current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: 4tqd_A mol:protein length:291 Pyrrolysine--tRNA ligase, from PDB1018

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .
# E-value Template Links and tools%idFirst MGSSSSGLVPRGSHMASAPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLSFIQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNLLast
1 0.000e+00UniRef50_R1C468 Alpha subunit of phenylalanyl-tRNA synthetase n=2 Tax=Haptophyceae TaxID=2830 RepID=R1C468_EMIHU  ali  17  217.GTWRDALFKPVNVDAAGVAPAGGALHPLLKVRSMFREIFLEMG--FAEMTQQYVESSFWNFDALYQPQQHP-----ARDAHDTFFIKTPAQTELPYMERVRATHEVGGESTGWRYDWSEDEARKNLLRTHTTAASSRTLYQIAQLAKAPQKYFSIDRVFRNEALDATHLAEFHQVEGFVIDRNLSLGNLMGTIADFYRRLGFKHMKFKPTYNPYTEPSMELGKWVEVGNSGVFRPEMLRPMGFDVQVIAWGMSLERPTMIKYGYDNIRDLFGHRIDLGMVR... 520
2 0.000e+00UniRef50_D7E861 Phenylalanine--tRNA ligase alpha subunit n=19 Tax=Methanomicrobia TaxID=224756 RepID=D7E861_METEZ  ali  17  230.GEWKKKNFRSYNIHTPPKPIYGAKIHPYQRLINQMRQIFIEMG--FTEIKGEIIQSSFWNFDALFQPQDHP-----ARDMQDTFHLESTSEIDEECKDNVCAMHEHGGDISSTGWGWDENIARRNVLRTHTTAVTIKYL---ADNPEPPVKAFCIDRAYRRETIDPTHLPEFEQLEGVVMDKNMSFANLLGCLAEFYHRMGFENVRFRPGYFPYTEPSVEGMGWIELGGAGIFRKEVTDPLGIKHPVLAWGLGVSRVAMLKLGLRDLRELYQSDIN........ 503
3 0.000e+00UniRef50_E6N4Y6 Phenylalanine--tRNA ligase alpha subunit n=6 Tax=Archaea TaxID=2157 RepID=E6N4Y6_9ARCH  ali  17  242.GRWRELRLSRYDVKAPTPPIFAAKRHPLTELIRMVRQAYVEMG--FEEIEGPIVELAFWNFDALFQPQDHP-----AREMQDTFYLLEPRAGDPPHVEAVRKVHENGGDTGSKGYKWSLEEARRLLLRTHTTATTIRHLATVKQ---PPVKVFCVDRIFRNEKVDWKHLAEFHQIEGIVVERDASLRMLMGVLRDFYSRLGLREIRFKPSYFPYTEPSMEGGRWLELGGSGIFRPETTYPFGVKHPVLAWGLGLERLAMVIYGLEDIRTFHLNDLWLRSV.... 521
4 0.000e+00UniRef50_Q57911 Phenylalanine--tRNA ligase alpha subunit n=24 Tax=Methanococcales TaxID=2182 RepID=SYFA_METJA  ali  19  203.GKWKKAYIRPYDVKVPTKPIYPAKVHPLTRIIREVKEILLAMG--FKEVKSPIVETEFWNFDMLFEPQDHP-----AREMQDTFFLKYPNEGDIPE----DLLSKVKEVHERCWYKFDENVSRRLILRTHTTASSIRYLASLSDEEKKPHKVFCIDRVFRNEAIDYKHLPEFYQCEGIIMDDNVNFNNLIGVLKEFLNRLGFEKVRFRPAYFPFTEPSLEGKGWLEILGAGIFRPEVLEPIGIEKPVLAWGIGFSRLAMLRYGLTDIRDLHKNDLD........ 475
