVQVKSAQILSEAK 108
363 4.000e-30UniRef50_A0A0N0U498 Aspartate--tRNA ligase, mitochondrial n=3 Tax=Protostomia TaxID=33317 RepID=A0A0N0U498_9HYME  ali  21  11...NKFVSRTHTCGELKIQNIGENVQLCGWLEYSRTKK---FLILRDSYGSTQLIIPEHRI----DLQEMAKNLTFESVLSIEGKVLKRPENKHMETGIEVEVKSLKVLNMAK 117
364 5.000e-30UniRef50_A0A2U0RWT8 Aspartate--tRNA(Asp/Asn) ligase n=1 Tax=Candidatus Bathyarchaeota archaeon TaxID=2026714 RepID=A0A2U0RWT8_9ARCH  ali  41  8......WERSHYSKQLNAEMDSQQAIVMGWVRELRDLGKVKFIKLADREGFVQIIV---KKDMDEEILKKFKELGREDVIAVKGTVKASKMAPN---GVEILPSEIRILNVSE 108
365 5.000e-30UniRef50_V4AAZ6 Uncharacterized protein n=1 Tax=Lottia gigantea TaxID=225164 RepID=V4AAZ6_LOTGI  ali  28  20...SSYSHRTHTCGELGAKHIGQEVTLCGWLQYQRNK---NFYILRDWHGITQAYVEKN---------DIIDKLYFESVIKLKGEVRVRSPNKEMKTGIEVLAKEIEILNPAK 119
366 5.000e-30UniRef50_A0A258HBX6 Aspartate--tRNA(Asp/Asn) ligase n=2 Tax=unclassified Saccharibacteria TaxID=1895827 RepID=A0A258HBX6_9BACT  ali  25  9................TPQSIGQSISVSGWVNARRDHGGLIFIDVRDHTGIVQLVINPEQ----AEAFARAETVRDEYVIQASGTVKEREENPNIPTGVEIVVEQLELLNKSE 105
367 5.000e-30UniRef50_R6SKD9 Aspartate--tRNA(Asp/Asn) ligase n=15 Tax=root TaxID=1 RepID=R6SKD9_9CLOT  ali  22  6.......YRDHYCGKLNNDDIGKTVKVAGFIENIRDHGGVIFVDIRDQYDTLQLVSNDD---------KMFDNLTRESSVSVTGTVRKRAENRIKTGEIELLVDSITVLGRSK 106
368 5.000e-30UniRef50_A0A164XGB2 Putative Aspartyl-tRNA synthetase (Fragment) n=1 Tax=Daphnia magna TaxID=35525 RepID=A0A164XGB2_9CRUS  ali  18  49.HPNSFALRSHTCGELRKSDVGRKVKLSGWVQFQRLNK---FVLLRDAYGVTQLMVPDERL----DLLNKVQDIPLESVISAEGKVSARPPGKQSTGEIEVVVEDFQVLSSS. 156
369 5.000e-30UniRef50_A0A2C9L7I7 Uncharacterized protein n=8 Tax=Bilateria TaxID=33213 RepID=A0A2C9L7I7_BIOGL  ali  22  31...TSFTNRSHLCGELRSHNAGENVTLCGWLQFHRLNG--AFIVLRDWCGSVQLIL-------PKNIIEEYKSLPLESVLEVKGTVSLRPENKKMATGIEVNVSELKLLN... 132
370 5.000e-30UniRef50_A0A1X6QPT3 Aspartate--tRNA ligase n=1 Tax=Entomoplasmatales bacterium EntAcro1 TaxID=1941207 RepID=A0A1X6QPT3_9MOLU  ali  25  3........RTNNCGELTAKDLNQVVILQGWVKKVRKLGGLTFLDLRDRYGYTQVVVEENQA-------ALVKGIKPEYVLEVKGIVKERKKNAEIATGIEVVAQSIKVINPS. 101
371 5.000e-30UniRef50_V6DGK3 Aspartate--tRNA(Asp/Asn) ligase n=15 Tax=Bacteria TaxID=2 RepID=V6DGK3_9DELT  ali  20  5.......ERTTGCGLVDEKFLNKVITLSGWVNKRRDHGNLIFIDLRDRSGIMQIVFNPVQSQNS---HNIAHTLRAEYVISVTGKVVMREVNKELSTGFELQVDSIVILNKSK 111
372 6.000e-30UniRef50_A0A061QKW4 Aspartyl-tRNA synthetase (Fragment) n=1 Tax=Tetraselmis sp. GSL018 TaxID=582737 RepID=A0A061QKW4_9CHLO  ali  25  55....SWPSRTSFCGEIDESAAGRQVTICGWVDGYRNFGGVLFLDIRDHTGLVQVVSQPTE---SAEAYAVAEKLRNEYVTCMRGTVRLRKDNPNIPTGVEVLLEEAQLLNA.. 160
373 6.000e-30UniRef50_A0A1V9X6J7 Aspartate--tRNA ligase n=1 Tax=Tropilaelaps mercedesae TaxID=418985 RepID=A0A1V9X6J7_9ACAR  ali  25  31...NSFSGRTHTCNQLNSDDLGKRVVLCGWVSFKRMF----FLQLRDGYGATQVMVSQDLHK------DLMQTLSLESVIRVEGVVQLRPEGQDLPTGIEVQAERISVLNAA. 133
374 6.000e-30UniRef50_A0A2W4IML0 Aspartate--tRNA ligase n=1 Tax=candidate division SR1 bacterium TaxID=2044938 RepID=A0A2W4IML0_9BACT  ali  31  3........RTHTCGALTAQDLGKSVVIAGWVNKLRNLGGMTFIDLRDRYGITQVTYDP-----SVATFE-LPEIKSEYVLQIHGEVVARPENPDMLTGIELKPTAITVLAACK 105
375 7.000e-30UniRef50_A0A1F6Q897 Aspartate--tRNA ligase n=5 Tax=Terrabacteria group TaxID=1783272 RepID=A0A1F6Q897_9BACT  ali  29  10........KTRWCGKITKNDINQRINIAGWVATVRDLGGIIFAEIRDRTGVIQLVADPGK---NPEIHKILEQLRDEYVIAASGIVTQRPTNPNLGTGIEIYPDKVEILNRAE 115
376 8.000e-30UniRef50_R6XNX8 Aspartate--tRNA ligase n=4 Tax=Firmicutes TaxID=1239 RepID=R6XNX8_9FIRM  ali  23  3........RTKTCGELTEANVGEKVTLCGWVSKVRNLGFLVFVDLRDRYGITQISIDAKEFEKEP--------LKSEYCVQVEGEVILRSPNKNILTGIEIKAEKIKVFSES. 100
377 8.000e-30UniRef50_X1JZ11 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X1JZ11_9ZZZZ  ali  26  2........RNHSCGKLTQAEVGQEVLLCGWVKRNRNLGGITFLDMWDRGGTVQVIFDP---NLDERLHRQAVKLRAEDVIQVGGAVRLRPRNPAMATGVEVLASELKMLA... 104
378 8.000e-30UniRef50_A0A2H0T8T5 Aspartate--tRNA(Asp/Asn) ligase n=162 Tax=root TaxID=1 RepID=A0A2H0T8T5_9BACT  ali  30  11..................NHIGKEVTLYGWVNGRRDHGKIIFIDIRDRSGLAQIVFIPQ----NEDAYKIGDDLRDEYVISISGIVNKRPINPKIPSGVEIEAKSATILSKSK 105
379 9.000e-30UniRef50_W2SJB1 Putative aspartate--tRNA ligase n=1 Tax=Necator americanus TaxID=51031 RepID=W2SJB1_NECAM  ali  23  519...NAFTTRTHNCGELSKKDEGRKVCVMGWLAYKRMN---RFLVLRDSYGTVQAKVNPE-----SELVEIVKNLPYESIVQVEGSVIDREENKNKTGEIEIDVTRLTVLNYA. 622
380 9.000e-30UniRef50_UPI0008F9C4BD aspartate--tRNA ligase, mitochondrial n=1 Tax=Bemisia tabaci TaxID=7038 RepID=UPI0008F9C4BD  ali  27  46...NTYTNRSHTCGELRSSDVGKEVTLYGWLEYQRLDK---FGVLRDGYGSVQFLVPDESKKIGD----ILGKLNLESVIKLRGIVTSRPENKDMGTGIEIIVQDLDVLNVAK 152
381 9.000e-30UniRef50_A0A087ZV42 Uncharacterized protein n=5 Tax=Apis TaxID=7459 RepID=A0A087ZV42_APIME  ali  22  54...NKFVSRTHTCGELTIQNIGENVHLYGWLEFSRINK---FLTLRDSYGSTQLIIPEHK----KDLQEMAKKLTFESVLSIEGKVLKRPENKFMTTGIEVEIKSIKVLNMA. 159
382 1.000e-29UniRef50_A0A2D8WC24 Aspartate--tRNA(Asp/Asn) ligase n=16 Tax=Bacteria TaxID=2 RepID=A0A2D8WC24_9BACT  ali  30  3.............GRIRASHXGSEVTLAGWVHRRRDLGGXLFVDLRDRSGLVQVSFGPDW--TXEASLECARGLGHEDVIQVKGIVVLRPQNPDMGTGIEVHARSVELFSNAQ 104
383 1.000e-29UniRef50_A0A1E5VRL6 Aspartate--tRNA ligase, chloroplastic/mitochondrial (Fragment) n=2 Tax=Mesangiospermae TaxID=1437183 RepID=A0A1E5VRL6_9POAL  ali  24  78.....WPPRDALCGELGAGDAGRRVRLCGWVALRRAHAGLTFLTLRDRSGMVQVTTLPE----YPEVYNIVNKLRVESVVAVEGVVRPRPINADMKTGIEVAADRVLVLN... 182
384 1.000e-29UniRef50_UPI000BAEB35A aspartate--tRNA ligase, mitochondrial-like n=1 Tax=Crassostrea virginica TaxID=6565 RepID=UPI000BAEB35A  ali  28  58...NNFSQRSHSCGEFRHTHIGQEVKICGWVQYKR----LMFLVVRDWSGLVQVLL-------PESMLAVLKELPFESVVEVTGTVQAREVNEEMDTGIEIHAVNIRVLNLCQ 160
385 1.000e-29UniRef50_A0A2A4WV57 Aspartate--tRNA(Asp/Asn) ligase n=1 Tax=Candidatus Dependentiae bacterium TaxID=2030827 RepID=A0A2A4WV57_9BACT  ali  23  6.......ERSMGCGEVKAALVGEKIQLAGWVHRRRDHGGVIFIDLRDRTGLVQLICNPDFTAASS--MDHAHALRSEYVVFIRGSVVKRSINTKLATGIEVYVDELDILATSR 113
386 1.000e-29UniRef50_A0A0G1YWD8 Aspartate--tRNA(Asp/Asn) ligase n=16 Tax=Parcubacteria group TaxID=1794811 RepID=A0A0G1YWD8_9BACT  ali  26  1....MHMERT-----LNKKLVGKTVRIAGWVDTRRDHGKLIFLDVRDRSGIVQAVVTPKA----AEALDTAKRLRAQWVVEIEGEVKARPEGEGPLGGVELAAQKIRVLAEA. 105
387 1.000e-29UniRef50_A0A1G2CMK3 Aspartate--tRNA(Asp/Asn) ligase n=16 Tax=cellular organisms TaxID=131567 RepID=A0A1G2CMK3_9BACT  ali  26  2.......KRT-SVGDI-KNLEGKEVELAGWVHARRDHGKIIFIDLRDRTGLVQIVFTP--------AVAGAVDLRLEYLIRVSGLVKKRPVNDKLPNGYEVEAKTLEIMNASE 101
388 1.000e-29UniRef50_A0A0P6HXL8 Aspartate--tRNA ligase, mitochondrial n=19 Tax=Daphnia magna TaxID=35525 RepID=A0A0P6HXL8_9CRUS  ali  18  28.HANSFALRSHTCGELRKSDVGRKVKLSGWVQFQRLNK---FVLLRDAYGVTQLMVPDERL----DLLNKVQDIPLESVISAEGKVSARPPGKQSTGEIEVVVEDFQVLSSS. 135
389 1.000e-29UniRef50_A0A1Q9NBB4 Aspartate--tRNA ligase n=1 Tax=Candidatus Heimdallarchaeota archaeon LC_3 TaxID=1841598 RepID=A0A1Q9NBB4_9ARCH  ali  23  2....MLKKRSNYAGELRKSHVEQSVTLMGWVFAKRLYKKLAFVDLRDRKGLVQLVFVKKNVDL-----DLINETPLESVIWINGTVVSRKENPDLSGDIEVQVSEYGVINKAE 107
390 1.000e-29UniRef50_C1CV34 Aspartate--tRNA ligase n=9 Tax=Deinococcus TaxID=1298 RepID=SYD_DEIDV  ali  25  2.......KRTALIGQLSTTHLDQAVTLQGWVNRRRDLGGLIFLELRDRSGLVQVQVEPD-----SPAFAQADQLRAEYVAEVEGIYRARPENQRKGGDYEVIASRVKVLNTAK 104
391 2.000e-29UniRef50_A0A0F8ZLB4 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=A0A0F8ZLB4_9ZZZZ  ali  23  1....MLKKRSNYAGELRKSHVEQSVTLMGWVFAKRLYKKLAFVDLRDRKGLVQLVFVKKNVDL-----DLINETPLESVIWINGTVVSRKENPDLSGDIEVQVSEYGVINKAE 106
392 2.000e-29UniRef50_A0A2V9U9B3 Aspartate--tRNA ligase (Fragment) n=2 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V9U9B3_9BACT  ali  26  2............CGALRASDAEKKAVLMGWVNRRRDLGNLIFIDVRDRTGITQVVFHKE---NNPALHQKAGELRNEYVIAAIGAVKLREINKNIGTGIELIAEELRILNEAK 103
393 2.000e-29UniRef50_D1B965 Aspartate--tRNA(Asp/Asn) ligase n=21 Tax=Bacteria TaxID=2 RepID=D1B965_THEAS  ali  24  7.FFSERWKRSVKCGLVDLSMAGSQVVLNGWLRRRRDLGGIIFLELWDHTGAVQVVINPE---VAPEAHDRAKEVRSEYVMAIRGSVQRRPENPDMPTGVEVVAQDILVLSPSK 119
394 2.000e-29UniRef50_A0A2M6W8M3 Uncharacterized protein (Fragment) n=1 Tax=Candidatus Levybacteria bacterium CG10_big_fil_rev_8_21_14_0_10_36_7 TaxID=1974632 Rep  ali  34  6............IKEIIGK-VGEKVKIAGWVDVRRDHGKLIFIDLRDRSGKIQMVVLPNH----KEAHDIAQELRGEWVIEVEGIVNARPENLDIETGVEIEVEEIKILGKAK 105
395 2.000e-29UniRef50_A0A1S4EY33 Uncharacterized protein n=3 Tax=Stegomyia TaxID=53541 RepID=A0A1S4EY33_AEDAE  ali  17  93...NKFTNRTHNCGELRTSHVDQEIVICGWLEFSRLNK---FFTLRDGYGSTQIFIP---DELAAEV--NLNNIPFESILRVEGKVVKRPENPRLPTGVEVVLGNVEVLNKAR 198
396 2.000e-29UniRef50_X1MWJ0 Uncharacterized protein n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X1MWJ0_9ZZZZ  ali  23  8...........YISEL-KDNVGQEVTLCGWLYQSRASGKIQFLIIRDGTGLCQCIL--EKGKVSNELFEQLKHLGQESSLAVTGTIRADER---SVGGFELAVTNAKIISPA. 102
397 2.000e-29UniRef50_A0A224YNF6 Aspartyl-tRNA synthetase n=3 Tax=Ixodidae TaxID=6939 RepID=A0A224YNF6_9ACAR  ali  23  77ALRSMFSWRTHTCGDLRPEHAGQQVTLCGWLAFKRM---DRFLLLRDAYGMTQVLLPEEGAESAKS---QLECLPLESVVQVTGHVVCRPPNPQLSTGVEVVCQQLQPLNEAR 187
398 2.000e-29UniRef50_A0A2E3DYV5 Aspartate--tRNA(Asp/Asn) ligase n=7 Tax=Chloroflexi TaxID=200795 RepID=A0A2E3DYV5_9CHLR  ali  25  10...........NCSDVXLDKEGXTINLAGWVHKRRDHGGLVFIDLRDNSGIVQVVFX---QGISEKSYLDAQTLRPEWVVSIKGKVMPRPENTRIPSGMEVHCSELEVLNESK 112
399 2.000e-29UniRef50_A0A0B7B710 Uncharacterized protein (Fragment) n=4 Tax=Arion vulgaris TaxID=1028688 RepID=A0A0B7B710_9EUPU  ali  21  41....SFTQRSHLCGDLRAHHVGETVVLCGWLQYHRLSG--AFIVLRDWCGLVQLLIPDSKIP-------ECRDLPLESVLEVKGQVILRPENKMMPTGVELLVDDITVLN... 141
400 3.000e-29UniRef50_A0A177VL48 Uncharacterized protein n=13 Tax=Ustilaginomycotina TaxID=452284 RepID=A0A177VL48_9BASI  ali  25  2AHAGYLPPRSHSCGELSEKHDGEQVRIAGWILARRVSKTLSFHPLRDSTGTVQVVTTADDKSPSNSLGDELASLPTESVIIIDGIVRKRPQNPGMQTGVEVELSSFKLLNPAR 128
401 3.000e-29UniRef50_A0A2H8TT04 Aspartate--tRNA ligase, mitochondrial (Fragment) n=3 Tax=Aphidini TaxID=33387 RepID=A0A2H8TT04_9HEMI  ali  17  84...NLYTSRTHTCNQLRTEDCGKSVILCGWVEYIRLN---RFIILRDGYGSTQLIIP---ENASAELYDLVDKIPLESVLMCYGSVKLRPINKNQATGIEVIVDKLQLLNA.. 189
402 3.000e-29UniRef50_UPI0009313BC0 aspartate--tRNA ligase n=3 Tax=Firmicutes TaxID=1239 RepID=UPI0009313BC0  ali  22  8.......KRSDFCGKLRVEDIGRTVTVMGWAQRTRNLGALNFIDLRDFSGLVQLVFNP---NTEKALYEKSKRVRQEYVLAARGVVAQRSENPDLPTGIEILCTELRILDEAK 112
403 3.000e-29UniRef50_A0A1Z8SUK0 Aspartate--tRNA(Asp/Asn) ligase n=2 Tax=Bacteria TaxID=2 RepID=A0A1Z8SUK0_9BACT  ali  23  3........RTHTCGQLRSEYVGQEVTLVGWIDAVRDHGGLKFVDLRDRYGRVQVQISPDSIAGDA-----LATLRFDQVLKVTGEVQSRPRNPKLETGVELIAGSTEIIGEC. 105