5 0.000e+00UniRef50_A0A0G4H9B2 Uncharacterized protein n=1 Tax=Chromera velia CCMP2878 TaxID=1169474 RepID=A0A0G4H9B2_9ALVE  ali  17  217.GSWEKLEYKKYNFNAEGQTLPSGHLHPLLKVRREFRNVLLLMG--FEEMTNRWVESSFWNFDSLFQPQQHP-----ARDAHDTFFLTRPELACKSRF-PPDYFDLVKKTHEDGGYDWSEDEARKNLLRTHTTSVSARMLYKLAQDVKKPKKYFSIDRVFRNETLDATHLAEFHQVEGLVADVGLSLGHLIGTIKDFFQRIGITNLRFKPAYNPYTEPSMEINKWVEIGNSGVFRPEMLRPMGLDVNVVAWGLSLERPTMIQYGIPNIRELFGHKVNLQELKTN. 533
6 0.000e+00UniRef50_Q54KS8 Phenylalanine--tRNA ligase alpha subunit n=5 Tax=Eukaryota TaxID=2759 RepID=SYFA_DICDI  ali  18  192..SWEKESFKV-NINAMGVVPEQGYRHPLNKVKNEFKQIFLDMG--FEEMTFNFVENGFWNFDALFQPQQHP-----ARELQDTFFIKDPKTFSDEYCERVKQVHSVGGYGSLGWYDWKLEEAEKNILRTHTTAVSARMLYKLAQNGFKPKKYFSIDRVFRNETLDATHLAEFHQVEGVIADVDISLGHLIGVISEFFKRLGIDNVRFKPAFNPYTEPSMEIFGWVELGNSGIFRPELLLPMGIPENVAAWGLSLERPTMIKYGLDNIRAIFGNSINVNFIKNN. 479
7 0.000e+00UniRef50_A0A0D8X9L6 Phenylalanine--tRNA ligase, alpha subunit n=2 Tax=Dictyocaulus viviparus TaxID=29172 RepID=A0A0D8X9L6_DICVI  ali  15  211.GSWKLKTFKQYNFDSLGVQPPCGHLHPLMKVRSEFRQIFFSMG--FSEMTNRYVESSFWNFDALFQPQQHP-----ARDAHDTFFISDPAR---STDFPSDYLERVKAVHSKGGYDWKIEEAQKNVLRTHTTAVSARQLYKLAQEGYRPVKMFSIDRVFRNETLDATHLAEFHQVEGVIAERNLSLSHLIGVFTEFFRKLGIENLRFKPAYNPYTEPSMEIKKWVEVGNSGMFRPEMLLPMGLDVNVAGYGLSLERPTMIRYGINNIRDLFGPKVDLQMVYD.. 549
8 0.000e+00UniRef50_I1IEX1 Uncharacterized protein n=26 Tax=Eukaryota TaxID=2759 RepID=I1IEX1_BRADI  ali  16  201.GDWKDLEFKDYNYGAQGQPIAIGYVQPLLEVREAIQNIFVEMG--FSEMTNMFVESSFWNFDALFQPQQHP-----ARDSHDTFFLKAPATTKLPYLEKVKQVHQSGGFGSKGGYDWKRDEAEKNLLRTHTTAVSTRMLYKLAQEKPFPKRYYSIDRVFRNEAVDRTHLAEFHQIEGLICDYGLTLGDLIGVLEDFFSRLGVSKLRFKPAYNPYTEPSMEIKKWVEIGNSGMFRPEMLLPMGLPVNVIAWGLSLERPTMILYGIDNIRDLFGPKVDFNLIK... 489
9 0.000e+00UniRef50_U5HFV3 Uncharacterized protein n=1 Tax=Microbotryum lychnidis-dioicae (strain p1A1 Lamole / MvSl-1064) TaxID=683840 RepID=U5HFV3_USTV1  ali  15  786.GAWEKSNFKKYNFEAEGAPTNGGALHPLMKVREEFRNIFFEMG--FTEMTNRFVESGFWNFDALYVPQQHP-----AREVQDTFYLKDPVASSG---FPQDYYGRVKKTHEVGGYGFSKEETSRLVLRTHTTSVSAAMLYKIANQPGGPSKLFSIDRVFRNETVDATHLAEFHQVEGVIADYNLTLADLIGFMEVFFKKMGVTNLRFKPAYNPYTEPSLEINKWVEIGNSGMFRPEMLEPMGLDVRVHGWGLSLERPTMIRYGISNIRDLLGHKVPLEMIE... 1075
10 0.000e+00UniRef50_G3AF86 Uncharacterized protein n=11 Tax=Eukaryota TaxID=2759 RepID=G3AF86_SPAPN  ali  16  36...WKDAEFKPYNFNSEGVYPPSGALHPLNKVREEFRQIFFSMG--FTEMSNQYVESGFWNFDTLFVPQQHP-----ARDLQDTFYLKDPVEAGLP--EDKEYWDRTRQVHESGKYGWKGEESLRMVLRTHTTAISSAMLYQLAKD-PKPIRLFSIDRVFRNEAVDATHLAEFHQVEGVIAGYDITLGDLIGFMEDFFGKMGVNGLRFKAAYNPYTEPSLEIGKWVEIGNSGMFRPEMLETMGLPKNVLGWGLSLERPTMIKYGVSNIRELLGHKVSLDFVESN. 323
11 0.000e+00UniRef50_D2VDQ1 Phenylalanine-tRNA synthetase family protein, alpha subunit n=1 Tax=Naegleria gruberi TaxID=5762 RepID=D2VDQ1_NAEGR  ali  18  246..EWQNASFKEYNFKATGKRNENGYLHTLLKVRTEFRKVFLELG--FEEMTNNFVESSFWNFDALFQPQQHP-----ARDAHDTFFLENPKQISLPTLEDVKKIHEEGGGSIGYRYDWKVEESKKNLLRTHTTAVSTRYLRKLGEELFKPRKYFSIDRVFRNEAPDATHLCEFHQIEGMVIDKGLTLGDMIGLFRVFFAKIGITDLKFKPAFNPYTEPSMEIKKWVEVGNSGMFRPEMLRPMGLDVTVLAWGLSLERPTMIKYSVDNIRDLVGHKVDLGGVQKN. 540
12 0.000e+00UniRef50_A0A2P6TKZ9 Putative phenylalanine--tRNA ligase alpha subunit n=1 Tax=Chlorella sorokiniana TaxID=3076 RepID=A0A2P6TKZ9_CHLSO  ali  16  201.GTWKEETFKEYNFNALGLLPAGGHLHPLLKVRTQFRKIFTQMG--FEEMTNNYVESSFWNFDALFQPQQHP-----ARDAHDTFFLTKP--AATPASNPADYMQRVKETHQHGGYGWATAEAEKNLLRTHTTAVSSRMLYRLAQEGFRPAKYFSIDRVFRNEAIDRTHLAEFHQIEGVVCDYGLTLSDLIGVLQEFFDRLGLSKLRFKPAFNPYTEPSMEIGKWIEVGNSGMFRPEMLRPMGLPVNVIAWGLGLERPTMILYNIDNIRDLFGHKVSLSM..... 488
13 0.000e+00UniRef50_A0A074T637 Phenylalanyl-tRNA synthetase alpha chain A, putative n=16 Tax=Sarcocystidae TaxID=5809 RepID=A0A074T637_HAMHA  ali  15  233..AWEKSNFKEYNFFAAGKKIRRGAVHPLMQVMKQFKQILYCMG--FEEMTNQYVESSFWCFDSLFMPQQHP-----ARDVQDTFFLQAPKSSDATKI-PQAYFNSVKNIHERGGYEWSEEESMGNILRTHTTASSARMLYGLAQEYKKPRKFFSIDRVFRNETLDATHLAEFHQVEGLVADRGLTIGHLMGVMETFYKQIGIEQLKFKPAYNPYTEPSMEIFGWIEVGNSGIFRPEMLLPMGLDVTVIAWGLSLERPTMIRYGISNIRQLFGH........... 518
14 0.000e+00UniRef50_A0A2E9QXX1 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Deltaproteobacteria bacterium TaxID=2026735 RepID=A0A2E9QXX1_9DELT  ali  17  255.GEWKNVTFREYDIQLDTAPVYAGKAHPLRRVLEETRRAFLNMG--FTEIRGPYVESAFWDFDALFQPQDHP-----AREMQDTFYCANPGTFSLPLVETIRQIHEDGGETGSTGYDWDEEKAKQVVLRTHTTAVTV---EACHKNPNPPQKVFCVGRVFRRETIDYKHLPEFHQVDGIIVDEHASFAHLLGTLTEFYRQMGFEEIKFRPAFFPYTEPSVEVKEWFELGGAGVFRPEVIRPAGVNVPVLAWGLGLERLAMIRYRVEDIRHLYLSQLD........ 532