404 3.000e-29UniRef50_UPI0008FA8F94 aspartate--tRNA ligase, mitochondrial-like n=1 Tax=Cyprinus carpio TaxID=7962 RepID=UPI0008FA8F94  ali  24  67........RSHTCGELCSSHIDEEVTLCGWVQYLR---QDLFVILRDFSGLVQILIPQDESKS--ELKNAFLDLTVESVIMVKGRVRRRPENKKMSTGIEVCAESMEVLNTCR 170
405 3.000e-29UniRef50_A0A1Z8X208 Aspartate--tRNA(Asp/Asn) ligase n=8 Tax=Terrabacteria group TaxID=1783272 RepID=A0A1Z8X208_9CHLR  ali  19  3........RDLMCGEVSSTVIEKKIKLAGWVSKRRDHGQLIFIDLRDKSGIMQIVFNPE---LSSKVHSLAKXLRSEWVISVEGKVTKRAENPEISTGLELLVDSMEILSRSK 108
406 4.000e-29UniRef50_A0A268U6T6 Aspartate--tRNA(Asp/Asn) ligase n=1 Tax=Helicobacter sp. 13S00477-4 TaxID=1905759 RepID=A0A268U6T6_9HELI  ali  23  3........RTHLCADLNENDIGKQVSLCGWCNTYRDHGGVVFIDLRDKSGLIQLVCDP-----ATPAYNIASNVRDEYVLIAKGKIRARGENPKLKTGIEVVLDELIIENKS. 105
407 4.000e-29UniRef50_A0A258GBV7 Aspartate--tRNA ligase (Fragment) n=1 Tax=Candidatus Saccharibacteria bacterium 32-49-12 TaxID=1970479 RepID=A0A258GBV7_9BACT  ali  29  11.................SSLVEQTVVVSGWVHARRDHGGLIFIDLRDHTGLVQLVINPE----SQQAFSVAEELRDEFVVKATGLVSRRGENPNIASGVEVVVESLEILNRAE 106
408 4.000e-29UniRef50_A0A2I4C351 aspartate--tRNA ligase, mitochondrial isoform X1 n=38 Tax=Neopterygii TaxID=41665 RepID=A0A2I4C351_9TELE  ali  24  58...SSLSFRSHTCGELRPHHVGEKVTLCGWVQYLR---QDLFVILRDFSGLVQVLIPQEESASSLKAV--LSDLTVESVVKVTGTVRKRPENKGMLTGVEVLAENVDVFN... 163
409 4.000e-29UniRef50_A0A2N2GQ56 Aspartate--tRNA ligase n=1 Tax=Deltaproteobacteria bacterium HGW-Deltaproteobacteria-22 TaxID=2013750 RepID=A0A2N2GQ56_9DELT  ali  22  8.......ERTCDCGTLRTGDAGKNVTLMGWVGRRRNLGGAIFVDLRDRGGVTQITFMQDQL---PELHAQAETLRAEDVICIRGQVVSRGDNERMSTGIEVIASELHVISRSE 113
410 4.000e-29UniRef50_A0A0S7Z9I8 Aspartate--tRNA(Asp/Asn) ligase n=3 Tax=root TaxID=1 RepID=A0A0S7Z9I8_9SPIR  ali  28  5...........FCTDINENLAGRKVEMYGWVQIKREHGGVVFVDLRDRSGIVQLVFNENHNV---ECFKAASELRPEFVIRVVGEIRKREPNPNIPTGVEIWVDELTVLNTS. 104
411 4.000e-29UniRef50_A0A1X7L4R6 Aspartate--tRNA(Asp/Asn) ligase n=2 Tax=Bacteria TaxID=2 RepID=A0A1X7L4R6_9BACT  ali  23  4GVFSPSWKRTVMCGLISEGHVGTKITVNGWVRKRRDLGGITFIELWDKSGVIQVVFNPE---VCPEPHERARGLRSEFVIAVTGSIRVRPDNDDMATGWELMVDDFILLSAA. 116
412 5.000e-29UniRef50_A0A226E5F1 Aspartate--tRNA ligase, mitochondrial n=1 Tax=Folsomia candida TaxID=158441 RepID=A0A226E5F1_FOLCA  ali  23  113...SKYTLRSHTCGELKKFHDGRRVNLYGWITYKRLKGK--FLVIRDVYGSTQLIIPAEK----KELVKAADNTPLESVVRIAGVVHMRPQKPDQPTGIEVVVDDYEVLNE.. 218
413 5.000e-29UniRef50_A0A2A3SZX0 Aspartate--tRNA(Asp/Asn) ligase n=9 Tax=Euryarchaeota TaxID=28890 RepID=A0A2A3SZX0_9EURY  ali  29  4.........TRKCGEIEPSDFGSEQTLCGWLQDTRNLGGIAFIQLRDTTGVIQLTLLKKK--LDEEKFKNWTNINRESVVLVRGIV---KENKEAPGGVEMLPDNIELLNEAE 102
414 5.000e-29UniRef50_Q5JHC1 Asparagine--tRNA ligase n=45 Tax=Archaea TaxID=2157 RepID=SYN_THEKO  ali  25  6...........YCADVTPEMEGKKVKLAGWVYRKREVGKKVFIVLRDSSGIVQVVFSKD---LNEEAYREAKKVGIESSVIIEGTVKADPRAP---TGAEVQGEKLQII.... 97
415 6.000e-29UniRef50_A0A0R2R094 Aspartate--tRNA(Asp/Asn) ligase (Fragment) n=5 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A0R2R094_9PROT  ali  24  1....MNKYRSHHCNELRKNNVGQDVILSGWINKKRDHGNLLFIDLRDNYGITQCIIDQENIN-----FKLLERTPLETVVKIEGKVVDRTINKDIETGIEVTINNSEILGTCK 108
416 6.000e-29UniRef50_A0A0G1BZT2 Aspartate--tRNA(Asp/Asn) ligase n=1 Tax=Candidatus Beckwithbacteria bacterium GW2011_GWA2_43_10 TaxID=1618369 RepID=A0A0G1BZT2_9B  ali  31  11..................AQVGKEVELAGWVGARRDHGKLIFIDLKDRSGILQVVFNPQ----NREVLKLADSLRPQDVISIKGVVNNRPEAELASGKVELLAKELEILNKAE 105
417 6.000e-29UniRef50_L8H7B9 Aspartate-tRNA ligase n=1 Tax=Acanthamoeba castellanii str. Neff TaxID=1257118 RepID=L8H7B9_ACACA  ali  30  102........RTHHCGRVTAADAGTSVRLCGWLTASRDFGGVLFLVVKDHTGPVQVLVDEKR--LTPGLREQVASWRIESVVTVTGKVQLRPQNKDMPTGIEIVCEDIALLNP.. 206
418 6.000e-29UniRef50_A0A257A596 Aspartate--tRNA(Asp) ligase n=2 Tax=Euryarchaeota TaxID=28890 RepID=A0A257A596_9EURY  ali  35  3........RTHTTKEAS-KLDGEEVTVCGWIHEIRVLGKIAFIILRDRYGFAQLTLI--RGIIGKDKFKEYTKLSRESVICARGKVQHTEQAKL---GFEILPEEIKVLSLAQ 101
419 6.000e-29UniRef50_A0A0L8G6X6 Uncharacterized protein n=10 Tax=Bilateria TaxID=33213 RepID=A0A0L8G6X6_OCTBM  ali  23  35.MVSSYRSRSHSCGELSLDDVGKVVVLCGWLQYKRL---DQFLLLRDWQGITQVLIPTEKQDI---LHPLLSNLPLESVIQVQGTVIKRPENDKMQTGIEVKLSDFHVLNSCR 145
420 6.000e-29UniRef50_A0A2E8QTB6 Aspartate--tRNA(Asp/Asn) ligase n=27 Tax=Gemmatimonadetes TaxID=219685 RepID=A0A2E8QTB6_9BACT  ali  27  12........RSRMVGGLRVEHEGEDLVLAGWVHRRRDLGGLLFIDLRDRSGLVQVSFGPEW--TDAISWELAHSIGHEDVIRVKGLVVSRPDGSQMPTGVELQVQKLEILSKAR 118
421 6.000e-29UniRef50_A0A2G9Y565 Aspartate--tRNA ligase (Fragment) n=1 Tax=bacterium (Candidatus Stahlbacteria) CG23_combo_of_CG06-09_8_20_14_all_34_7 TaxID=20142  ali  21  7........RSCLCSEPDSKYEGKELTLCGWVNKKRDHGNLIFIDLRDRSGIIQLF------PKDDNTAKIMKSLRSEDVIQVKGIIKCRPENDMKTGEIEMECHFAEVLSRS. 108
422 6.000e-29UniRef50_A0A1F6EDR7 Aspartate--tRNA(Asp/Asn) ligase n=22 Tax=unclassified Bacteria TaxID=2323 RepID=A0A1F6EDR7_9BACT  ali  26  5...........YIENL-QKHVGKEAIIAGWVDVRRDHGKLIFIDLRDRTGKVQCVIVPSALK----AYEAGKDLRSEWVVQMTGVVQERPRNDKEPNGIELAVSEIEVLSRA. 104
423 6.000e-29UniRef50_X1MWW4 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X1MWW4_9ZZZZ  ali  26  8...........YISEL-KNNVGQEVTLAGWLYQSRSSGKIQFLIIRDGTGLCQCIL--EKGKVSNELFEQLKHLGQESSLTVTGTVRADER---SVGGYELAITNAQIISPA. 102
424 7.000e-29UniRef50_B2GBY7 Aspartate--tRNA ligase n=108 Tax=Bacteria TaxID=2 RepID=SYD_LACF3  ali  28  2.......KRTNYAGRTSEEQIGQEVVVKGWVAKRRNLGGLIFIDLWDREGIVQLVFNEEEDQ---AAFEVANQARNQYILEARGLVRAREVNPDIATGIEIEVKEAKILAKSQ 106
425 7.000e-29UniRef50_A0A024GCV3 Uncharacterized protein n=1 Tax=Albugo candida TaxID=65357 RepID=A0A024GCV3_9STRA  ali  18  332.HSTKFSYRTRTCGELRNQHLNQYVRLCGWVHGIRELGSITFLSLRDRYGITQLVVDKDSTAAHA-----ASNLRLESIVRVAGSVRQRPKNSSMSTGIEVIVESIE...... 439
426 7.000e-29UniRef50_A0A2T9XZH2 Uncharacterized protein n=1 Tax=Smittium megazygosporum TaxID=133381 RepID=A0A2T9XZH2_9FUNG  ali  24  63.FFNKYSTRSHSIDQVDNKLSGKTVVLCGWAERIRVSSSLGFIVLRDRYGSVQIVFNKKDLPLESDIFEKLASLNQESVIQIKGTVRVLENNAPSPSSVEINAQELTVLNSS. 181
427 8.000e-29UniRef50_A0A1F2XPJ3 Aspartate--tRNA(Asp/Asn) ligase n=1 Tax=Actinobacteria bacterium RBG_16_68_12 TaxID=1797203 RepID=A0A1F2XPJ3_9ACTN  ali  24  2............CGEPRTEHVGKTLALAGWAARRRDHGGLVFVDLRDRTGLMQLVINPER---SPAAAELAKEIRNEFVLQATGEVVARSVNPKMETGGELHVDELTIVSRS. 102
428 8.000e-29UniRef50_W4XNT8 Uncharacterized protein n=1 Tax=Strongylocentrotus purpuratus TaxID=7668 RepID=W4XNT8_STRPU  ali  18  33......TERSHNCSELRCDHVGEKVTLCGWLQHRRF--DFMF-TLRDSFGTVQIVI-PKEELGGKELVDTLTAAYQESVIQVKGHVQLRPKNKEMGTGIEVVADSVELLNPCK 139
429 9.000e-29UniRef50_Q55C99 Aspartate--tRNA ligase, mitochondrial n=3 Tax=Dictyostelids TaxID=33083 RepID=SYDM_DICDI  ali  28  76........RSHSCGEITSKDIGKEVIIYGWINSLRNLGDNVFLVIRDGHGKVQCYVDLKQQCILKSSVENIKLFKLESIVSIKGKVIARPENKNMSTGIEISVDQLQLLN... 193
430 9.000e-29UniRef50_A0A2E9A0L8 Aspartate--tRNA(Asp/Asn) ligase n=4 Tax=Gammaproteobacteria bacterium TaxID=1913989 RepID=A0A2E9A0L8_9GAMM  ali  22  8.............KDISEKDIDKTVTLSGWVNKRRDHGGIIFVDLRDXTGIVQIVFNPD----NKDIFKDAEILRSEFVISVTGTITARSINEDISSGIEVVANHLTXLNNSE 107
431 9.000e-29UniRef50_A3PFH7 Aspartate--tRNA(Asp/Asn) ligase n=35 Tax=Prochlorococcus TaxID=1218 RepID=SYDND_PROM0  ali  23  2........RNKICKELNNTDIGKLVNLCGWVDRRRDHGGVIFIDLRDHSGFLQITINPDD---GAALFKQAETLRNETVIMVSGIINERPKNTNLSTGLELKVKDLQILN... 104
432 1.000e-28UniRef50_A0A2E6WL76 Aspartate--tRNA(Asp/Asn) ligase n=24 Tax=Bacteria TaxID=2 RepID=A0A2E6WL76_9CHLR  ali  28  7............CGEIGIDQEKNEIIIAGWVDSWRDHGSLLFIDLRDSTGTVQVVFDKSKSNSN---HQIASSFRTEWVVQIKGMVEKRAENPNISTGIEIHATEINVLNESK 108
433 1.000e-28UniRef50_B3DX01 Aspartate--tRNA(Asp/Asn) ligase n=31 Tax=Bacteria TaxID=2 RepID=SYDND_METI4  ali  29  9.......YRTHHCNELNLALVGHKAKLCGWVHSKRDHGGLLFIDLRDREGITQVVFHPEKD---PPLFAKAKQLKNEFVVKVEGKVVERPKNASIPTGIELEAESLEILNPSQ 115
434 1.000e-28UniRef50_A0A2D4WSS4 Aspartate--tRNA ligase (Fragment) n=1 Tax=Planctomycetaceae bacterium TaxID=2026779 RepID=A0A2D4WSS4_9PLAN  ali  30  2............CGALRSEHEGQEVVVCGWVNTYRDHSGLVFIDLRDREGLVQVVFDGDDAQ--KDVLEIGRSLRREDVAGIKGVVRARAANPKLASGIEILVTEAEVLAKTE 104
435 1.000e-28UniRef50_A0A0L7KUU8 Putative aspartyl-tRNA synthetase n=6 Tax=Ditrysia TaxID=37567 RepID=A0A0L7KUU8_9NEOP  ali  25  94...NSYTCRTHSCGELRPENKGQKVILCGWVQFSRLSK---FLLLRDAYGLIQCVVH--ENNVS------FSDILLETVVKIEGKVTLRPKNHSMATGVEVVIEKLEVLNNVE 196
436 1.000e-28UniRef50_A0A183VSH3 Uncharacterized protein n=1 Tax=Trichobilharzia regenti TaxID=157069 RepID=A0A183VSH3_TRIRE  ali  24  41..SSAFVYRSHNCGELGVNHVDTFVSLCGWVDSTRLSSR--FLVLRDDCGLVQIYCDTKTLSMP--------RITLESVVKVTGKVKARPKNKLMSTGIEVIAESVEVLNES. 144
437 1.000e-28UniRef50_A0A061SFN3 Aspartyl-tRNA synthetase n=1 Tax=Tetraselmis sp. GSL018 TaxID=582737 RepID=A0A061SFN3_9CHLO  ali  25  97....SWPSRTSFCGEIDESAAGRQVTICGWVDGYRNFGGVLFLDIRDHTGLVQVVSQPTE---SAEAYAVAEKLRNEYVTCMRGTVRLRKDNPNIPTGVEVLLEEAQLLNA.. 202
438 1.000e-28UniRef50_A0A0G1KLV8 Aspartyl-tRNA synthetase, non-discriminating n=1 Tax=Candidatus Collierbacteria bacterium GW2011_GWA2_44_99 TaxID=1618380 RepID=A  ali  27  5...........YIKEI-KNKIGEEVKLAGWVDVRRDHGKLIFIDLRDMSGKAQMVALPNH----KEAHDNASKLRSEWVVEIIGKVNKRPENKNEEGEVEVEITEVKILSEAE 105
439 2.000e-28UniRef50_A0A1G3QVS2 Aspartate--tRNA ligase n=11 Tax=Bacteria TaxID=2 RepID=A0A1G3QVS2_9SPIR  ali  23  1....MFKNRS-YCGELTTQDIDRHVMLAGWAEGVRNLGGIVFIEVRDVSGTLQVVVDSSK---SPELIPAAEETRSEFVLKITGIVRKRDENPGLPTGIEVYADSIEILNRSE 109
440 2.000e-28UniRef50_A0A257Y5I8 Aspartate--tRNA ligase (Fragment) n=2 Tax=unclassified Saccharibacteria TaxID=1895827 RepID=A0A257Y5I8_9BACT  ali  27  13....................VGQSVSVAGWVHARRDHGGVIFIDLRDHAGLVQLVINPEQTT----AFATAESVRDEFVMSATGVVRERGENPNIDSGIEIVVEGLTILNRA. 104
441 2.000e-28UniRef50_U3Q4D0 Aspartate--tRNA ligase n=16 Tax=Bacteria TaxID=2 RepID=U3Q4D0_9FLAO  ali  27  3.......YRTHNCGELSQKDIGKEVILSGWIKKIRNFGSLFFIDIRDYFGITQLVIYKK-------LVKKNLFLSKESIIRVKGKVVERSKNYNIYTGIEIYVSHINLLNSS. 102
442 2.000e-28UniRef50_A0A1Q7MID6 Aspartate--tRNA(Asp) ligase n=11 Tax=Archaea TaxID=2157 RepID=A0A1Q7MID6_9CREN  ali  30  2....SHLKRTALTSEL-KEHIDKVVVLAGWVHDVRVLGGISFILLRDMSGIVQV--TAPKAKVSPDIVKEIGILHQEDVILVKGKVVSSKIAKK---GIEVIPEQLEVVNRAE 104
443 2.000e-28UniRef50_UPI0002659A1B aspartate--tRNA ligase, mitochondrial n=1 Tax=Galendromus occidentalis TaxID=34638 RepID=UPI0002659A1B  ali  25  28..QNKFSERTHACDEVTVEHIGARVTLCGWLLYKRMQ----FALLRDGFGVTQVVLN-------ESLYRVIENAPTESILRVEGIVVRRPDGEDLPTGVEVVADEITVLNLCK 131
444 2.000e-28UniRef50_P56459 Aspartate--tRNA(Asp/Asn) ligase n=874 Tax=root TaxID=1 RepID=SYDND_HELPY  ali  27  2........RSHFCTEISEKDVGKIVKVAGWCNTYRDHGGVVFIDLRDKSGLVQLVCDP-----SSKAYEKALEVRSEFVLVAKGKVRLRGENPKLKTGIEIVLEELIIENKS. 104
445 2.000e-28UniRef50_A0A1D1W7P4 Uncharacterized protein n=4 Tax=Bilateria TaxID=33213 RepID=A0A1D1W7P4_RAMVA  ali  21  31SYTDPF--RSHLCGKLSREHVGQHVSVCGWLHKKRM--GQQFWLLRDWSGLLQILINEQRQ---EQWLDMLQKASLESVVAVRGLVQPRPENSDMPTGIELHAAEIKLLNPA. 139
446 2.000e-28UniRef50_A0A0S7Y676 Aspartate--tRNA ligase n=4 Tax=root TaxID=1 RepID=A0A0S7Y676_9BACT  ali  23  12......WQRTSYCGELRLEHVDQQVTLFGWIQKLRDIGNLVFIDLRDREGLVQVVFT----SGDRELLEEAKRIKLESVVGIKGVVKKRDVNPQLPT................ 101
447 2.000e-28UniRef50_A0A2V7WCX0 Uncharacterized protein n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V7WCX0_9BACT  ali  28  18........RT-FAGTLRKDHVGQSVTLAGWVQKQRDFGDLVFIDLRDRSGVCQIVVDRKRGA-DDRLLSTAKELRSEYVVRIAGEVIERARNPKIPTGVELLARQIELYNAA. 123
448 2.000e-28UniRef50_A0A2J6N7Z9 Aspartate--tRNA(Asp/Asn) ligase n=2 Tax=Archaea TaxID=2157 RepID=A0A2J6N7Z9_9ARCH  ali  29  2.......KRTHLASEITPELDGSQVTLLGWLHEKRDLGGLRFLVIRDRSGLVQTI--AAKKEVSRELWDEISSFKRESVLAVKGIAKASPQAP---GGAEVRIREVTLISPSE 102
449 3.000e-28UniRef50_A0A0G1CN81 Aspartate--tRNA(Asp/Asn) ligase n=13 Tax=Microgenomates group TaxID=1794810 RepID=A0A0G1CN81_9BACT  ali  33  8................TGKKIGTEVTLCGWVNTRRDHGRIVFIDLRDRSGLVQMVLTKD----------LAQGLGVEDVLEIRGLVKLRPENPKLTTGVEIEVKTVKILNKA. 97
450 3.000e-28UniRef50_A0A2K2V3W9 Asparagine--tRNA ligase n=1 Tax=Candidatus Korarchaeota archaeon TaxID=2056630 RepID=A0A2K2V3W9_9ARCH  ali  28  9........RSHYVDEITEKLAGSEVKLAGWVRKKMELGGLTFVMLRDSTGVIQVVFREDK--IGKEKMKEARKLSMESSIIVSGRVKLDKRAPN---GLEIEAEDLKVVGYAE 108
451 3.000e-28UniRef50_UPI0005564268 aspartate--tRNA ligase n=1 Tax=Acholeplasma hippikon TaxID=264636 RepID=UPI0005564268  ali  24  1....MFKY-THNNNELTLKNLGEKVALKGWVNKKRNLGGLIFIDLRDKFGITQLLVKPE-----SSFYQIASEIKSEYVIEVEGVVIEREKNKNILTGIEVEVSNLVIINTA. 104
452 3.000e-28UniRef50_A0A1Z9H181 Aspartate--tRNA(Asp/Asn) ligase n=42 Tax=Bacteria TaxID=2 RepID=A0A1Z9H181_9BACT  ali  30  4........RTHTCGQLTSKENNLNVVLNGWVNSIRLHGQIIFIDLRDRYGKTQLVFDSKTFLGD---FENVKKLSLEDVLSIQGIVSLRAINKDIITGIEILISNILLFNEAK 109
453 3.000e-28UniRef50_A0A146L606 Aspartate--tRNA ligase, mitochondrial n=8 Tax=Panheteroptera TaxID=33351 RepID=A0A146L606_LYGHE  ali  18  37...NLHSTRSHTCGELCERDVGRKITLCGWLQYVRMDS---FATLRDAYGSTQILAKNHK--------ELLSKTPLESVLMVEGEVRKRPENQKMKTGVEVVAENITVLNAA. 138
454 3.000e-28UniRef50_A0A117L5N6 Asparaginyl-tRNA synthetase (Fragment) n=1 Tax=Thermococcus sp. 40_45 TaxID=1641381 RepID=A0A117L5N6_9EURY  ali  25  7...........YCADVKPKMEGERVRLAGWVYRKREVGNKVFIVLRDSSGIIQTVFTKE---LNEEAYTKAKQVGIESSVIIEGTVKEDSRAP---TGVEVQADKIEII.... 98
455 3.000e-28UniRef50_U4KNI5 Aspartate--tRNA ligase n=3 Tax=Acholeplasma TaxID=2147 RepID=U4KNI5_9MOLU  ali  28  2.......KYTHHNNELNRSHLGMSVYLKGWVAKTRNLGGLIFIDLRDKNGITQLVVLPENSN-----YDTATRLKSEYVIEAKGKVIERQKNKNISTGIEIEVTELIILNEAE 104
456 3.000e-28UniRef50_P81432 Aspartate--tRNA ligase n=3 Tax=Buchnera aphidicola TaxID=9 RepID=SYD_BUCAP  ali  20  2........RTKYCGNIRIIDLHKSVILCGWVHKIRNFSQFIFIDMRDWTGIVQLVFEKKNNKV----FTKAVNLKNESCIQVIGIVKKRNANNNDTGEIEILVNKIKVFNISK 104
457 3.000e-28UniRef50_A0A016VNU2 Uncharacterized protein n=14 Tax=Chromadorea TaxID=119089 RepID=A0A016VNU2_9BILA  ali  25  19.....YTTRTHNCGELSKKDEGAKVCVMGWLAYKRMN---RFLVLRDAYGSVQATVAPDSNYA-----KIVKDLPYESVVQVEGSVIDRGENKNLTGEIEIDVSKLTVLNYA. 120
458 4.000e-28UniRef50_A0A2G6C1J5 Aspartate--tRNA ligase (Fragment) n=2 Tax=Bacteria TaxID=2 RepID=A0A2G6C1J5_9BACT  ali  28  2.......ERTM--AAATPQSKNERVTVCGWVQSRRDHGGLIFIDVRDHSGLVQLVFHPDQ----AEVFATAETLRDEFVVRARGVVAERGENPNIDSGIEIVVDELTILNRAE 106
459 4.000e-28UniRef50_A0A2T9YBD8 Uncharacterized protein n=3 Tax=Smittium TaxID=4888 RepID=A0A2T9YBD8_9FUNG  ali  24  132.FFNKYSTRSHSIDQVDNKLSGKTVVLCGWAERIRVSSSLGFIVLRDRYGSVQIVFNKKDLPLESDIFEKLASLNQESVIQIKGTVRVLENNAPSPSSVEINAQELTVLNSS. 250
460 4.000e-28UniRef50_A0A068S750 Aspartyl-trna synthetase n=1 Tax=Lichtheimia corymbifera JMRC:FSU:9682 TaxID=1263082 RepID=A0A068S750_9FUNG  ali  22  63....SYPQRTIKCGHLGAKNEGERVVLTGWVQTPRAMSQLIFIPIRDATGTTQLVFR----SGDSQLRADIQKLTTESVICAEGIVRKRPENKHQSTGIEVELDKIYCLNPA. 171
461 4.000e-28UniRef50_C7IVK1 Nucleic acid binding OB-fold tRNA/helicase-type n=2 Tax=root TaxID=1 RepID=C7IVK1_THEET  ali  29  9.......KRTHMCGELTVEDVDKYVVVMGWVQRRRDHGGLVFIDLRDRTGIVQVVFS---NEVSSEAFEKVQSVRSEYVLAIEGKVVK......................... 86
462 4.000e-28UniRef50_X1AT40 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X1AT40_9ZZZZ  ali  31  17........RTHFSNQITSELDGKEVILMGWTHILRDKGKIKFLVLRDEHGTVQVTIPQKK--VSEEVFETSGKLKPETAISVHGTVVAT---TQVAAGAEVIPTKIRILNTAE 116
463 4.000e-28UniRef50_A0A2M7Z4Q5 Aspartate--tRNA ligase (Fragment) n=1 Tax=Candidatus Nealsonbacteria bacterium CG_4_9_14_3_um_filter_37_13 TaxID=1974695 RepID=A0  ali  26  9................TLKHLGEKVKVCGWVQTIRSHGKILFIDLRDRSGILQIVFTPE----NKELYKKAKDLRPEWVVGIDGEIKERPRNPKIATGIELLPK......... 96
464 6.000e-28UniRef50_A0A2E7UXG3 Aspartate--tRNA ligase (Fragment) n=1 Tax=Deltaproteobacteria bacterium TaxID=2026735 RepID=A0A2E7UXG3_9DELT  ali  28  6.......PRTHNCGELRLHHVGQSVVLQGWANFVREKGGVMFLVLRDRFGVVQITVD---ERASESVWSVGRTVRLEYVVQVEGTVAQRQANADMSTGVEVLPAKVTVLS... 109
465 6.000e-28UniRef50_A0A135VR62 Aspartate--tRNA ligase n=2 Tax=Candidatus Thorarchaeota TaxID=1706441 RepID=A0A135VR62_9ARCH  ali  35  17........RTHFSNQITAEIAGTDVVLMGWVHILRDKGKLKFLVLRDERGTVQVTIPQKR--VPEEVFKTSGLLKPETAVSVTGKVTA---AKQVASGAEVIPRKIRILNTSE 116
466 7.000e-28UniRef50_A0A2M6YCC8 Aspartate--tRNA ligase (Fragment) n=4 Tax=Bacteria candidate phyla TaxID=1783234 RepID=A0A2M6YCC8_9BACT  ali  28  9................TVDKVGQEVLVSGWVNTRRDHGKIVFIDLRDMSGLLQVIFVP-----GSKAYEKIADVRPEWVISISGKINSRPENKLPTGGVEMEAVDIEILNPAK 104
467 7.000e-28UniRef50_A0A1J5IIG3 Aspartate--tRNA(Asp/Asn) ligase n=1 Tax=Candidatus Wirthbacteria bacterium CG2_30_54_11 TaxID=1817892 RepID=A0A1J5IIG3_9BACT  ali  26  11................TVNQIDQPVLLKGWVWNRRDHGKLIFIDLRDRSGEVQIVFNP--AQVSEEAFAIAKTLRAQDVITVTGKVLKRPENARIPTGVEVEAVEVKILSHA. 108
468 7.000e-28UniRef50_A0A1F2RJY0 Aspartate--tRNA ligase n=3 Tax=unclassified Acidobacteria (miscellaneous) TaxID=305072 RepID=A0A1F2RJY0_9BACT  ali  30  11.......RRTRGCGEFRPEHAGSRAVVMGWVARRRDLGSLIFLDVRDRSGILQVVFNRE---TVPEAHGRAGELRSEYVVAMEGEIVGRDPNPAIPTGVELRAARLYILNDAR 117
469 7.000e-28UniRef50_A0A2V8QDS7 Aspartate--tRNA ligase (Fragment) n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8QDS7_9BACT  ali  22  9.......ERTHSCGQLRTSDIGKQVTLMGWVAKRRDFGELTFIDLRDRDGLTQVVFNS---QDSPASHSKAKDVRGEYVIAVTGEVINR........................ 87
470 7.000e-28UniRef50_A0A2J7QBJ3 Aspartate--tRNA ligase, mitochondrial n=1 Tax=Cryptotermes secundus TaxID=105785 RepID=A0A2J7QBJ3_9NEOP  ali  22  45SVTSRFARRTHTCGDLNEDTIGQEVHLCGWVELKR-LGR--FLTLRDGYGAAQLVAPNNRPDIS----QQIGNIQLDTVVTVKGLVCARPRNVRMPTGIEVSVTELEVVNPSE 154
471 9.000e-28UniRef50_A0A1Y1WCE6 Aspartyl-tRNA synthetase n=2 Tax=Kickxellaceae TaxID=4862 RepID=A0A1Y1WCE6_9FUNG  ali  17  36........RTHTCGDLTASHIDQQVKLCGWAQNIRVLSDLVFVQLRDAYGSIQLLAEQSKVGDFEKQKRVLEQLNPDTLIGVQGTIVRRPEAQDGAGEIELLVDNIEVLN... 141
472 9.000e-28UniRef50_UPI0006C98816 aspartate--tRNA ligase, mitochondrial isoform X2 n=1 Tax=Copidosoma floridanum TaxID=29053 RepID=UPI0006C98816  ali  21  65...NKFVCRSHTCGELGVLNVGQKVKVCGWLEFQR-MGK--FFVLRDAYGSLQCLIPEQREDLS----NILKNLSYESVLGVIGVVVSRPKNLKMKTGIEVLTEAVDILNLA. 170
473 1.000e-27UniRef50_A0A2E0BFU7 Aspartate--tRNA(Asp/Asn) ligase n=3 Tax=Bacteria TaxID=2 RepID=A0A2E0BFU7_9BACT  ali  20  1.MKTSF--RNDYCATFNETHEGNSITISGWCSSIRDHGGVIFIDLRDKSGIIQIVSDP---NNSPAVHKIIESVRNEYVIQISGLVRLRSENKNLRTGIEILIDSVQILNSS. 110
474 1.000e-27UniRef50_A0A024URU3 Aspartate-tRNA ligase n=1 Tax=Aphanomyces invadans TaxID=157072 RepID=A0A024URU3_9STRA  ali  22  30...STHAFRSHTCGELRDVDVGKTIKLSGWVDAVRSFGPMTFVSLRDRHGTTQLVFGKDNHVAS------ANLLKPETVIRVTGQVRGRPINANMDTGVEVVVDSVDTLN... 134
475 1.000e-27UniRef50_A0A0C7DUM7 Aspartate--tRNA(Asp/Asn) ligase n=2 Tax=Candidatus Portiera aleyrodidarum TaxID=91844 RepID=A0A0C7DUM7_9GAMM  ali  19  2........RSNYCGNLNKKLVNNYVILYGWVDKIRDHGGILFIDLRDMYGIIQIVIDSKKIDL--KTFLIAKKIKYEFILKVIGLIKLRPLNKQLTNLIEIFIIDLKILNQSK 107
476 1.000e-27UniRef50_D4G8A6 Aspartate--tRNA ligase n=4 Tax=Candidatus Riesia TaxID=401618 RepID=D4G8A6_RIEPU  ali  22  3........RTHYCGEVNFFHIGTRVIISGWIHSIRRLKNLTFLDIRDRTGIIQAVCSKK---LFPSIFLQSLKLNQEFCIRISGKVREKRKKISLQKNIEVLVHSINILNNSK 107
477 1.000e-27UniRef50_A0A1F7U0E0 Uncharacterized protein n=8 Tax=Patescibacteria group TaxID=1783273 RepID=A0A1F7U0E0_9BACT  ali  29  13...................KVGEEIEICGWVHARRNMGKVAFLDIRDRSGIVQVVVVPKEDEVSKSL---IEGIRPEFVLQIRGTVQARQINANMKTGVEVLATSIVILNRSE 108
478 1.000e-27UniRef50_T0XVP0 Aspartyl-tRNA synthetase (Fragment) n=1 Tax=Leptospirillum sp. Group IV `UBA BS` TaxID=1260983 RepID=T0XVP0_9BACT  ali  25  2.......YRSHFVADLYAFGPGTVVTVAGWVHTVRDHGGLLFIELRDRSGRMQCVIDAKENPVMESM---AKTLRDEWVISVHGTLSARPENHEMAGGHEIRVS......... 99
479 1.000e-27UniRef50_K2BZ85 Aspartyl-tRNA synthetase (Fragment) n=3 Tax=root TaxID=1 RepID=K2BZ85_9ZZZZ  ali  31  2.......KRS-WIKD-TVGQIGQEVLLQGWVHRRRNMGKMVFIDLRDQSGVCQVVFLTNH----AEALATAGGLSHEDVVSIKGKVNARPKADQVCGSVEIEALDLTILSKA. 104
480 1.000e-27UniRef50_A0A0N4T6E7 Uncharacterized protein n=1 Tax=Brugia pahangi TaxID=6280 RepID=A0A0N4T6E7_BRUPA  ali  17  24...NDFTLRTHTCGELRVGHENQKVTLYGWLQFNRLN---RFLVLRDAYGCVQARIPEKR----KDLIEKIKMINCESVLKIEGVVADRGENENMRTGIEVLVDDLKLLNTS. 129
481 2.000e-27UniRef50_A0A0D0A8P8 Unplaced genomic scaffold scaffold_2, whole genome shotgun sequence n=15 Tax=Agaricomycetes TaxID=155619 RepID=A0A0D0A8P8_9HOMO :  ali  24  34....PFPPRTHTCGELTADHAGVRVVLAGWLLPERKVSKMSFFPIKDSHGTTQLVVRRKRDSCAGDL-AALSDIPVESTVLIEGEVRVRPQSSDGTGDIEVDVSDFVLLNPA. 144
482 2.000e-27UniRef50_H5VAD7 Aspartyl-tRNA synthetase n=3 Tax=Helicobacter TaxID=209 RepID=H5VAD7_HELBI  ali  21  3........RTQLCAEVGVEHIQKKVELCGWCNNYRDHGGVIFIDLRDKSGLVQLVCDP-----SSPAYEQASLVRHEDVLVIRGVVRPRGENPKLKTGIEVVLESLQLENK.. 104
483 2.000e-27UniRef50_A0A1F9MF81 Aspartate--tRNA ligase n=2 Tax=Proteobacteria TaxID=1224 RepID=A0A1F9MF81_9DELT  ali  25  2.......RRTHTCHDLRSLHCDQEVTLCGWVARVRKLGGLVFVQLRDRYGLTQLVHQVLE---GSDLSERVLALHKEDCIEIVGKVKARGEKSDLPTGIEVELEALDVLN... 105
484 2.000e-27UniRef50_A0A1G1I8Q4 Uncharacterized protein n=1 Tax=Nitrospirae bacterium RIFCSPHIGHO2_02_FULL_40_19 TaxID=1801713 RepID=A0A1G1I8Q4_9BACT  ali  23  5............CGEIRASDIGSTITIHGWTNRRRDHGGLIFIDLRDRSGVVQVVFNPE---INAEVHKTAHEIRNEYVLEAKGEVRKRPENPLIATG............... 90
485 2.000e-27UniRef50_M7TG26 Aspartyl/asparaginyl-tRNA synthetase n=1 Tax=Thermoplasmatales archaeon SCGC AB-540-F20 TaxID=1242866 RepID=M7TG26_9EURY  ali  30  2.......YRSHYSKDVTKKDYNKSITVAGWIEDIRNIGSIAFVILRDRKGTLQLTVLKKK---NPELFEKLTSLSRESVISVKGVC---KENEKVRNGYEILPEGMKVLSIAK 101