15 0.000e+00UniRef50_A0A0P9G5L9 Phenylalanine--tRNA ligase alpha subunit n=4 Tax=Candidatus Bathyarchaeota TaxID=928852 RepID=A0A0P9G5L9_9ARCH  ali  19  214.GRWRRVKLRRFDVTAPGPVVYPRKVHPAQQIIQRVREIFLEMG--FTEIRGPIVETAFWNFDALFQPQDHP-----AREMMDTFYLAHPTKGKLPIVNAVAKTHENGWITGSRGYTWSLDEAKRLILRTHTTAVTIRYLAEHK---EPPVKVFSVDRVYRNEKVDYKRLAEFHQIEGIVMDKKVTLRDLMGTLKEFYLKLGLKKVQFWPSYFPYTEPSMELKTWVELCGMGIFRPEVLAPFGIKYPVLAWGGGLERLIMLKLGVEDIRHLYKNDL......... 490
16 0.000e+00UniRef50_A0A0D6EGA2 SPOSA6832_00250-mRNA-1:cds (Fragment) n=30 Tax=Dikarya TaxID=451864 RepID=A0A0D6EGA2_SPOSA  ali  16  263.GAWEKSAFKKYNFEAEGAPTLGGALHPLMKVREEFRNIFFEMG--FTEMTNRFVESSFWCFDSLFVPQQHP-----AREMQDTFYLKGPLLVSAVLANPEDYYERVKGDHGSTGYRFSKEETSRLVLRTHTTSVSSAMLYELANQPGGPAKMFSIDRVFRNEAVDATHLAEFHQVEGVVADRNLTLADLIGFMEVFFSKMGVKNLRFKPAYNPYTEPSLEIGKWVEIGNSGLFRPEMLETMGLDVRVLGFGLSLERPTMIRYGISNIRDLLGHKVPLEMIE... 573
17 0.000e+00UniRef50_A0A2A2HEQ1 Phenylalanine--tRNA ligase alpha subunit n=2 Tax=Methanosphaera cuniculi TaxID=1077256 RepID=A0A2A2HEQ1_9EURY  ali  18  230.GEWKNLHYRGYDINASAPKNYPGKIHPLQQTIEEIRSIFIDMG--FDEAKGTILESAFWNFDMLFQPQDH-----AAREMQDTFYVKNPPKADLPDSELVKMTHEHGGNTGSTGYNWNEDVARQIVLRTHTTGLSVRHL----NENEPPLKMFSIGRVFRRETIDYKHLPEFHQVEGIVAGEDMSFKNLLGILKEFYRKLGF-KVRFRPAYFPYTYLSVEKRKWMELGGSGMFRPEVLEPLGIKTQVAAFGLGIERLAMIRYGIEDIRMLYQSDI......... 504
18 0.000e+00UniRef50_P15625 Phenylalanine--tRNA ligase alpha subunit n=600 Tax=Eukaryota TaxID=2759 RepID=SYFA_YEAST  ali  15  206....KDLKFKPYNFNSQGVQISSGALHPLNKVREEFRQIFFSMG--FTEMSNQYVETGFWNFDALYVPQQHP-----ARDLQDTFYIKDPLTADLPYMDNIKAVHEQGFGSIGYRYNWKPEECQKLVLRTHSTAISARMLHDLAKD-PKPTRLFSIDRVFRNEAVDATHLAEFHQVEGVLADYNITLGDLIKFMEEFFERMGVTGLRFKPTYNPYTEPSMEIQKWVEIGNSGMFRPEMLESMGLDLRVLGWGLSLERPTMIKYKVQNIRELLGHKVSLDFIETN. 492
19 0.000e+00UniRef50_A0A0R0FHB9 Uncharacterized protein n=6 Tax=Mesangiospermae TaxID=1437183 RepID=A0A0R0FHB9_SOYBN  ali  17  82.GEWKELEFKEYNYSAKGQPLEGGNLHPLLKVRAQLKQIFLCMG--FEEMTNNFVESSFWNFDALFQPQQHP-----ARDSHDTF----FLEARTTKILPEDYVLRVTQVHESGGYDWKREEANKNLLRTHTTSVSSRMLYQLAQKPFAPKKYFSIDRVFRNEAVDRTHLAEFHQIEGLVCDRGLTLCDLIGVLHDFFSRLGMTKLKFKPAYNPYTEPSMEIKKWVEVGNSGMFRPEMLQPMGLDVQVIAWGLSLERPTMILYGIDSIRDLFGHKI......... 363