486 2.000e-27UniRef50_A0A0D6DU85 Aspartate--tRNA(Asp/Asn) ligase n=21 Tax=Bacteria TaxID=2 RepID=A0A0D6DU85_9LACT  ali  27  2........RTKTSETITKQ--GETVTVKGWVNSRRDHGGVIFIDLRDYAGLLQVVIQPEHVTN----FSAAEHLRDEYAISVTGTIRARGENPNLATGIELVAASFEILNASK 104
487 2.000e-27UniRef50_A0A0G1HGI3 Aspartyl-tRNA synthetase n=1 Tax=Candidatus Gottesmanbacteria bacterium GW2011_GWA2_44_17 TaxID=1618444 RepID=A0A0G1HGI3_9BACT :_  ali  23  5........RTLTNETI--QKIGQEVLLQGWVGARRDHGKIMFLDLRDRSGIVQLVAPPAKAASFAEVATKAESVGKEDVIEVVGLVKERPVNPKLNTGIEVEVRSLNILSKA. 112
488 2.000e-27UniRef50_A0A2M7MGA2 Aspartate--tRNA ligase (Fragment) n=10 Tax=root TaxID=1 RepID=A0A2M7MGA2_9BACT  ali  23  3........RTLSIETI--KKVGETVKLNGWVNNRRNMGKIAFLDLRDRWGIVQVVCVP--NELDEKSQAALKDIRPEFVLEIEGMVQARGEKDLLTGGVEVLAKKIAILAKSE 107
489 3.000e-27UniRef50_M3GGW2 Putative aspartate--tRNA ligase n=11 Tax=Bacteria TaxID=2 RepID=M3GGW2_LEPBO  ali  23  6.....YKNRS-WAGELNESQVGKKIFLYGWSFRFRDQGGVIFIDLRDRTGIIQVV--ARKELLGEEFF-IAEKVRSEYVLAVSGTLKKRDVNLKMQTGIEVVLDKLEILNIAK 113
490 3.000e-27UniRef50_UPI000768BF95 GNAT family N-acetyltransferase n=1 Tax=Streptococcus suis TaxID=1307 RepID=UPI000768BF95  ali  21  2.......KRSMYAGRVRKEHVGQEITLKGWVGRRRDLGGLIFIDLRDREGIMQLVINPE--SVEAEVMAKAESLRSEFVIEVTGTVVEREQAIHYIT................ 89
491 3.000e-27UniRef50_A0A1X6PD84 Uncharacterized protein n=1 Tax=Porphyra umbilicalis TaxID=2786 RepID=A0A1X6PD84_PORUM  ali  27  133........RTHTCGELRVADAGATVTVAGWAHAVRDRGGVTFLLLRDRAGVIQVTVTPPXDAALPPALAAAKDVRLEYVVTASGTVAARDVNPSMATGVEVRAAAVTILSRS. 257
492 3.000e-27UniRef50_B5Y8L4 Aspartate--tRNA ligase n=4 Tax=Coprothermobacter TaxID=68335 RepID=B5Y8L4_COPPD  ali  24  5...........YIGDVKNVKLDSVVELCGWVQYVRDFGKVVFFVIKDRTGIIQCYTSTQ----SEELLELVKKLSIDDVVRVRGTVKRRPENPNMENGIEIEVEDFEVLNPC. 105
493 3.000e-27UniRef50_A0A133VDZ4 Aspartate--tRNA(Asp/Asn) ligase n=52 Tax=root TaxID=1 RepID=A0A133VDZ4_9EURY  ali  31  9......WRRTHLSQEIDSDLAGEKTTIMGWVTDIRDLGGIKFFILQDFSGTIQV--TAPKAKVGKDILNEIDSISKESAVAVKGEIAK---ADQAPRGVEVVPSEIRVLNPAE 110
494 3.000e-27UniRef50_A0A0K6G5S0 Aspartyl-tRNA synthetase n=35 Tax=Agaricomycotina TaxID=5302 RepID=A0A0K6G5S0_9HOMO  ali  23  40AHNGVFPPRSHTCGNLTLEDVGKTVTLAGWIQPARVSKHLTFFTLKDADGQTQLLVRSSATNTVEAGPK-LEDAPVESVVLAEGKVVARPRTDTLTGEVEVHVEKYTLLNPA. 155
495 3.000e-27UniRef50_C1M093 Aspartyl-tRNA synthetase, putative n=1 Tax=Schistosoma mansoni TaxID=6183 RepID=C1M093_SCHMA  ali  22  39.....FVYKSHACGELSTQHINSTVTVCGWLEHCRLSSR--FLVLRDDRGLIQIYCDKNSLQIP--------QFNSESVLRVTGKVQARPKNKRMPTGIEIVAESIEILSHS. 139
496 3.000e-27UniRef50_A0A151ZS56 Vacuolar protein sorting-associated protein 26 n=1 Tax=Tieghemostelium lacteum TaxID=361077 RepID=A0A151ZS56_9MYCE  ali  30  121.......PRTHTCGNLGSVDIGKEVVIYGWVNSLRDLGDKAFLVLRDGYGKVQTYCSFDDQDVTDQQF--IKSIKLESVVCVRGKVIARPVNAKMKTGIEIQLQSIYLLN... 237
497 4.000e-27UniRef50_A0A066V8K1 Uncharacterized protein (Fragment) n=1 Tax=Rhizoctonia solani AG-8 WAC10335 TaxID=1287689 RepID=A0A066V8K1_9HOMO  ali  21  60......PARSHTCGNLTAEDAGKTVTLAGWIQPARVSKHLTFFTLKDGEGQTQLLFRSPAAGTL-GVGPELEDVPVESVVLVEGKVVARPRTDTSTGDVEVHVDKYTVLNPA. 169
498 4.000e-27UniRef50_A0A197KCY3 Aspartyl-tRNA synthetase n=18 Tax=Fungi incertae sedis TaxID=112252 RepID=A0A197KCY3_9FUNG  ali  24  86.....FPSRTHKCGQLNQTNVGEHVVLTGWAQNIRKFSELIFLPLRDSSGTIQLVLKGSSNNASSAAARQLQDLTAESVIWVEGKVVAREINRQMATGIEIELSSIRILNK.. 197
499 4.000e-27UniRef50_A0A1G1YLT8 Aspartate--tRNA(Asp/Asn) ligase n=8 Tax=unclassified Bacteria TaxID=2323 RepID=A0A1G1YLT8_9BACT  ali  25  3........RT-YIQDL-KNNVGQKVTVAGWVDVRRDHGKLIFLDLRDKTGVLQVVSNAK----NEKAHAVVETLHGEWVVALTGVVHKRPEKELLMGDIEMSIEEVHILSQAQ 105
500 4.000e-27UniRef50_A0A0G0XDP3 Aspartyl-tRNA synthetase n=6 Tax=Bacteria TaxID=2 RepID=A0A0G0XDP3_9BACT  ali  25  9................TVSHIGETVLLKGWVDGRRDHGKIVFLDIRDRSGIVQTVLLES---------EKAKEVRSEFVVEVTGKVTQRPENPHIPTGVEVSIESIKIVNSSQ 100
501 5.000e-27UniRef50_A0A1D8S5N0 Aspartate--tRNA(Asp/Asn) ligase n=22 Tax=Euryarchaeota TaxID=28890 RepID=A0A1D8S5N0_9EURY  ali  34  3........................VTVAGWVHEIRDLGGIAFLILRDRTGKIQIKF--EKDELPDELVERALSVHRESVLSVTGEVFEEERAP---TGVEVVPSEIEVIAAA. 85
502 5.000e-27UniRef50_A0A2R6CMX0 Aspartate--tRNA(Asn) ligase (Fragment) n=1 Tax=Halobacteriales archaeon QH_10_65_19 TaxID=1919147 RepID=A0A2R6CMX0_9EURY  ali  33  13.....................GDEVTVAGWVHEIRDLGGIAFLILRDTTGKIQIKF--EKDTMDDALVEAGLDLHRESVVAVTGAV---EEEERAPTGVEVVPESIEVLAEA. 98
503 6.000e-27UniRef50_A0A1Q9NHG7 Asparagine--tRNA ligase n=5 Tax=Candidatus Heimdallarchaeota TaxID=1936272 RepID=A0A1Q9NHG7_9ARCH  ali  29  12..QNSSWK-TQLCSEISKENTKKTVRVAGWVHFIRDKGKIIFIQLRDASGLCQITLN--ETKSPEEAFKNAKQLSLESIISVEGIIKEDARSIN---GAELIPSIIFILSKAE 118
504 6.000e-27UniRef50_A0A257ULT2 Aspartate--tRNA ligase n=3 Tax=Bacteria TaxID=2 RepID=A0A257ULT2_9BACT  ali  29  13...........FCGSLRAADIGRRVELVGWVRRRRNLGGIVFVDLRDREGWAQVLLR-------DALREAGEKLSQEDVVCVVGTVAARSVNPEMPTGIEVIAEKVELLTAAE 111
505 7.000e-27UniRef50_A0A061H6K1 Uncharacterized protein n=1 Tax=Anthracocystis flocculosa PF-1 TaxID=1277687 RepID=A0A061H6K1_9BASI  ali  25  88.........THRCGELDQHHAGQQVVLAGWLDSLRVSKHLGFVALRDHTGSVQLVLQADGDERLEALIASTSSMPLQSVVLATGHVQLRPENPSLPSGIEIRLSSLQLLNPAR 196
506 7.000e-27UniRef50_A0A075GFN8 Aspartate--tRNA(Asp/Asn) ligase n=5 Tax=cellular organisms TaxID=131567 RepID=A0A075GFN8_9EURY  ali  25  4.........TRRCGELSEADDDTEQTLCGWLQETRNLGGIAFLQLRDSTGIAQLILPKKK--VGEENFKAWTAIARESTLRVTGTVKANQEAPN---GLELVPTELEVLNAA. 101
507 7.000e-27UniRef50_E0VEP3 Aspartyl-tRNA synthetase, putative n=64 Tax=Neoptera TaxID=33340 RepID=E0VEP3_PEDHC  ali  23  2........RTHTCGELDDIHVGQNVCLMGWVEFQR-MGK--FVLLRDGYGKTQLTIPESKSN----FQSLVETLKPESVLLAEGTVFPRPENLKQKTGIEVIVSDLKVLNMAK 103
508 7.000e-27UniRef50_A0A2E8GHY6 Aspartate--tRNA(Asp/Asn) ligase n=68 Tax=Bacteria TaxID=2 RepID=A0A2E8GHY6_9ACTN  ali  22  2........RTDYCGRLSSDDVGRTVTVCGWVSKRREHGHLAFVDLRDRTGVVQCVV------------DHAHDIRSEYVLAVTGTVRERPVNDELATGIEIGEASVEVLSQA. 98
509 9.000e-27UniRef50_A0A1V5UKZ3 Aspartate--tRNA ligase n=3 Tax=unclassified Tenericutes TaxID=713063 RepID=A0A1V5UKZ3_9BACT  ali  26  2.......YRTIENGNISEKLVGQNVRIIGWVAKKRDLGGLTFVDLRDRSGIVQVLINEDVARPD---------IRNEYIIQVEGTVTLKEVNLNLKTGVEVVARKVTLINKAK 100
510 9.000e-27UniRef50_E0TJ72 Aspartate--tRNA ligase n=7 Tax=Flavobacteriales TaxID=200644 RepID=E0TJ72_SULMC  ali  20  2.......YRTNNCGVLRLKDVGKNVIMSGWIKKIRNLGSIIFIDLRDMYGITQLNLINYFNNK-----KKINNLGREFVIKVEGKVIERSKNFKNPTGIEILVKKLKILNNS. 103
511 1.000e-26UniRef50_A0A0L0SB24 Aspartate-tRNA ligase n=4 Tax=Allomyces macrogynus ATCC 38327 TaxID=578462 RepID=A0A0L0SB24_ALLMA  ali  21  73.FSTKHYDRTCPCGRITSDHVGQRVQLVGWVESIRKLSSLVFIPLRDGYGKCQLVLRG----GNDAVWSALDNVSIESVVYVEGVVAKRPEKDVLGNDYEVEVDVLELVNKA. 181
512 1.000e-26UniRef50_A0A257A4K4 Aspartate--tRNA ligase n=2 Tax=Euryarchaeota TaxID=28890 RepID=A0A257A4K4_9EURY  ali  32  3........RTHYSKDITPAEYGKTIFLAGWIEDIRNLGGIAFILLRDRKGKAQVTCIKKEE---PEIFESLTSLPRESVVSVKGICQ---ENEKVRNGWELMVKEVKILSIAK 101
513 1.000e-26UniRef50_A0A0N5DD90 Uncharacterized protein n=1 Tax=Trichuris muris TaxID=70415 RepID=A0A0N5DD90_TRIMR  ali  23  75..STSFSYRTHTCGELNESDLGKRVVLCGWMHQKRMN---RFVILRDVYGKIQLLLN-------KQLFALVDKLPLDSVLKVVGVVAARPEADKMKTGIEVQTEE........ 171
514 1.000e-26UniRef50_Q8U4D3 Asparagine--tRNA ligase n=27 Tax=Archaea TaxID=2157 RepID=SYN_PYRFU  ali  26  6...........YCSEVKPELEGKKVKLAGWVYSNMKVGKKIFLWIRDSTGIVQTVIA--KNVVGEEVFEKAKKLGRESSVIVEGIVKADERAP---GGAEVRVEKLEVI.... 98
515 1.000e-26UniRef50_A0A1Y2IH27 Uncharacterized protein n=1 Tax=Trametes coccinea BRFM310 TaxID=1353009 RepID=A0A1Y2IH27_PYCCO  ali  22  6SETGPFPRRTHTCGSLGLDDADKRVVLQGWVHKGKVNKKMSFFGIRDSYGTTQLVVDARKC--GADVLAAMREASEESTVLIEGIVTQRPESQRRAGHVEVLVSSFKLLNPA. 119
516 1.000e-26UniRef50_A0A2A2KQB1 alpha-1,2-Mannosidase (Fragment) n=2 Tax=Diploscapter pachys TaxID=2018661 RepID=A0A2A2KQB1_9BILA  ali  27  824...STYTTRTHTCGELRKKNVGERVKVVGWLARRRM---DRFIVLRDAYGIVQARI-PDDFKFGESSVK---DLPYETVLEVEGQVMDRGKNSQMETGIEIEIDKLRILNKA. 928
517 1.000e-26UniRef50_A0A2U0RXQ1 Aspartate--tRNA(Asn) ligase (Fragment) n=1 Tax=Candidatus Bathyarchaeota archaeon TaxID=2026714 RepID=A0A2U0RXQ1_9ARCH  ali  30  9......WRRTHYSADINPELDGQEVVVFGWVQEIRDLGGLRFLILQDKAGQLQITIHRHK--VAKEVVEKAETLQKQYSVGIKGTVKKMPKAPN---GAEIIPNEMRIFSMSQ 110
518 1.000e-26UniRef50_A0A2G9PT92 Aspartate--tRNA(Asp/Asn) ligase n=4 Tax=cellular organisms TaxID=131567 RepID=A0A2G9PT92_9ARCH  ali  33  3........RTHYAADVKPSMDGKTVTVAGWTHETRDLGGLEFVILRDRSGLVQITV--KKKEADAKLVEIAKKLVKETAIVCTGVVKSSKMAP---GGVEIIPSEMSVVGE.. 100
519 1.000e-26UniRef50_UPI000C202BD9 aspartate--tRNA ligase, chloroplastic/mitochondrial-like n=1 Tax=Cucurbita moschata TaxID=3662 RepID=UPI000C202BD9  ali  22  126........RTALCGELSVDDVGKRVRLCGWVALHRVHGGLTFLNLRDHSGIVQVTTLPNE---FPDAHSTINDLRLEHVVAVEGTVRSRPVNVKMKTGIE............. 218
520 2.000e-26UniRef50_A0A2E9R316 Aspartate--tRNA(Asp/Asn) ligase n=1 Tax=Deltaproteobacteria bacterium TaxID=2026735 RepID=A0A2E9R316_9DELT  ali  18  1.MANTLANRTHTCGALRVEHEGQEVILKGWITLRREHKNIIFLDLGDRYGMTQLTLNTQE---HPQLAALLPELRLGTCIGVAGTVVDREKNKQLATGIEVIVSHTEIYGATK 115
521 2.000e-26UniRef50_A0A0C7CIB9 Putative Aspartyl-tRNA synthetase n=1 Tax=Rhizopus microsporus TaxID=58291 RepID=A0A0C7CIB9_9FUNG  ali  25  57.....YPSRTHYCGDLSASNEGEKVVLCGWAQSTRSLSQLIFIPLYDHSGTAQLVFR----NGNQQLKSQIQSLSAESVICVEGIVRKRPE...................... 139
522 2.000e-26UniRef50_A0A1S6H5M4 Aspartate--tRNA(Asp/Asn) ligase n=9 Tax=Bacteria TaxID=2 RepID=A0A1S6H5M4_9BACT  ali  25  2.........TRTLAGATLELVGKTVTLKGWINSVRSHGGLTFFDLRDRSGLVQVVGE-----------KLAKDLKPESVVAVTGRVKARPVNPKLTTGVEVAAQTVEVITVSR 98
523 2.000e-26UniRef50_O74407 Aspartate--tRNA ligase, cytoplasmic n=5 Tax=Ascomycota TaxID=4890 RepID=SYDC_SCHPO  ali  17  84..STARPGRTYTISDISAKNDGQTVLLRARVYTSRLQGKMCFFSLRQKYDTIQALAVVNKDTISKQMVKWCGSISLESIVLVEGIVKKSPEIIKSATDAEIHISSIYVISP.. 196
524 2.000e-26UniRef50_A0A182E3R8 Uncharacterized protein n=5 Tax=Chromadorea TaxID=119089 RepID=A0A182E3R8_ONCOC  ali  20  63...NDFTLRTHTCGELRIGHESQKVTLYGWLQFNRLN---RFLVLRDAYGSVQVRVPEKK----KDLIEKIKMINCESVLKIEGVVVDRGENANMRTGIEVLVNDLELLNNS. 168
525 2.000e-26UniRef50_A0A0G1M5I2 Aspartate--tRNA ligase n=15 Tax=root TaxID=1 RepID=A0A0G1M5I2_9BACT  ali  30  3........RT-LISE-TISKVGQEVLLKGWVNTRRDHGQIVFIDLRDRTGIVQIVASPG----------LVAGLHSEDVIYVTGLVKARPENLKLATGVEIDAQKIELVSKA. 98