20 0.000e+00UniRef50_A0A0B7FNY9 Phenylalanyl-tRNA synthetase alpha chain n=60 Tax=Fungi TaxID=4751 RepID=A0A0B7FNY9_THACB  ali  16  206.GAWKSSTFKQYNFEAEGTPTNGGALHPLLKVREEFRNIFFEMG--FAEMTSQFVESGFWNFDTLFVPQQHP-----ARDLQDTFYLSDPAESHPP---PKDYYDTVARTHEHGGFGWREADSRRLLLRTHTTATSARMLKAIADRKGGPIKMFSIDRVFRNEAVDATHLAEFHQVEGLVADRGITLGDLIGFMQTFFKKMGVDNLRFKPAYNPYTEPSAFHKGWVEIGNSGMFRPEMLEPMGLDVRVLGWGLSLERPTMIRYGISNIRALVGHKVSIESVE... 495
21 0.000e+00UniRef50_A0A2S4WN13 Uncharacterized protein n=1 Tax=Puccinia striiformis TaxID=27350 RepID=A0A2S4WN13_9BASI  ali  16  246.GRWKTATFKPYNFNAEGVPPNGGALHPLMKVREEFRNIFFEMG--FTEMTDKYIETSFWCFDSLFVPQQHP-----ARESQDTFYLKDPSSTDFPYYEKVKNIHEVGG-HGSIGYRFQESETSKLVLRTHTTSVSANMLYQIAQESFKPSKLFSIDRVFRNEAVDATHLAEFHQVEGVVADKNITLGDLIGFMEVFFAKMGIHDIRVKPTYNPYTEPSMEIKKWVEIGNSGLFRPEMLEPMGLDVRVLGWGLSLERPTMIKYGISNIRELLGHKVSLASVQ... 539
22 0.000e+00UniRef50_A0A226E465 Phenylalanine--tRNA ligase alpha subunit B n=3 Tax=Folsomia candida TaxID=158441 RepID=A0A226E465_FOLCA  ali  14  201.GDWKTKNFKAYNFDALGTPIPAGHLHPLMKVRSEFRSVLFEMG--FSEMTNRFVESSFWNFDALFVPQKHP-----ARDAQDTFFVSQPS---TCNSIPEDYMNRVKAAHEGGSYNWKKEEALKNVMRTHTTAVSARMLYEIGQKKEFPTKLFSIDRVFRNETLDATHLAEFHQVEGVVADKGINLGHLIGIMKEFFSRLGIKKLRFKPAYNPYTEPSMEVKKWVEVGNSGMFRPEMLLPMGLDVRVIAWGLSLERPTMIRYGYDNIRDLVGPKVDLGMVY... 489
23 0.000e+00UniRef50_A0A2P2I4I7 Phenylalanine--tRNA ligase alpha subunit-like n=1 Tax=Hirondellea gigas TaxID=1518452 RepID=A0A2P2I4I7_9CRUS  ali  15  213.GQWRNKTFKPFNFRSKGKQVRPGHLHPLMQLRSEFRQIFLEMG--FSEMTNSYVESAFWNFDALFQPQQHP-----ARDAHDTFYVKTPISVPQEYMQRVREVHSNGGYGSSGYYPWSEEEAHKNLLRTHTTAVSARMLHKLAQDGFKPAKYFSIDRVFRNETLDATHLAEFQQIEGVVADYNLSVKHLIGMFTAFYEKIGIKKLRFKSTYNPYTEPSMEIGKWVEVGNSGLFRPEMLRPMGLNVSVLGWGLSLERPAMIMFGINNIRELVGPRVKMELVYSN. 503
24 0.000e+00UniRef50_A0A151ERF5 Phenylalanine--tRNA ligase alpha subunit n=20 Tax=Euryarchaeota TaxID=28890 RepID=A0A151ERF5_9EURY  ali  20  222.GLWKKKSIRPYDINAFAPAHYGGKAHPLLDLISTIRQIFLEMG--FEEIKGDFVESCFWNMDMLFIPQDHP-----AREMQDTLYCKTPSKIDSKLINTISKVHEDGGITSSWGYKFSKEEGEKALLRTHTTVNTIRYLYNN---PKPPSKVFSIGRVFRKENIDTTHLPEFYQIEGIIHESDSNFRQLIGILKEFYRRMGFEKIRFRPGYFPYTEPSMEVNKWMELGGSGIFRPEVTEPIGIKSPVLAWGLGLERLAMLKFELTDIRDLYISDL......... 496