526 2.000e-26UniRef50_A0A0G0EQU8 Aspartyl/asparaginyl-tRNA synthetase (Fragment) n=1 Tax=Candidatus Moranbacteria bacterium GW2011_GWF2_35_39 TaxID=1618721 RepID=  ali  23  9................TPNLIGQKVKLSGWVSVRRDHGKLIFIDLRDRSGIIQMVVIPDKV----EAHQISKEVRSEYVITVEGLVKERPKNENPLGRVELEVEKMEIISRVE 105
527 2.000e-26UniRef50_A0A2M7CNV0 Asparagine--tRNA ligase (Fragment) n=4 Tax=Bacteria TaxID=2 RepID=A0A2M7CNV0_9CHLR  ali  31  10.................SNYEGQEATVQGWVYNRTDKGKLVFLLVRDGTGFIQCV--AFKGDLDEAVFDQLVRLPQESSVVITGPVRADKRAPGIPGGYEIGVKQIRIVQTAE 103
528 2.000e-26UniRef50_A0A1Q7TRE8 Aspartate--tRNA ligase (Fragment) n=1 Tax=Chloroflexi bacterium 13_1_20CM_4_66_15 TaxID=1805061 RepID=A0A1Q7TRE8_9CHLR  ali  24  4......TPRT-PCGAPRIEQAGQSVDVYGWVHRRRDLGGLIFIDLRDRSGIVQVKFDP----VHAQAHATGGELRLETVIHVRGPIVRRPENKELPSGVEIEAQAVDILNRA. 108
529 2.000e-26UniRef50_A0A0G0SYD2 Aspartate--tRNA ligase n=26 Tax=root TaxID=1 RepID=A0A0G0SYD2_9BACT  ali  30  9................TVNKVGEKVTLAGWVNTIRDHGKITFIDLRDRSGIVQCV------------GKDLTKVNPESVVEISGLVKKRPENPRMETGIEIEIENLNILSKS. 96
530 2.000e-26UniRef50_A0A0G0UQT6 Aspartate--tRNA ligase n=11 Tax=Bacteria candidate phyla TaxID=1783234 RepID=A0A0G0UQT6_9BACT  ali  34  2.......KRT-YNKEIG-QHVGKEVVVMGFVHTLRVQSKIIFLLLRDVTGIIQNVV-----ETSSTSFETAKNLSHESVVKITGTV---KEAKQAMGGFEISVKSIEVLSVA. 96
531 2.000e-26UniRef50_A0A2E0B6D8 Aspartate--tRNA(Asp/Asn) ligase n=2 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2E0B6D8_9CHLR  ali  22  10...........NCSDVVLDKEGETINLAGWVHKRRDHGGLVFIDLRDXSGIVQVVFD---QGISEKSYVDAQSXRPEWVVSVKGKVXPRPENTRIPSGMEVHCSEXXVXNESK 112
532 3.000e-26UniRef50_A0A1I7RS50 Uncharacterized protein n=1 Tax=Bursaphelenchus xylophilus TaxID=6326 RepID=A0A1I7RS50_BURXY  ali  20  12AVVNRFTQRSHNCGQLRIQNEGNRVLLKGWVSYKRYNK---FFVLKDSYGTVQIL-------TPEKMSGFMKDVPHESVVAVEGVVINRGENSNATGDIEVLAEDIQVLNLA. 116
533 3.000e-26UniRef50_A0A2G0V6P6 Aspartate--tRNA ligase n=1 Tax=Candidatus Tremblaya phenacola TaxID=1010676 RepID=A0A2G0V6P6_9PROT  ali  18  2........RTIYCGELRSLHIGKRITICGWLNKIRNLGKLIFLELRDIKGIVQAYIEVE----NKPIFLKTLKLHNELCIQLDGLVRARPINSISTGDIEVLAIGLSILNES. 105
534 3.000e-26UniRef50_Q6YR88 Aspartate--tRNA ligase n=30 Tax=Acholeplasmataceae TaxID=2146 RepID=SYD_ONYPE  ali  25  1....MKTKYSHYNNQLQLAHQGKTVFLKGFIFRKRNLGKTLFFDLRDVSGIVQLLV-----KENNPQYDKIALIKLETVVQIKGQVIERNKNPDLPTGIEILVSHIEILSEAQ 106
535 3.000e-26UniRef50_A0A1D2MA01 Aspartate--tRNA ligase, mitochondrial n=1 Tax=Orchesella cincta TaxID=48709 RepID=A0A1D2MA01_ORCCI  ali  22  91...STYTFRSHTCGQLTKEDEGKSVRLCGWLTFKRLNG--TFVVLRDLYGVTQIYVPKEL----ENAAKIACDAPLESVLLIQGKVALRPRSDQISGDIEVVATHISLLNPSE 199
536 4.000e-26UniRef50_D2MQN3 Aspartate--tRNA ligase n=1 Tax=Bulleidia extructa W1219 TaxID=679192 RepID=D2MQN3_9FIRM  ali  23  8.............GSLRKEDIGQLVQLVGWVNTRRNFGSMIFVDLRDRSGLVQLVIQ-------EEDIPEVKEIRSEYVLQVEGKVALRKDNPKLETGIEVLVSKMVVLNRSK 102
537 4.000e-26UniRef50_UPI0007116141 aspartyl-tRNA synthetase n=1 Tax=Blastocystis sp. subtype 4 TaxID=944170 RepID=UPI0007116141  ali  21  35....PKPLKSCPCSSLTSSDLCRKVTTAGWVSSIRVMKDSVFIVLRDGSGMVQTLF-----PCNKETEEIIKSIPLESSVCVTGTVQKRPENPKMKTGIEIKGDHLYLLNKA. 141
538 4.000e-26UniRef50_A0A1Y3BN82 Aspartate-tRNA ligase, mitochondrial-like protein (Fragment) n=1 Tax=Euroglyphus maynei TaxID=6958 RepID=A0A1Y3BN82_EURMA  ali  16  12...NRFTTRTVNCGQLNDHMIGQQVQLCGWLEYRRMN---RFIVLRDSYERIQLFIKRKQDQ------DIVSVCHLESVIRVTGTIAVRPENVNMVNGIEILVDHLELLNNSK 116
539 4.000e-26UniRef50_A0A074ZL13 Uncharacterized protein (Fragment) n=3 Tax=Opisthorchiidae TaxID=6196 RepID=A0A074ZL13_9TREM  ali  23  35........RSHTCGELRLRHVSETVSLCGWIHRIRLSK---FLILRDKYGLVQVFLGPD---VAKDPFP-----PVETVVRVVGTVAARPMNKDLPTGVEVLATRIDVLNLA. 131
540 4.000e-26UniRef50_A0A0R3RE42 Bm15491 n=2 Tax=Brugia malayi TaxID=6279 RepID=A0A0R3RE42_BRUMA  ali  18  24...NDFTLRTHTCGELRVGHENQKVTLYGWLQFNRLN---RFLVLRDAYGCVQARIPEKR----KDLIEKIKMINCESVLKIEGVVADRGENANMRTGIEVLVDDLELLNTS. 129
541 4.000e-26UniRef50_D2EF87 Aspartate--tRNA(Asp/Asn) ligase n=1 Tax=Candidatus Parvarchaeum acidiphilum ARMAN-4 TaxID=662760 RepID=D2EF87_PARA4  ali  27  4...........YCGDLSAELVDKEVTLNGWCRYIRDHGGKLFVDLADRTGIAQAVFDG-------DLLEQAKTLGREYVIRIKGLVKERDKEEQNPTGFEVIVEDLIIINKAE 102
542 5.000e-26UniRef50_A0A0G0XI37 Aspartate--tRNA(Asp/Asn) ligase n=22 Tax=cellular organisms TaxID=131567 RepID=A0A0G0XI37_9BACT  ali  25  2.......ERTLAIETVKA--VGKEVKLQGWVNTRRDHGKIMFLDLRDRSGIVQLVSTKD-----------LADARAEDVIEVVGLVKERPVNPKIETGVEVEIKSIAIISKAR 98
543 5.000e-26UniRef50_A0A0Q1B6R2 Aspartate--tRNA(Asp/Asn) ligase n=1 Tax=Desulfuromonas sp. SDB TaxID=1735325 RepID=A0A0Q1B6R2_9DELT  ali  18  15........RSKYCGEIRDSDLGKDLTLVGWVNSNRQHGGINFVDLRDRSGLIQLVFAP-------EVYKDA-GIKLETLIQVFGAVKLRPVNPHLPTGFELEVQKFQVIS... 112
544 5.000e-26UniRef50_E8V0L8 Asparagine--tRNA ligase n=14 Tax=Acidobacteriales TaxID=204433 RepID=E8V0L8_TERSS  ali  23  12...........TIATLG-QHEGQSVTLRGWLYNLRASGKLLFPIFRDGTGTIQGIV--PKAAVPEEVFETLKNLTLESSVIVTGKVRADSRAP---SGFELDVEDVQVLQR.. 105
545 7.000e-26UniRef50_A0A151ERU8 Aspartate--tRNA ligase n=4 Tax=cellular organisms TaxID=131567 RepID=A0A151ERU8_9EURY  ali  40  12....................IGQEVTVAGWVHELRDLGGIKFLLLRDRNGLVQITFLKKK--VDADVFQKFSELGREYVIQVKGLVNKSDIAQM---GIEIFPAEVTVLSEA. 98
546 7.000e-26UniRef50_A0A1V6A1T8 Aspartate--tRNA(Asp/Asn) ligase n=1 Tax=Firmicutes bacterium ADurb.Bin153 TaxID=1852883 RepID=A0A1V6A1T8_9FIRM  ali  24  3........RTHTCGDLNLSHVGGKVTLCGWIQVIRDHGGLLFIDLRDRYGITQVSVLPER---SPDAAELVKSLSRESVVQVVGEVVERPKNRNIATGIEVRADSVKVITRAE 108
547 7.000e-26UniRef50_J9Z1A7 Aspartate--tRNA(Asp/Asn) ligase n=6 Tax=Alphaproteobacteria TaxID=28211 RepID=J9Z1A7_9PROT  ali  18  1....MNKYRDLYLKDINKSSIGKTITVSGWVNRSRDHGNLLFIDLRDSTSLLQCVVD-----NSSAIFENLSKIKNEDVIQISGEITERPENPNLSGEVELQIKSFEHLS... 105
548 7.000e-26UniRef50_A0A0B3AVA8 Aspartyl-tRNA synthetase n=1 Tax=archaeon GW2011_AR17 TaxID=1579375 RepID=A0A0B3AVA8_9ARCH  ali  27  6............CGELSKAEVGKSVELSGWVDTLRLTGKISFLLLRDRTGIVQVFLD-------KVLTEKFQHIKAQSVVHITGVVHARPENQDMKTGIEIAAASLEVLSMAE 103
549 8.000e-26UniRef50_A0A256ZYX4 Asparagine--tRNA ligase n=6 Tax=Archaea TaxID=2157 RepID=A0A256ZYX4_9ARCH  ali  27  6.............KEILSGNVSGETKVRGWVYNSRSSGGIVFILLRDGTGLIQCTV--KKDEVPEDVFKTAESLSQESSIIVHGEVNKDERAP---GGYEIKAKKIEIVHRAE 100
550 8.000e-26UniRef50_A0A1F7IPT6 Aspartate--tRNA(Asp/Asn) ligase n=2 Tax=unclassified Bacteria TaxID=2323 RepID=A0A1F7IPT6_9BACT  ali  32  9................TPHKIGSEIELYGWVDSKRDHKNIIFIDLRDRTGIVQVVGD-----------QQFKELNSEDVIYVKGLVKKRPENPKLKTGIEIEAKQLKIITKAK 98
551 9.000e-26UniRef50_A0A075HLK1 Aspartate--tRNA(Asp/Asn) ligase n=67 Tax=Archaea TaxID=2157 RepID=A0A075HLK1_9ARCH  ali  23  44......WRRSHYSKDLVASMEGSDVTIMGWISSIRGHGNITFLTLVDKMGSIQVV--AKKGSSPDDLVQSISKLKEHSSIGLIGTVKTSEKAPN---GIEISPKDLRIFSSVE 145
552 1.000e-25UniRef50_F8NMH4 Uncharacterized protein (Fragment) n=8 Tax=Agaricomycotina TaxID=5302 RepID=F8NMH4_SERL9  ali  23  1....PYPPRTHVCGELSAAHDGTRVVLAGWLLERRASKSLSFFPIQDASGSLQLVVQRKKAGLCG-----LSAVPVESTVLIEGRVCVRPRRAEARGEIEVEVDKYTLLNPA. 107
553 1.000e-25UniRef50_J9K6D5 Uncharacterized protein n=4 Tax=Aphididae TaxID=27482 RepID=J9K6D5_ACYPI  ali  17  75...NLYTSRTHTCDQLRNEDCGKSVILCGWLEYVRLN---RFIILRDGYGSTQLVIP---ENASTELNDFIKQIPLESVLMCYGSVKLRPINKDQSTGIEVIVDQLLLLNA.. 180
554 1.000e-25UniRef50_A0A1F8KNR3 Asparagine--tRNA ligase n=5 Tax=Bacteria TaxID=2 RepID=A0A1F8KNR3_9CHLR  ali  29  11.................ANYTDQDVRIQGWVYNRTDKGKLVFLLIRDGSGFVQCV--AFKGDLDETTFDKIMRLPKESSVIITGKVRADKRAPGIPGGFEVGIKEIEILQEA. 103
555 2.000e-25UniRef50_R6HSJ4 Aspartate--tRNA(Asp/Asn) ligase n=6 Tax=Firmicutes TaxID=1239 RepID=R6HSJ4_9FIRM  ali  26  1....MNKYRTHLLKDINETLAGQDVVVSGWVENIRDHGGVLFLDLRDETSTLQTV------SNDDDMFKGIAK---ESVVKLTGKIRRREENDRISTGVEMVVDSLEMLG... 101
556 2.000e-25UniRef50_A0A2D6JC61 Aspartate--tRNA ligase n=1 Tax=Euryarchaeota archaeon TaxID=2026739 RepID=A0A2D6JC61_9EURY  ali  37  10.......RKTHYASEIVPAMDGKDAVLMGWAREIRLLGNLVFVVLSDRSGDCQVTFLSK----TKKAFEIAQELNREDVIAIKGKIKKS---TKTNRGVEVLAEEIFVLNKSK 108
557 2.000e-25UniRef50_A0A1Q7YQD1 Asparagine--tRNA ligase n=2 Tax=Bacteria TaxID=2 RepID=A0A1Q7YQD1_9CHLR  ali  27  3.........TITIEQAG-NHDGQEVALKGWLYNLRESGKLLFPIFRDGTGIIQGVCAQKE---NPEAFESLKGLTQESSVIVTGKIRAEKRAP---GGYEIGVTKIQILQK.. 97
558 2.000e-25UniRef50_A0A2H9LVS4 Aspartate--tRNA(Asp/Asn) ligase n=21 Tax=cellular organisms TaxID=131567 RepID=A0A2H9LVS4_9ARCH  ali  28  13.......ERT-YVSE--TKKAGEKVLLKGWIHDVRDIGKIKFLLLRDVTGIIQ--ITAIMGKTDEKVLEKMSKIPRESVISIEGTV---KESKQAPGGFEVFPEKIEVLSEA. 109
559 2.000e-25UniRef50_A0A1C7LZ50 Sulfhydryl oxidase n=1 Tax=Grifola frondosa TaxID=5627 RepID=A0A1C7LZ50_GRIFR  ali  23  178............IGNLTP-LRSKRVRVSGWVHRLRDQKGIYFVVLRDGTGYLQCVLSGKVAQTYDAL-----TLTLESTIEVVGALQLTPEGKTAPGGHELLVDYWKVLGPS. 271
560 2.000e-25UniRef50_U6PHF8 Nucleic acid binding domain containing protein n=2 Tax=Haemonchus TaxID=6288 RepID=U6PHF8_HAECO  ali  23  15...NAFTTRTHNCGELTRKDEGVRVCIKGWLAYKRM---DRFIVLRDSYGTVQACIGP-----GSELCKMVKDLPYESVVQVEGTVVSRGENPKMKTG-EIENHSVCLIS... 114
561 2.000e-25UniRef50_A0A0G1DET5 Aspartate--tRNA(Asp/Asn) ligase n=73 Tax=root TaxID=1 RepID=A0A0G1DET5_9BACT  ali  25  2.......KRTI-IKD-TVNHIGSTVTVSGWVHSVRKHGKIAFLDLRDRSGLIQAV---------DLTGKAVEKVGNEYAVEVTGLIKKRPENPKIITGVEMEIRELTVYSKS. 99
562 2.000e-25UniRef50_Q3Z8N3 Universal stress protein family n=10 Tax=Dehalococcoides TaxID=61434 RepID=Q3Z8N3_DEHM1  ali  39  3........KTHSCA-LTQENIGTEVTLAGWVHRRRDHGGVIFIDLRDREGIVQVVFNPEQ---SAACLDIGKELRSEYVLQVKGI............................ 75
563 2.000e-25UniRef50_D5HDB2 Aspartyl-tRNA synthetase n=2 Tax=root TaxID=1 RepID=D5HDB2_9FIRM  ali  27  7.......YRNRTMNEITEGDVGQTLKVAGWVENIRDHGGVSFIDLRDMYGVLQVVMRDTS---------LLDGITKEDCVSIEGIIEHRDENPKIPTGIELEAKTVEILGK.. 105
564 3.000e-25UniRef50_A0A0G0ZYF4 Aspartate-tRNA ligase (Fragment) n=1 Tax=Candidatus Yanofskybacteria bacterium GW2011_GWC2_41_9 TaxID=1619029 RepID=A0A0G0ZYF4_9B  ali  30  9................TKNLIGQEVNLCGWIHNRRDHGKLVFIDLRDRSGIVQVVFTPEQAPNDNLLYDMASQLRAEWVVRLKGAVKARPENDEISTG............... 110
565 3.000e-25UniRef50_A0A0G0LUV6 Aspartate--tRNA(Asp/Asn) ligase n=17 Tax=unclassified Bacteria TaxID=2323 RepID=A0A0G0LUV6_9BACT  ali  30  2.......KRTLSID--VAEKIGKEVMVSGWIHKIRKLGGINFIVLRDRGGLVQAIVEKTED------IDKLKELTTESVVSITGKVAKEDRAP---GGAEIHVQNIEILSP.. 94
566 3.000e-25UniRef50_A0A0G0WN53 Aspartate--tRNA ligase n=52 Tax=root TaxID=1 RepID=A0A0G0WN53_9BACT  ali  28  2.....................GAEIVINGWVQTRRNLGKIIFLDIRDGSGLVQVVCAPSELGSD---YDVAKEVRQEFVVEIAGVVNKRNENPALITGVEILAKDFKILAKAE 94
567 3.000e-25UniRef50_M4ZR59 Asparaginyl-tRNA synthetase (Fragment) n=3 Tax=Amniota TaxID=32524 RepID=M4ZR59_STATI  ali  20  31.................EAHRGQRVKVFGWVHRLRRQGKLMFLVLRDGTGFLQCVLSDELCQCYNGVI-----LSTESSVAVYGTLNLVPEGKQAPGGHELSCDYWELIGLA. 121
568 3.000e-25UniRef50_A0A0L0HNQ1 Aspartate-tRNA ligase n=1 Tax=Spizellomyces punctatus DAOM BR117 TaxID=645134 RepID=A0A0L0HNQ1_SPIPN  ali  24  75.......RRTHRCGDIRLSDVGKEVVLCGWALSPRKIGSIAFLPIRDASGVAQLVHEMPGAISQADLRELLLSLSPETIVCATGLVRKRPVSDQSTGEVEVLLRSFQVLNPA. 186
569 3.000e-25UniRef50_X1IWT6 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X1IWT6_9ZZZZ  ali  23  1GKSNIQMYRTHTCGELNIKSVGINVALSGWVQRSRDLGGMTFIDLRDRYGITQLVFNMD---TNATLCEKARKLGREFVIQAE.............................. 80
570 3.000e-25UniRef50_A0A090L0H9 Aspartate--tRNA ligase, mitochondrial n=2 Tax=Strongyloidoidea TaxID=2082224 RepID=A0A090L0H9_STRRB  ali  24  13...NRYSLRSHNCGELRLKDEGKIVSLYGWVAYKRMDK---FVVLKDAYGMTQLQIDDE----NKELKEIVKNITLESCLSVVGIVKDRKRNKSMDTGIEVSVQNLDILNCA. 117
571 3.000e-25UniRef50_A0A2H0X7Y7 Aspartate--tRNA ligase (Fragment) n=1 Tax=candidate division WWE3 bacterium CG08_land_8_20_14_0_20_43_13 TaxID=1975087 RepID=A0A2  ali  22  10.................SSKLGETVHLLGWVNSRRDHGKITFIDLRDRTGIVQVVLSGDLAKNNDQ-------IRDEYILEVVGKVAPRPDNELPLGNVEVQAQQIAVISKSQ 102
572 3.000e-25UniRef50_F1A3I9 Uncharacterized protein n=1 Tax=Dictyostelium purpureum TaxID=5786 RepID=F1A3I9_DICPU  ali  25  72......TKRSNTCGDLNKNDIGKEVLIYGWINSFRKFGDQVFMVIRDGHGKVQVIINLNESNSNSKNIENIKLFKLESIVSIRGKVIGRPINQKMKTGIEIEASEIQLLN... 200
573 4.000e-25UniRef50_A0A090W4Q7 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B n=2 Tax=Flavobacteriales TaxID=200644 RepID=A0A090W4Q7_9FLAO  ali  29  519.......YRSHKASELSEASISQKVTLAGWVSSVRDHGELIFIDLRDSSHEIQVRLSRESFPNLDELVK----LKPESVITVTGEVVQRKANPALRTGIELETSELDILNLSK 625
574 4.000e-25UniRef50_A0A0F8VGJ0 Aspartate--tRNA(Asp/Asn) ligase n=6 Tax=root TaxID=1 RepID=A0A0F8VGJ0_9ARCH  ali  35  5SLGN--WRKTHFTKDITSALVDKEIILGGWVRNFRDLGGLKFISLQDKYGERQITI--KKGVVSDDLFDK-TKVGYQYCIMVKGIV---KIFKKAPGGIEIIPSEIKILNK.. 107
575 4.000e-25UniRef50_A0A0G0Z272 Aspartate--tRNA(Asp/Asn) ligase n=33 Tax=Bacteria TaxID=2 RepID=A0A0G0Z272_9BACT  ali  25  2.......ERT-YIKDI-KKNTGQKILLSGFVQTLRKQGGIAFLILRDVTGTVQTVII----KSNTDAFATIQDLSLESVVTLVG---ESKENSQAPNGIEVLVETVEVLSKAE 98
576 4.000e-25UniRef50_A0A2D3R7K2 Aspartate--tRNA(Asp/Asn) ligase n=1 Tax=Legionella endosymbiont of Polyplax serrata TaxID=2005262 RepID=A0A2D3R7K2_9GAMM  ali  23  2........RSHYCGNVNKKILNKIISICGWIDNYRQHKKIIFFDVRDHSGILQVVCSYK----YEKVFSVAKKIHCEDVIWVKGLVCSSKNHNSKISYIEILVYELKILNPA. 105
577 4.000e-25UniRef50_A0A2A4Y6P4 Aspartate--tRNA ligase n=4 Tax=unclassified Bacteria TaxID=2323 RepID=A0A2A4Y6P4_9BACT  ali  23  2.......ERT-TLGKL-AEKTGEKVRIEGWVDVRRDHGKLMFLVLRDRSGSVQGIVKGEL-----AAGETAQKLREQWVVRIEGTVNQRPENDELNGDIELLVEEITVLAEA. 102
578 4.000e-25UniRef50_B8PNI8 Predicted protein (Fragment) n=2 Tax=Agaricomycetes TaxID=155619 RepID=B8PNI8_POSPM  ali  20  72..SQSRPRRSRTIASLTPELDGQPVLLRARVQTSRMQGKMVFFVLRQRIDSVQALLTVSEGKVSKQMAKWAGGLAMESIVLVEGTVKKAPEIIKSATNVEIHISQWTC..... 181
579 4.000e-25UniRef50_A0A090WIX7 Multifunctional fusion protein n=45 Tax=Bacteroidetes TaxID=976 RepID=A0A090WIX7_9FLAO  ali  29  519.......YRSHKASELSEASISQKVTLAGWVSSVRDHGELIFIDLRDSSHEIQVRLSRESFPNLDELVK----LKPESVITVTGEVVQRKANPALRTGIELETSELDILNLSK 625
580 4.000e-25UniRef50_A0A0G0FG60 Aspartate--tRNA(Asp/Asn) ligase n=17 Tax=root TaxID=1 RepID=A0A0G0FG60_9BACT  ali  22  9................TPNVIGQHVKLSGWVSVRRDHGKLIFIDLRDRSGIIQMVVIPDKL----EAYQISKEVRSEYVISVEGLVKERPKSENPLGRVELEVEKMEIISRVE 105
581 4.000e-25UniRef50_K5W120 Uncharacterized protein n=14 Tax=Agaricomycetes TaxID=155619 RepID=K5W120_AGABU  ali  20  63.FTGPFPPRTHSCGALNASHVGQRVVLAGNLLPGRKGKRVSFFPLKDSHGTTQLILS------DPQGFSDLANVPLESSVLVQGTVLPRPQEAKSTGEIDVQVESFTVLNPA. 170
582 4.000e-25UniRef50_A0A1S7HAK8 DED81 (YHR019C) n=7 Tax=Opisthokonta TaxID=33154 RepID=A0A1S7HAK8_9SACH  ali  24  122.................PEFVGHRVKVYGWVHRLRNNKKLVFIVLRDGSGFLQAVLTGDL-----ALAKQTQELTLESSVALYGRVNKVPEGKTAPGGIELIVDYYEIVSLA. 211
583 4.000e-25UniRef50_R4PMH7 Aspartate--tRNA(Asp/Asn) ligase n=6 Tax=Candidatus Saccharibacteria TaxID=95818 RepID=R4PMH7_9BACT  ali  26  13....................IGKTLSVSGWVHARRDHGGLIFVDVRDHSGILQLVINPE----NTDAFAVAEELRDEFVIKAQGELKERTKNEKIPTGVELYVATLTILNRSQ 105
584 5.000e-25UniRef50_A0A132AHM9 Aspartate-tRNA ligase, mitochondrial-like protein n=1 Tax=Sarcoptes scabiei TaxID=52283 RepID=A0A132AHM9_SARSC  ali  29  59...NRFSRRTKNCGEISNRLIGETVQLFGWIEFQR-YGR--FVLLRDAYGKVQIFFP------SKDLQTRCKNCHLESVIRIKGVVCKRPINEEMPNGVEILAEELDVLGEAK 163
585 5.000e-25UniRef50_D1J7X5 Aspartate--tRNA ligase n=22 Tax=Bacteria TaxID=2 RepID=D1J7X5_MYCHP  ali  21  7..........NYCGTLCINDLNKEVELCGWIANKRKFKQQVFIDLRDSSGVVQLIFQNVSDPL----------LTKESCIYVKGTVQKREVNPALKTGIEVIVSDYKIFNSAK 101
586 5.000e-25UniRef50_A0A136KRG0 Asparagine--tRNA ligase n=3 Tax=cellular organisms TaxID=131567 RepID=A0A136KRG0_9CHLR  ali  24  11.................SNYVGQDIILKGWVYNRTDKGKLAFLLVRDGSGFVQCV--AFKGDLQPETFDMITRLPQESSVIITGSVREDKRAPGIPGGYEVGIKDLQVVQAA. 103
587 5.000e-25UniRef50_A0A124G0G7 Aspartate--tRNA(Asp/Asn) ligase n=1 Tax=candidate division TA06 bacterium 34_109 TaxID=1635277 RepID=A0A124G0G7_9BACT  ali  27  7........RSTMCGYVDLEFLGKEINLVGWIKRVRDHGNIVFIDLGDRSGIVQVFTDRK------ELMPLVKGLRSEDVVQIKGVVKKRPVNSDMKTGIEIDLKEVKIMNRSE 109
588 5.000e-25UniRef50_A0A2G8KEV3 Putative aspartate--tRNA ligase, mitochondrial n=1 Tax=Stichopus japonicus TaxID=307972 RepID=A0A2G8KEV3_STIJA  ali  17  36......SWRTHTCGELRAADEGKAVTLCGWLQHKR----FDFLVLRDSHGVTQAVLPEDKVTRGKLSHR-LSSAHLESVVKVKGHVQKRPDNTNADRDVEVVVEDLKFLT... 138
589 5.000e-25UniRef50_A0A0G0WVZ6 Aspartate--tRNA ligase n=12 Tax=root TaxID=1 RepID=A0A0G0WVZ6_9BACT  ali  33  2.......ERTPSLDTLNK--VGQEVRLKGWVRLVRDHGKVMFVDIRDYSGVVQVVFVA--GMLSDEQVALIKGLHGEDVVEIIGTAQQRKENADMPTGVEVFGKELTVLQKA. 106
590 5.000e-25UniRef50_O07683 Aspartate--tRNA(Asp/Asn) ligase n=30 Tax=Archaea TaxID=2157 RepID=SYDND_HALSA  ali  34  3.......ERT-YIEDVTPDDDGEDTTIAGHVHELRDLGGILFVIVRDATGRLQVVA---KEDDTPDLFETAEGLSSEDVVQVTGTLEASDQAP---GGVELAPTELTVVSEA. 100
591 6.000e-25UniRef50_A0A257AFH6 Asparagine--tRNA ligase n=1 Tax=Candidatus Bathyarchaeota archaeon ex4484_205 TaxID=2012510 RepID=A0A257AFH6_9ARCH  ali  26  6.........THTIKDLWSLEEGTEVSLYGWVRNKREHGDLIFIDLRDGTGIIQV--SAKRENVPN--FEKVKTIGREYAIFVSGKVVNDRRAPR---GREIRAGSIEIVAKSE 102
592 6.000e-25UniRef50_A0A0G7ZN04 Aspartate--tRNA ligase n=2 Tax=Candidatus Hepatoplasma crinochetorum TaxID=295596 RepID=A0A0G7ZN04_9MOLU  ali  23  7...............LTEKSIDKKVKLSGWVAKIRKLGDLIFLDLRNSEKIIQIVITNQNQKI----YQIAKKLTKEDVILVKGIIKKRKINKNLSTGIELIASDLELISKAK 102
593 6.000e-25UniRef50_A0A1G9T0I7 Aspartate--tRNA(Asp/Asn) ligase n=2 Tax=Halobacteria TaxID=183963 RepID=A0A1G9T0I7_9EURY  ali  29  13.....................GDHVTVAGWVHEIRDLGGIAFLILRDKTGKIQIKF--EKDEMDDDLVEAGLDAARESVVSVTGTV---DEEPRAPTGVEVTPDGFEVIAPA. 98
594 7.000e-25UniRef50_A0A0R3SAE1 Uncharacterized protein n=3 Tax=Cyclophyllidea TaxID=6201 RepID=A0A0R3SAE1_HYMDI  ali  21  39........RTHTCGELRESDAGKVVTLCGWLYNTRVSS--SFLLIKDAYGITQIILDPALRNGLP---------PSDSVVKVEGVVRTRPENKSMGTGIEVKAAKIEILNSA. 135
595 7.000e-25UniRef50_K2FP50 Asparagine--tRNA ligase n=50 Tax=cellular organisms TaxID=131567 RepID=K2FP50_9BACI  ali  21  12...................HLNEEVTIGAWIHNKRSSGKIAFLQLRDGTGFIQGVVG--KNDLGEDKFNKAKTLSQETSLYVTGTVVEDKRSPL---GFELQISDFSIIQEAE 100
596 8.000e-25UniRef50_A0A1S8VWQ2 Asparagine-tRNA ligase n=4 Tax=Eukaryota TaxID=2759 RepID=A0A1S8VWQ2_9FUNG  ali  26  98...........HIRELT-SHWGARVKISGWVHRLRVQGKIMFIVLRDGSGYIQCVLTGKQCHTFDAL-----TLTVESTVTLYGIIQAVPEGKLAPGGCELICDYWTLLGKA. 193
597 8.000e-25UniRef50_A0A059LPQ5 Class II (D, K and N) tRNA synthetase n=1 Tax=Helicosporidium sp. ATCC 50920 TaxID=1291522 RepID=A0A059LPQ5_9CHLO  ali  26  11.............GGLRASHAEQQVSLCGWVSSVRDMGDLVFAVIRDGSGFVQVAASR---STPEPLLTLVASLRPESAVRVRGTVRMRSPNPKMRTGVEVWVEGLDVLNRA. 108
598 9.000e-25UniRef50_D8M8I8 Aspartyl-tRNA synthetase n=2 Tax=Blastocystis TaxID=12967 RepID=D8M8I8_BLAHO  ali  21  37....PSPLRSCSCNSLTKKNINEFVTLSGWVDSVRIMKDSVFIILRDGEGQTQTLFDCDKEVES-----LLKKIPMESVVCVEGNVIARPINARMNTGIEVKGKKLYLLNQA. 143
599 1.000e-24UniRef50_A0A1L8ZBW8 Aspartate--tRNA ligase (Fragment) n=1 Tax=Borreliella bissettii TaxID=64897 RepID=A0A1L8ZBW8_BORBI  ali  26  7............CNELNEKLINKKVEVNAWVKKIRHHGKFIFLNIRDRYEKVQVLVNEEY------LLKIAEKIKLEYCIKIQGLLIKRPINANMKTGFEILAKNIEIISKC. 104
600 1.000e-24UniRef50_UPI000C76B885 aspartate--tRNA ligase, mitochondrial-like n=1 Tax=Eurytemora affinis TaxID=88015 RepID=UPI000C76B885  ali  22  79....SFSSRSHYCGEIGEQNVGEIVTISGWVQCSRM---DRFLILRDRTGLCQIFIPKSSS------FSDLIKVRNESVVTLSGVVRLRPENPDMNTGIEVEVQKVLNVSPAK 182
601 1.000e-24UniRef50_A0A2A9NF21 Uncharacterized protein n=1 Tax=Amanita thiersii Skay4041 TaxID=703135 RepID=A0A2A9NF21_9AGAR  ali  20  124.................SDHVSKRVRVFGWVHRLRDQKGIIFIVLRDGTGFLQAVLSGRTAQTYEAL-----TLNLESSVELVGTLQPVPEGKNAPGGFELVVDFWRVLG... 211
602 1.000e-24UniRef50_D4MVD5 Aspartate--tRNA(Asp/Asn) ligase n=305 Tax=root TaxID=1 RepID=D4MVD5_ANAHA  ali  22  1.MSDMY--RTRTMDQISEGDIGAQLKIAGWVENIRDHGGVSFIDLRDMYGVMQVVLRDTS---------LLDHVRKEECLSVEGVIQHRDENPKIPTGIELEAHKIDILGK.. 103
603 1.000e-24UniRef50_A0A0F2JHG5 Lysine--tRNA ligase n=3 Tax=Bacteria TaxID=2 RepID=A0A0F2JHG5_9FIRM  ali  26  31.......ERTHKALDILDELEGQEVSIAGRIMSKRDQGKVIFVHVQDFSERIQAYIRAD--ELGAAMFELVAKFDVGDIIGVEGKVFRTKR-----GEISIHASKVLLLSKA. 131
604 1.000e-24UniRef50_A0A091CAD7 Aspartyl-tRNA synthetase n=3 Tax=Terrabacteria group TaxID=1783272 RepID=A0A091CAD7_9ENTE  ali  23  1.MGN----RTVYCGLVSKEVLEQTVTLQGWVQKRRDLGGVIFIDLRDREGIVQVVFNPK---NSQEAWEIADTCRSEYVLEVTGVVKKT........................ 81
605 1.000e-24UniRef50_A0A0G0XA06 Aspartyl-tRNA synthetase n=1 Tax=candidate division WWE3 bacterium GW2011_GWA1_41_8 TaxID=1619103 RepID=A0A0G0XA06_9BACT  ali  33  2.......ERTPSLDTLNK--VGQEVRLKGWVRLVRDHGKVMFVDIRDYSGVVQVVFVA--GMLSDEQVALIKGLHGEDVVEIIGTAQQRKENADMPTGVEVFGKELTVLQKA. 106
606 1.000e-24UniRef50_Q979Y4 Asparagine--tRNA ligase n=14 Tax=root TaxID=1 RepID=SYN_THEVO  ali  20  9................SEAHVGSEVSVRGWVYRIRSSGGVTFIVIRDSTGIVQC--TAKKNELTPEQYDEISSLGIESSLSLIGTMKKEPR---SPTGYEISIHKFTVYQK.. 98
607 1.000e-24UniRef50_A0A261C678 Uncharacterized protein (Fragment) n=1 Tax=Caenorhabditis latens TaxID=1503980 RepID=A0A261C678_9PELO  ali  17  113............IGE-SVKHREQRVTIKAWVHRIRRQGKLMFLVLRDGYGFIQCVLNDKLCQSYDAV-----TLSTESSIQVYGVIKALPDGKDAPDGHELTVDYWELIGAA. 207
608 2.000e-24UniRef50_P38707 Asparagine--tRNA ligase, cytoplasmic n=144 Tax=Eukaryota TaxID=2759 RepID=SYNC_YEAST  ali  21  126..................SKVGQRVKVSGWIHRLRSNKKVIFVVLRDGSGFIQCVLSGDL-----ALAQQTLDLTLESTVTLYGTIVKLPEGKTAPGGVELNVDYYEVVGLA. 214