25 0.000e+00UniRef50_A0A0P4W1C9 Uncharacterized protein n=3 Tax=Eumalacostraca TaxID=72041 RepID=A0A0P4W1C9_9EUCA  ali  17  193.GQWKNANFKPYNFKSKGRELRSGHLHPLMQLRSEFRRIFLEMG--FTEMTNSYVESAFWNFDALFQPQQHP-----ARDAQDTFYVADPLEVPEDYLERVRKTHSEGG-YGSIGYKWNRAEADKNLLRTHTTAVSARMLYKLAQDGFKPAKYFSIDRVYRNETLDATHLAEFYQVEGVVADHNFSIKNLMGVIGSFFKKIGMTSVRFKPTYNPYTEPSMEIKKWVEVGNSGLFRPEMLRPMGLPVKVCGYGLSLERPAMIMYGINSIRELVGPRVKMELILDN. 483
26 0.000e+00UniRef50_A0A1I7VQ56 Uncharacterized protein n=2 Tax=Loa loa TaxID=7209 RepID=A0A1I7VQ56_LOALO  ali  16  289.GSWRKKMFKKYNFDALGMMPAGGHLHPLMKVRNEFRQIFFQMG--FVEMTNRYVESSFWNFDALFQPQQHP-----ARDAHDTFFLSDPEKFSFPELQRVKKVHAEGGYGSRGYYDWKLEEAQRNVLRTHTTAISAHQLYKLAKEGFKSTKMFSIDRVFRNETLDATHLAEFHQVEGVVAERNLTLGHVMGLFTEFFRKCGITNLRFKPTYNPYTEPSMEIGKWVEIGNSGMFRPEMLLPMGVDVNVAGYGLSLERPTMIRYGIDNIRDLFGPKVDLRMIYEN. 578
27 0.000e+00UniRef50_R9TBX4 Phenylalanine--tRNA ligase alpha subunit n=7 Tax=Thermoplasmata TaxID=183967 RepID=R9TBX4_METII  ali  20  219.GKWKDVAIRKYDVRTFAPAIYPGKKHPLSIIADEIRTIFTSMG--FKEIDEQYVQPAFWNMDALFTPQDHP-----ARELQDTFYLAHPQELDDPVVEKVAAIHENGGNTGSIGWKWSKEEAEKLLLRTHTTVNSIKYLSQH---TEPPVKVFSLSKVFRKEAIDATHLPEFTQIEGIIMDEDANFDMLCGIIKEFYRRMGFTDIRFRPGYFPYVEPSKFRGKWMELGGAGVFRPEVTEPFGIKHPVLAWGMGFERLAMLRWNLKDLRDLYISDI--EMLREN. 498
28 0.000e+00UniRef50_A0A026WQG6 Putative phenylalanyl-tRNA synthetase alpha chain (Fragment) n=14 Tax=Hymenoptera TaxID=7399 RepID=A0A026WQG6_OOCBI  ali  18  194.GAWKSKKFKPYNFEALGAALQIGHLHPLLKVRHEFRKIFLEMG--FTEMANNYVESSFWNFDALFQPQQHP-----ARDAHDTFFISEPRV---STKFPMEYLEKVKTVHSKGGYDWKLEEAQKNLLRTHTTAVSARMLHKLMQEGEKPVKYFSIDRVFRNETLDATHLAEFHQIEGVVTDYGLTLGDLIGTLYEFFKKLGITQLQFKPAYNPYTEPSMEIKKWIEIGNSGMFRPELLLPMDLDVNVIGWGLSLERPTMIKYGLNNIRDLVGPKVDMEMVHNN. 489