609 2.000e-24UniRef50_A0A1V4JH70 Asparagine--tRNA ligase, cytoplasmic n=1 Tax=Patagioenas fasciata monilis TaxID=372326 RepID=A0A1V4JH70_PATFA  ali  20  128............IGAL-EAYRGQRVKIFGWIHRLRRQGKLMFIVLRDGTGFLQCVLSDELCQCYNGLV-----LSTESSVAVYGTLNLVPEGKQAPGGHELSCDYWELLGLA. 222
610 2.000e-24UniRef50_A0A1W1X8Y2 Aspartate--tRNA ligase n=3 Tax=Mycoplasma agassizii TaxID=33922 RepID=A0A1W1X8Y2_9MOLU  ali  27  7.............GEINESFLEKEIEVYGWVQQHRNFGKLTFIDLRDESGIIQIVVN-----------DLEQKISNESVIKVTGILKNRKVNEKIKTGFEIIASELEVLNYAQ 97
611 2.000e-24UniRef50_A0A0X3PKB9 Uncharacterized protein n=1 Tax=Schistocephalus solidus TaxID=70667 RepID=A0A0X3PKB9_SCHSO  ali  21  39......SQRTHTCGELRKRDVGKFVTLCGWLYSTRLS--CAFLLIKDAYGITQVLVDKSFRKRVP---------PSDSVIKVEGNVRLRPENPAMPTGIEVQANNIEVLGP.. 136
612 2.000e-24UniRef50_A0A2R6LRW2 Aspartate--tRNA(Asn) ligase (Fragment) n=1 Tax=Halobacteriales archaeon SW_7_68_16 TaxID=1919204 RepID=A0A2R6LRW2_9EURY  ali  35  4........RTH-AADARA---GETATVAGWIHEVRDLGGIAFLIVRDATGMIQV--KVEKGELDDDLVERALALHRESVVRVTGDVEEEDRAP---TGVEIVPEAIEVVAEA. 98
613 2.000e-24UniRef50_A0A2C9LQD8 Uncharacterized protein n=3 Tax=root TaxID=1 RepID=A0A2C9LQD8_BIOGL  ali  27  64........................VVISGWIHSKRDHGKLLFVDLRDHYGIVQVVIEHER-----DFFEKLSCLNNESVILVRGKVVLRSENDGIFTGIEIIANEVEILSLS. 150
614 2.000e-24UniRef50_H3ANZ0 Aspartyl-tRNA synthetase n=79 Tax=Opisthokonta TaxID=33154 RepID=H3ANZ0_LATCH  ali  17  76............IQQLTKEKADQVVWVRARVHTSRAKGKQCFLVLRQQQFNIQALVAV-GDRASKQMVKFAANINKESIVDVEGIVRKVKIESCSQQDVELHVEKIYVVSSAE 177
615 2.000e-24UniRef50_A0A0G0BB34 Aspartate--tRNA(Asp/Asn) ligase n=10 Tax=root TaxID=1 RepID=A0A0G0BB34_9BACT  ali  36  9................TVNKVGETVELYGWVDTKRDHKKIVFIDLRDRTGTVQVV-----------GGEEFKALSEEDVVYIKGLVKARPINSKIKTGIEIEVKELKILNKTK 98
616 2.000e-24UniRef50_A8QD39 Uncharacterized protein n=5 Tax=Malassezia TaxID=55193 RepID=A8QD39_MALGO  ali  27  63.......PRTHACSQVGSNDVNERVVLAGWVLAPRKISRLAFVPLQDASGTVQLVLH------DPALVDAFAQVPVESVVSVQGAVQARAENPAMRTGVEVRVESWTLLNAA. 166
617 2.000e-24UniRef50_A0A0B3ALX5 Aspartate--tRNA(Asp/Asn) ligase n=13 Tax=Archaea TaxID=2157 RepID=A0A0B3ALX5_ARCGX  ali  34  3........RTHFAKDIEPG----TVKVAGWVHEKRALGGILFVILRDSTGLMQII--AKKDKTDAQMIRTLEGLSRESVVSIEGKAV---ESKNAPNGVEVIPGIIEILAEAE 98
618 2.000e-24UniRef50_A0A0P6C945 Asparagine--tRNA ligase, cytoplasmic-like protein (Fragment) n=1 Tax=Daphnia magna TaxID=35525 RepID=A0A0P6C945_9CRUS  ali  19  17.................EGYRGQRVKVFGWVHRLRRQGKLMFLVLRDGTGYLQCVLSDVLCQCYNGVV-----LSTESSVAVYGTLNLTPKGKQAPGGHELSCDFWELVGLA. 107
619 2.000e-24UniRef50_A0A2U1IVF2 Uncharacterized protein n=3 Tax=Harpellales TaxID=61421 RepID=A0A2U1IVF2_9FUNG  ali  22  71........RSHSCGSLFKNDIGETVHLCGWVQHIRVSSSLAFIKLRDGFGTIQLVFNKADLEKDSEIFEALDKITPESVIRVSGKVHFQPQKDSTKNGIEVRGHQIQILNIAK 194
620 2.000e-24UniRef50_UPI000B7B7405 aspartate--tRNA ligase, chloroplastic/mitochondrial-like n=1 Tax=Prunus avium TaxID=42229 RepID=UPI000B7B7405  ali  24  198.....WVTRTGFCGELSTADVGKRVTLCGWVALHRVHGGLTFLNLRDHTGSVQVTTLPD---TFPNAHSAINNLRLEYVVAVEGVVRL----------FEILVK......... 283
621 3.000e-24UniRef50_C1M2T8 Aspartyl-tRNA synthetase, putative n=1 Tax=Schistosoma mansoni TaxID=6183 RepID=C1M2T8_SCHMA  ali  22  12.....FVYKSHACGELSTQHINSTVTVCGWPGHCRLSSR--FLVLRDDRGSIQIYCDKNSLQIP--------QFNSESVLIVTGKVQARPENKRMPTGIEIVAESIEI..... 108
622 3.000e-24UniRef50_A0A2D6ABG3 Uncharacterized protein (Fragment) n=1 Tax=Euryarchaeota archaeon TaxID=2026739 RepID=A0A2D6ABG3_9EURY  ali  21  18.......YRTHTLGQIGAELVGKEVKVAGFLEANRGKGAICFVDLRDGTGSTQIFL--KADNVGEEVLDMVQRMTRESTLQXTGXVSE-KRPPKVKDGFEVVASAVTVISRAE 130
623 3.000e-24UniRef50_A0A2V7RWM6 Asparagine--tRNA ligase n=1 Tax=Gemmatimonadetes bacterium TaxID=2026742 RepID=A0A2V7RWM6_9BACT  ali  27  140............IAELR-DYVGSTVTLHGWITHLRSSGKVAFAVIRDGTGIAQAVFV--KTALPAEVWQRFASLTLETSVMVRGEVRADARAP---GGFEISVADLEIIGPS. 233
624 3.000e-24UniRef50_A0A0R3WHU4 Uncharacterized protein n=1 Tax=Hydatigena taeniaeformis TaxID=6205 RepID=A0A0R3WHU4_HYDTA  ali  23  15........RTHTCGELRESDIGKAVTLCGWLYNTRVSS--SFLLIKDAYGITQIV-----------------QLRLGSVIRVHGIVQSRPINKSMQTGIEVRASKIETLNRA. 108
625 3.000e-24UniRef50_A0A2H5XNM2 Aspartate--tRNA(Asp/Asn) ligase n=4 Tax=Bacteria TaxID=2 RepID=A0A2H5XNM2_9BACT  ali  28  33.........THSCGQVSEELIGKKIKLAGWVESIRDHGGVKFLDLVDMSGKVQVVIRPS--NIPSEKLPELDEIGDFWVLKIEGKVERRPENPNISTGVEIIAHNFDILSKSE 142
626 3.000e-24UniRef50_A0A256YL71 Aspartate--tRNA ligase n=5 Tax=Archaea TaxID=2157 RepID=A0A256YL71_9ARCH  ali  34  7.............KEVSKE-AGKTIMLKGWVHELRDLAKIKFILLRDSSGIIQCVVKDKK------LFKEFAKLTLETVVQLEGKVRKAKKSEQALKNVEVEVSKIKILNKAE 100
627 3.000e-24UniRef50_A0A0G0WKP0 Aspartyl-tRNA synthetase (Fragment) n=1 Tax=Candidatus Daviesbacteria bacterium GW2011_GWB1_41_5 TaxID=1618429 RepID=A0A0G0WKP0_9  ali  28  11..................SKVGEAVKICGFVTTRRDHGKIVFLDISDRSGVLQVVANG----------ELAGSLRPQDVVCITGKVSKRPENKNLVTGIELQAEEIEVLSKAE 99
628 3.000e-24UniRef50_X1DHR7 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X1DHR7_9ZZZZ  ali  26  5.........TNTIADL-KDNVDKEVTLAGWLYQARSSGKIQFLIIRDGTGLCQCIV--EKGEIQDELFGELKHLGQESSLTVTGIVRADER---SVGGFELAVTDARIISPA. 102
629 3.000e-24UniRef50_Q5ZJQ6 Aspartate--tRNA ligase, cytoplasmic n=119 Tax=Eukaryota TaxID=2759 RepID=Q5ZJQ6_CHICK  ali  17  50............IKDLTEEKADEVVWVRGRVHTSRAKGKQCFLVLRQQQFNIQALVAV-GQHASKQMVKFAANINKESIVDVEGVVRKQKIGGCTQQDVELHVQRIYVISLAE 151
630 3.000e-24UniRef50_U1P727 Aspartyl/asparaginyl-tRNA synthetase (Fragment) n=3 Tax=Halobacteria TaxID=183963 RepID=U1P727_9EURY  ali  31  13.....................GESVTVAGWVHEIRDLGGIAFLILRDTTGKIQIKF--EKDEMDDDLVETGLNVARESVISATGAVEEEPRAP---TGVEITPDAVEVVAEA. 98
631 3.000e-24UniRef50_A0A0N5DKD6 Uncharacterized protein n=1 Tax=Trichuris muris TaxID=70415 RepID=A0A0N5DKD6_TRIMR  ali  17  41.............NQLCSNCAGKKVWLRGRLHTSRAKGKTCFVILRQQHHTVQVVMFV-GDVVSKDMLKFASSVSRESIIDVYGEVKADPVVSCSVQDVEVHVEKFFVVSTA. 140
632 3.000e-24UniRef50_I4YAX3 Aspartyl-tRNA synthetase n=2 Tax=Wallemia TaxID=148959 RepID=I4YAX3_WALMC  ali  22  8........RTHHCNQLRVSNAGESVALAGWVQTRRASNKLSFVPLKDFTGTTQLVVR------SSSALEGLDKLPSQSVVLIEGQVNKRQINKSLDTGIEVDVKSYTLLNQA. 110
633 3.000e-24UniRef50_A0A0S8B0A8 Asparagine--tRNA ligase (Fragment) n=3 Tax=Bacteria TaxID=2 RepID=A0A0S8B0A8_9BACT  ali  26  7............IADL-PGHIGDEVSVRGWVMTTRSSGKIAFMVLRDGTGYLQCVLV--RSETDDDAWESFRRLSQEMSVTVTGAVRADAR---SPGGVELGVRSVEVIGES. 100
634 3.000e-24UniRef50_A0A1D2RBK5 Aspartate--tRNA(Asn) ligase (Fragment) n=2 Tax=unclassified Candidatus Altiarchaeales TaxID=1849260 RepID=A0A1D2RBK5_9EURY  ali  36  2........RTQYSNEITAELEGKEVVLSGWAHEIRDLGKLKFLILRDQEGF--IQVCAKEGSSPHEVLAAIKAISKESVVRVKGKVKVSPQAP---GGAEIVPDSINIISKS. 100
635 4.000e-24UniRef50_Q8D388 Aspartate--tRNA ligase n=2 Tax=Enterobacterales TaxID=91347 RepID=Q8D388_WIGBR  ali  21  2........RNIYCYQINKSHVGKIVTLCGWVENIRDCGKLLFIDFRDHTGIIQICFECFDKNIH---INESKKLKNESCVQITGIVKIKKIKSLSPQEVEVKATNLNIINIS. 104
636 4.000e-24UniRef50_F2TZY5 Uncharacterized protein n=1 Tax=Salpingoeca rosetta (strain ATCC 50818 / BSB-021) TaxID=946362 RepID=F2TZY5_SALR5  ali  25  93........RTHTCGDMTLSLADTSVSLTGWMASKRIIGDLVFAVLRDHYGAVQLKL------TGEDAIDRVTNLPLESTIQVQGRVTARPVNPKMASGVEVLVSSLAVLGTA. 195
637 4.000e-24UniRef50_J7S2B7 Uncharacterized protein n=16 Tax=Fungi TaxID=4751 RepID=J7S2B7_KAZNA  ali  22  130..................SMIGERVKISGWIHRFRSNKKVVFVVLRDGSGFIQCVLTGDL-----ALAKQTVELTLESTVTLYGTVTKLPEGKSAPGGVELVVDYYEVVGLA. 218
638 4.000e-24UniRef50_A0A0B2VZ55 Aspartate--tRNA ligase, mitochondrial n=4 Tax=Ascaridoidea TaxID=33256 RepID=A0A0B2VZ55_TOXCA  ali  20  24..TNDYTLRTHTCGELRIQHKDKSATIYGWLAFKRM---DRFLVLRDAYGSVQVRIPDSRT----DLIKAAAAANYESVLKVTGVIRGTNRNPSMKTGVEVVAEELQVVNNS. 129
639 4.000e-24UniRef50_A0A2E1WHQ0 Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase GatCAB subunit C (Fragment) n=1 Tax=Candidatus Marinimicrobia bacterium TaxID=202676  ali  30  3.......KRTHTCGELNSXSVDKSIILNGWVNTIRLHGQVVFVDLRDRYGKTQIVFNAEDYIGD---FDVVKKLSMEDVISVIGKVQ.......................... 79
640 4.000e-24UniRef50_G4TC65 Related to aspartate--tRNA ligase, mitochondrial n=2 Tax=Serendipita TaxID=358905 RepID=G4TC65_SERID  ali  20  27....SYRPRTHTCGQLDESLINQKVDLCGWIVVKRNVKGLTFFVLQDVHGQVQLVSRQEQSQNSDAAGAILRELPLQSVVQVTGTIRPSPGKIDKNGSIEVVVERVQVLNPA. 149
641 4.000e-24UniRef50_B3RP59 Uncharacterized protein (Fragment) n=4 Tax=Metazoa TaxID=33208 RepID=B3RP59_TRIAD  ali  25  3....KYCSRSHTCGQLRKEDAGQEVKLYGWVRHIRRFNGPFFLTLHDAYGSTQLFVKK-----TSPVYNILEKLSVESVIGITGTVNARPENKDMPTG-EIE........... 98
642 4.000e-24UniRef50_A0A0G1SJZ6 Aspartyl-tRNA synthetase (Fragment) n=2 Tax=Microgenomates group TaxID=1794810 RepID=A0A0G1SJZ6_9BACT  ali  27  4.......KRT-LVKE-TTEKVGQKVLLQGWVDSIRDHGKIVFLDLRDRTGIVQCV------------GQDLPKVTPESVVEIKGSVSKRPVNPNLETGVEVKIENLEVISLA. 98
643 4.000e-24UniRef50_A0A2E3DW20 Asparagine--tRNA ligase n=7 Tax=Bacteria TaxID=2 RepID=A0A2E3DW20_9BACT  ali  28  2........KTITINDLG-SFIGKTVKLKGWVYNTRSIGKIWFLIFRDGTGLLQGVVV--KGEATDDTFALEQKLNKEDSVLITGMVKKEPR---SIGGFEIGISEVEVIN... 97
644 5.000e-24UniRef50_Q9PQK5 Aspartate--tRNA ligase n=16 Tax=Ureaplasma TaxID=2129 RepID=SYD_UREPA  ali  27  4...........YCGYIGEEHLEKNVILNGWVKKVRKMGNLVFVDLKDRFGIVQIFATK-----SDGVFNELTQLSREDVINVEGLVRKNPNNDLKTGRFEIHVKKILIYSKAK 102
645 5.000e-24UniRef50_A0A210Q1C6 Aspartate--tRNA ligase, mitochondrial n=4 Tax=Bilateria TaxID=33213 RepID=A0A210Q1C6_MIZYE  ali  31  85....SFTDRSHLCGCLTTADVGQSVKLCGWVDRV---SKL-FLKLYDWTGRVQITV-------PPDMVKMVMSLDRESVVEVKGIVMMRPDSQKRAGEVEILPSEIKVLN... 183
646 5.000e-24UniRef50_A0A1G6JIN1 Asparagine--tRNA ligase n=14 Tax=Bacteria TaxID=2 RepID=A0A1G6JIN1_9BACT  ali  21  1.MSSSWVY----IKDL-KDYLDKKIILKGWMWNKRSSGKIAFLQIRDGYGFVQVI--AEKSVLGEDFFNEIKKLKNESSLIIEGTVKKDDR---SPVGVEILAEKIEII.... 98
647 5.000e-24UniRef50_A0A2T2QZB4 Aspartate--tRNA(Asn) ligase n=1 Tax=Parcubacteria group bacterium SW_4_49_11 TaxID=1919225 RepID=A0A2T2QZB4_9BACT  ali  21  12.................SEHIGEQVTLKGWAQTIRDQGKIAFVVLRDVTDTVQLVITKNDDT---DVLETVQNLSTESVIEVTGTAQSSDQAP---GGREVKMDSLTVLSAA. 100
648 5.000e-24UniRef50_A0A074TRH0 Aspartate-tRNA ligase n=18 Tax=Alveolata TaxID=33630 RepID=A0A074TRH0_HAMHA  ali  23  332..................NHVGQTVWIRGRIQESRGKGSVGFLMLRERQATVQGVLDAKRGN-SKDMIKWTMSLPLESVVDIQGTVVEPEVEIQSTSGVELLVTKIFCVSKA. 426
649 5.000e-24UniRef50_R9T6A7 Aspartate--tRNA(Asp) ligase n=17 Tax=Euryarchaeota TaxID=28890 RepID=R9T6A7_METII  ali  29  7.........TRNSKTLSPEDAEKQVKVKGWAQEIRNLGGISFLILRDRYGTVQV--TAPKKKVAPEIMDVLTSLSRESVVEVCGTAKASNQAK---GGAEVIPESITVLSSA. 104
650 5.000e-24UniRef50_A0A0V1EL19 Aspartate--tRNA ligase, mitochondrial (Fragment) n=19 Tax=Trichinellida TaxID=6329 RepID=A0A0V1EL19_TRIPS  ali  20  66...NEFTCRTHTCGELTLDNVGQRVILCGWLQRKRLDK---FLVLRDAYGSVQALLERGQ-------FEQLRSVPLESVLRVEGTVVARP....................... 142
651 5.000e-24UniRef50_A0A2P6VY54 Aspartate--tRNA(Asp/Asn) ligase n=1 Tax=Thermoplasmatales archaeon SW_10_69_26 TaxID=1919232 RepID=A0A2P6VY54_9EURY  ali  30  1.MSIPLSER-VAIPELGPDDDGREVVVAGWIQEVRDLGGIAFVELRQGTETGQIVL--PKGKVDEDTVDTLVEANRESVAAIAGTVQESDEAP---GGFEVLPDEAELLNEAQ 106
652 5.000e-24UniRef50_UPI0008FA70E4 LOW QUALITY PROTEIN: asparagine--tRNA ligase, cytoplasmic n=1 Tax=Cyprinus carpio TaxID=7962 RepID=UPI0008FA70E4  ali  22  76.......PKTVKIGKL-EALREQRVKVFGWVHRLRRQGKLLFIVLRDGTGFLQCVLTDKLCQCYNGLV-----LSTESTVALYGTVKPVPEGKQAPGGHELHCDFWELIGLA. 175
653 5.000e-24UniRef50_A0A2V5P8R9 Uncharacterized protein n=1 Tax=Verrucomicrobia bacterium TaxID=2026799 RepID=A0A2V5P8R9_9BACT  ali  21  38...NPYPQRTHYVKPILEKFDGQQVTVAGRLMSWRKQGALAFGHVQDQTGRIQLFLRRQLVQPTDAAYNELNLLDLGDFIEATGKVVKTER-----GEISVLVEHLRLLTKA. 152
654 5.000e-24UniRef50_A0A2E3RHM5 Aspartate--tRNA ligase (Fragment) n=1 Tax=Planctomycetaceae bacterium TaxID=2026779 RepID=A0A2E3RHM5_9PLAN  ali  27  3........RTHTCGELSADDLSADVALCGWVDTYRDHGGGLFIDLRDRFGLTQVVFGPD---TAEGVMQLARKLRAETVVRIEG............................. 75
655 5.000e-24UniRef50_D9TTC6 Asparagine--tRNA ligase n=26 Tax=Bacteria TaxID=2 RepID=D9TTC6_THETC  ali  22  12.................KDFVGEEVTIKGWLYNKRSSGKIKFLIIRDGSGFVQGVVV--KNEVAEDVFELCDKLTQESSITVTGVVRKDDRSPY---GYELTISSIKLIQMA. 101
656 5.000e-24UniRef50_Q19722 Asparagine--tRNA ligase, cytoplasmic n=412 Tax=Eukaryota TaxID=2759 RepID=SYNC_CAEEL  ali  21  113............IGE-SVQHRDQRVSIKAWVHRLRRQGKLMFLVLRDGYGFLQCVLNDKLCQSYDAV-----TLSTETSVQVYGIIKALPDGKSAPDGHELTVDYWEVIGKA. 207
657 6.000e-24UniRef50_N6U1X7 Uncharacterized protein (Fragment) n=4 Tax=Bilateria TaxID=33213 RepID=N6U1X7_DENPD  ali  20  65......PKRAFTAKDLSKALTGQQVWIRGRLHTSRAKGKQCFIVLRQREFSVQVLVNVS-EAVSKAMVKFASNISKESIIDVQAKVAQVPVAGCSQSEVELVASEVWVVSAA. 172
658 6.000e-24UniRef50_A0A075FVG1 Aspartyl-tRNA synthetase (DARS, aspS) n=4 Tax=Thaumarchaeota TaxID=651137 RepID=A0A075FVG1_9ARCH  ali  27  9......WRRTHYSKELDSSLKESDVTIMGWVSSVRSHGNITFLTIVDKMGEVQIV--AKKGSSPDDLIENLSKLKEHSSVGLIGTVKTSDKAPN---GVEIIPKDLRIFSSVE 110
659 6.000e-24UniRef50_K7G0C3 Asparaginyl-tRNA synthetase n=37 Tax=Opisthokonta TaxID=33154 RepID=K7G0C3_PELSI  ali  21  118............CAKIREAHRGQRVKVFGWVHRLRRQGKLMFLVLRDGTGFLQCVLSDELCQCYNGVI-----LSTESSVAMYGTLNPVPEGKQAPGGHELSCDYWELIGLA. 215
660 7.000e-24UniRef50_A0A183W2D2 Uncharacterized protein n=1 Tax=Trichobilharzia regenti TaxID=157069 RepID=A0A183W2D2_TRIRE  ali  22  81............IREL-QTLYDKRVHVYGWVHRIRRQSKLMFIILRDGTGFLQCVFANNLCLTQDAV-----TLSPESTIEIYGTIKQLPAGKSAPGGIELLADYWSVIGKA. 175
661 7.000e-24UniRef50_A0A101WVL8 Aspartate--tRNA(Asp/Asn) ligase (Fragment) n=1 Tax=Pyrobaculum sp. JCHS_4 TaxID=1714260 RepID=A0A101WVL8_9CREN  ali  64  1....MYPKKTHWTSEITPELHGKEVVVAGWVWELRDIGKVKFLLLRDREGFVQVTL--KAGRTPDHVFKAFADLGREDVVVVRGVVEASRIAKR---GVEVFPLDIWVLNKAK 104
662 7.000e-24UniRef50_M7BEQ6 Putative phospholipid-transporting ATPase IC n=1 Tax=Chelonia mydas TaxID=8469 RepID=M7BEQ6_CHEMY  ali  20 1289.................EAHRGQRVKVFGWVHRLRRQGKLMFLVLRDGTGFLQCVLSDELCQCYNGVI-----LSTESSVAVYGTLNLVPEGKQAPGGHELSCDYWELIGLA. 1379
663 8.000e-24UniRef50_A0A0X3NYJ9 Aspartate--tRNA ligase n=2 Tax=Schistocephalus solidus TaxID=70667 RepID=A0A0X3NYJ9_SCHSO  ali  21  39......SQRTHTCGELRKRDVGKFVTLCGWLYSTRLS--CAFLLIKDAYGITQVLVDKSFRKRVP---------PSDSVIKVEGNVRLRPENPAMPTGIEVQANNIEVLGP.. 136
664 8.000e-24UniRef50_A0A0P6A112 Asparagine--tRNA ligase, cytoplasmic n=6 Tax=Bilateria TaxID=33213 RepID=A0A0P6A112_9CRUS  ali  22  137.....................GQRVKVFGWVHRLRRQGKLMFITLRDGTGLLQCVLSDQLCQTFDAV-----TLSTESSVQLFGTLKLVPEGKSAPGGHELNVDYWKLIGSA. 223
665 8.000e-24UniRef50_A0A218NM48 Aspartate--tRNA(Asp) ligase n=8 Tax=root TaxID=1 RepID=A0A218NM48_9ARCH  ali  26  3........RSNYVSEITQEMDNQKVTLAGWVHEVRKLKNVTFLLLRDITGIIQV--TGKAGTCDKNIIESM-DIPKESVISVEGIV---KINPEAKIGFEIIPTKITNLNP.. 99
666 8.000e-24UniRef50_A0A2H0VFN2 Aspartate--tRNA(Asp/Asn) ligase n=2 Tax=Bacteria TaxID=2 RepID=A0A2H0VFN2_9BACT  ali  32  13....................VGKKVRIAGWVQTIRDQGAIKFLLIRDDSGVVQVVV---KGSKSKTVFDSISDLTTESVVEILGLV---KEEKQAPGGLEMAATSLSVLSKA. 98
667 9.000e-24UniRef50_A0A023FZF5 Putative aspartyl-trna synthetase (Fragment) n=11 Tax=Bilateria TaxID=33213 RepID=A0A023FZF5_9ACAR  ali  19  109.............KDLAPPLSGQNVWLRGRLHTSRSKGKQCFFVLRQQQYTVQCLVAVS-EKVSKAMVKFCALVNKESIVDVHGHVQTSPQKVEGCTEVELHVEEFFVISSAE 209
668 9.000e-24UniRef50_X7XYC4 OB-fold nucleic acid binding domain protein n=4 Tax=Bacteria TaxID=2 RepID=X7XYC4_MYCKA  ali  25  2.........................TLAGWVARRRDHGGVIFIDLRDASGVAQVVFR------DPQVLAQAHRLRAEFCVTVCGVVELRPENPEIATGVEVNATALTVLGEC. 86
669 9.000e-24UniRef50_A0A2D6PAY1 Aspartate--tRNA(Asp/Asn) ligase n=37 Tax=root TaxID=1 RepID=A0A2D6PAY1_9ARCH  ali  30  2.......ERT-YIKDAFEK---KQVMIEGFIHEIRDQSKIKFILIRDRTGIIQCIVKPE----NKKVFNKIAKIPRESVLKITGEVKKSKQAPN---GAEIIIKEYEILSEAK 96
670 9.000e-24UniRef50_A0A2P7VY77 Asparagine--tRNA ligase (Fragment) n=5 Tax=Bacteria TaxID=2 RepID=A0A2P7VY77_9BACL  ali  21  10..................QHVGQEVRLGCWLYNKRSSGKIQFLQLRDGSGFIQGVVV--KAEVAEEVWENASQLTQESSLYITGVVRADDRAP---SGYELTVTGVEIIQIAE 99
671 1.000e-23UniRef50_A0A2W4K6D0 Asparagine--tRNA ligase (Fragment) n=1 Tax=Firmicutes bacterium TaxID=1879010 RepID=A0A2W4K6D0_9FIRM  ali  28  15.........TVTIAAAG-QHVGQEVEMRGWVYNRRSSGRVRFLILRDGTGIMQCVVARDR--VGDEGLRTFEELAQESSCRVRGIVRADRRAP---GGFELEVTALEPLHIAE 112
672 1.000e-23UniRef50_R5T1K1 Aspartate--tRNA ligase n=26 Tax=Bacteria TaxID=2 RepID=R5T1K1_9CLOT  ali  22  10................TIKNVGEVVSLYGWVNKTRNLGGVIFIDLRDRSGIIQLAIKPD-----NKYYKQALEIKNEYVLKVEGAIIEREKNKNLNTGIEVDVTNLEILNTS. 102
673 1.000e-23UniRef50_Q9HKS7 Asparagine--tRNA ligase n=26 Tax=Archaea TaxID=2157 RepID=SYN_THEAC  ali  23  3...........SIAEVTKAYVGSKVSIRGWVYRIRSSGGVTFVVVRDSSGIIQC--TARKNELPEDVYDTISSLGIESSVEFHGTLKEDRR---SPSGYEIAVDSFRVYQK.. 98
674 1.000e-23UniRef50_A0A068WQ56 Asparaginyl tRNA synthetase, cytoplasmic n=1 Tax=Echinococcus granulosus TaxID=6210 RepID=A0A068WQ56_ECHGR  ali  22  132............IRDLGE-FVGKRVQVFGWAHRIRRQSKLMFIILRDGTGLLQCLLAGDLPRTADGL-----TLSTESSIFVKGVVSKVPAGQKAPGGIELQVDYWECIGKA. 226
675 1.000e-23UniRef50_A0A267GWT3 Uncharacterized protein (Fragment) n=2 Tax=Macrostomum lignano TaxID=282301 RepID=A0A267GWT3_9PLAT  ali  18  38........RSHACGQLSSSLAGQPATLCGWLARLRNRGQ--FALLRDRYGTVQVV------PANPAARAALRSAPLESTLQVSGLVQLRPENPSMPTGIELVADTVTVMGP.. 136
676 1.000e-23UniRef50_A0A1U9NQ19 Asparagine--tRNA ligase n=11 Tax=Bacteria TaxID=2 RepID=A0A1U9NQ19_9BACT  ali  20  7...........TISEL-KDHVGEEVSLQGWLYNSRSSGKLVFLILRDGTGLCQCIV--EKAEFAEEKFDELKRLGQESSLVVTGTCREEPR---SVGGYELSVTGAEVVCEA. 101
677 1.000e-23UniRef50_A0A2N2ETS1 Aspartate--tRNA(Asp/Asn) ligase n=5 Tax=unclassified Elusimicrobia TaxID=1797919 RepID=A0A2N2ETS1_9BACT  ali  25  9...............INTGYERREIELSGWIDSIRDHGGVMFADLRNRSGKIQLVFDAS--NKGGDYSGAVAALRAEFVVRVKGTVSKRPENKKIPTGVELKVMSFEILNEA. 107
678 1.000e-23UniRef50_A0A1B6ICY5 Uncharacterized protein (Fragment) n=2 Tax=Neoptera TaxID=33340 RepID=A0A1B6ICY5_9HEMI  ali  20  131.................KEHRGSRVKIYGWVHRLRKQGKLMFITLRDGTGFLQCVLNDVLVQTYEALV-----LSTESSVLLYGVLKEVPKGKSAPGGHELQVDYWELVGLA. 221
679 1.000e-23UniRef50_Q8DSG3 Aspartate--tRNA(Asp/Asn) ligase n=177 Tax=Streptococcaceae TaxID=1300 RepID=SYDND_STRMU  ali  23  5...........FIGNYGLEQVGQKVTAKGWVANIRNHGKLAFIELRDREGLLQVFVDSAVAD-----FDKLHDLHKESILAVTGEIVARDENPHIKSGVELRAETIEIIASSK 105
680 1.000e-23UniRef50_A0A2R7Y9A3 Asparagine--tRNA ligase n=1 Tax=Aigarchaeota archaeon NZ13_MG1 TaxID=1980982 RepID=A0A2R7Y9A3_9ARCH  ali  26  7.......RRLH-IAEAFCMPENEEVELFGWVRNKRVHGKLVFLELRDSTGTIQVTV--KHGLVDEGGFAEALDVTRESSVVVTGLTKKDPRAP---GGTEIQCSSFKVIGKS. 105
681 1.000e-23UniRef50_E7RHG1 Asparagine--tRNA ligase n=117 Tax=cellular organisms TaxID=131567 RepID=E7RHG1_9BACL  ali  22  5...........TIAEM-AKHNGETIKLGAWIANKRSSGKIAFLQLRDGSGFVQGVVV--KAEVGDDLFATAKGLTQETSVYVTGEVKEDER---SAFGYELAVTGIEVIHEAK 100
682 1.000e-23UniRef50_X1HEV8 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X1HEV8_9ZZZZ  ali  24  6............ISDIR-NYEGKEVEIRGWLYNRRSSGKIKFLIVRDGTSFIQATLI--KNEMDEKIFNKADNINYESSIKISGIVKEEKRVPL---GYEILVKNIEVVSEA. 99
683 1.000e-23UniRef50_A0A075FW21 Aspartyl-tRNA synthetase (DARS, aspS) n=1 Tax=uncultured marine thaumarchaeote AD1000_66_F10 TaxID=1455930 RepID=A0A075FW21_9ARCH  ali  30  5........RTHNIEDVNANMKDQDVILGGWVEDLRKMGKMTFLTLRDVTGITQIILT-------DELTKTVEGITRQSVVRITGKVQDTRARDF---EYEIKANEISILAKA. 98
684 1.000e-23UniRef50_O51402 Aspartate--tRNA(Asp/Asn) ligase n=63 Tax=Borreliaceae TaxID=1643685 RepID=SYDND_BORBU  ali  25  7............CNELNEKLIDKKVEINAWVKKIRHHGKFIFLNIRDRYEKAQVLVNEEK------LLKIAEKIKLEYCIKIQGLLIKRPINANMKTGFEILAKNIEIISKC. 104
685 1.000e-23UniRef50_K0BD92 Aspartate--tRNA ligase n=8 Tax=Thaumarchaeota TaxID=651137 RepID=K0BD92_9ARCH  ali  35  5........KTHDISELNEELIGKQVVLGGWIEDLRKLGKMSFITLRDVSGISQVIVKGELNDN-------LGEINRQSVVSIRGIVQETKARDFA---FEVKAEEIEVLGKA. 98
686 1.000e-23UniRef50_A0A0P5DIM2 Asparagine--tRNA ligase, cytoplasmic (Fragment) n=14 Tax=Eukaryota TaxID=2759 RepID=A0A0P5DIM2_9CRUS  ali  22  103.....................GQRVKVFGWVHRLRRQGKLMFITLRDGTGLLQCVLSDQLCQTFDAV-----TLSTESSVQLFGTLKLVPEGKSAPGGHELNVDYWKLIGSA. 189
687 1.000e-23UniRef50_A0A0C3QDA3 Uncharacterized protein n=1 Tax=Tulasnella calospora MUT 4182 TaxID=1051891 RepID=A0A0C3QDA3_9HOMO  ali  18  33.....FAYRTRVCQEVKAEDAGQTVRLAGWLSAERKSKKASFYSLRDASGIIQLIVRRSGESDLEDPLTKMSRTPEESVVSVLGRVKLRPQSSKSTGDVELEVEGFELLNAA. 144
688 1.000e-23UniRef50_A0A2A3E7U9 Aspartyl-tRNA synthetase, cytoplasmic n=2 Tax=Apis TaxID=7459 RepID=A0A2A3E7U9_APICC  ali  17  69....KYTERKIDIKDLNPNLENQNVWLRGRLHTSRAKGKQCFIVLRQQSYTIQG-LAAVNNKVSKQMIKFISNITKESIVDIEAVVKSSQIESCTQKDVEIHIEKAFVISSAK 179
689 1.000e-23UniRef50_A0A1H3GDZ9 Aspartate--tRNA(Asp/Asn) ligase n=5 Tax=Halobacteria TaxID=183963 RepID=A0A1H3GDZ9_9EURY  ali  29  7........RTYT----SDAEPGDHVTVAGWVHEVRDLGGIAFLILRDTEGRIQVKF--EKDEMDDELVETGLGVARESVIAVTGAV---DEEPRAPTGVEITPDSVDVLAES. 101
690 1.000e-23UniRef50_A3CXH4 Aspartate--tRNA(Asp/Asn) ligase n=37 Tax=root TaxID=1 RepID=SYDND_METMJ  ali  29  13......................ESAEIVGWVHEVRDLGGLSFFLIRDRTGIIQVTIPKKK--VPAEILDTARSVSRESVVRVRGTVKA---IEKAPGGREIVPEELEIISTAE 98
691 2.000e-23UniRef50_E9ICF4 Uncharacterized protein (Fragment) n=5 Tax=Holometabola TaxID=33392 RepID=E9ICF4_SOLIN