29 0.000e+00UniRef50_A0A1Y1IFG6 Phenylalanyl-tRNA synthetase class IIc alpha subunit n=3 Tax=Eukaryota TaxID=2759 RepID=A0A1Y1IFG6_KLENI  ali  18  225..AWKGATFKDYNFAALGLPPSGGSLHPLLKVRAQFRKIFLQMG--FEEMTNNFVESSFWNFDALFQPQQHP-----ARDSHDTFFLKAPEKCRS---VPEDYMKRVKEMHEHGGGDWQYSEAAKNLLRTHTTAVSSRMLYKLAQDGFKPKKYFSIDRVFRNEAVDRTHLAEFHQIEGLICDRGVTLGDLLGTIEQFFSRLGMNEIRFKPAFNPYTEPSAEIKKWVELGNSGMFRPEMLQPMGLDVNVIAWGFGLERPTMILYNIDNIRDLFGHKVNLNVIRSN. 513
30 0.000e+00UniRef50_J9JVQ6 Uncharacterized protein n=21 Tax=Eukaryota TaxID=2759 RepID=J9JVQ6_ACYPI  ali  16  191.GSWKSTPFKLYNFEALGQPQSAGCLHPLLKVRSDFRQIFLEMG--FTEMTNNFVESSFWNFDALFQPQQHP-----ARDSHDTFFLENPQ---TSENFPQEYLNKVKTVHSKGGYDWSLDEAKKNVLRTHTTAVSARMLYGLAKDFK-PTKYFSIDRVFRNETLDATHLAEFQQVEGVIADYNLTLGDLIGVLHMFFERLGMTEIKFKPAYNPYTEPSMEIKKWIEIGNSGMFRPEMLLPMGLKVNVIAWGLSLERPTMIKYGINNIRDLVGPRVNLQMVQDN. 479
31 0.000e+00UniRef50_A0A158NE23 Uncharacterized protein n=24 Tax=Ecdysozoa TaxID=1206794 RepID=A0A158NE23_ATTCE  ali  18  193.GAWKDKKFKPYNFDALGASLQIGHLHPLLKVRHEFRKIFLEMG--FTEMSNNYIESSFWNFDALFQPQQHP-----ARDAHDTFFISEPLSTKFPMLERVRTVH-SKGAYGSQGYDWKLEEAQKNLLRTHTTSNSARMLYKLMEKGDKPIKYFSIDRVFRNETLDATHLAEFHQVEGVVADYNLTLGNLIGILYEFFSKLGITQLRFKPAYNPYTEPSMEIEKWIEIGNSGMFRPEMLLPMNLDVNIIAWGLSLERPTMIKYGLNNIRDLVGPKVDMEMVHNN. 483
32 0.000e+00UniRef50_A0A0V1HA16 Phenylalanine--tRNA ligase alpha subunit (Fragment) n=5 Tax=Eukaryota TaxID=2759 RepID=A0A0V1HA16_9BILA  ali  16  41...WQEKKFKPYNFKAFGVAPVRGYLHPLMKVRTEFRQIFLEMG--FTEMTQRYVESSFWNFDALFQPQQHP-----ARDEQDTFFISEPMYTDLPYVKRVEKVHSVGDYGSSGGYKWKIEEAAKNVLRTHTTASSIRMLYEIAKKPFKPVRYFSIDRVFRNESLDATHLAEFHQVEGLIAGENLSLGHLIGILQEFYKKLGIERLRFKPAYNPYTEPSMEIKKWVEIGNSGMFRPEVLLPLGLNVTVIAWGLSLERPTMIKYGIDNIRDLIGPRVDLTMIQ... 326
33 0.000e+00UniRef50_Q9Y285-2 Isoform 2 of Phenylalanine--tRNA ligase alpha subunit n=98 Tax=Eukaryota TaxID=2759 RepID=Q9Y285-2  ali  16  168VGSWRDRPFKPYNFLAHGVLPDSGHLHPLLKVRSQFRQIFLEMG--FTEMTDNFIESSFWNFDALFQPQQHPARDQ-----HDTFFLRDPAEAQLPMVQRVKRTHSQGGYGSQGYYNWKLDEARKNLLRTHTTSASARALYRLAQKKPFPVKYFSIDRVFRNETLDATHLAEFHQIEGVVADHGLTLGHLMGVLREFFTKLGITQLRFKPAYNPYTEPSMEVKKWVEVGNSGVFRPEMLLPMGLNVSVIAWGLSLERPTMIKYGINNIRELVGHKVNLQMVYD.. 458
34 0.000e+00UniRef50_Q9T034 Phenylalanine--tRNA ligase alpha subunit, cytoplasmic n=56 Tax=Eukaryota TaxID=2759 RepID=SYFA_ARATH  ali  15  191...WKELEFKEYNFKAKGAPVDAGHLHALLKVRKQFKDIFVQMG--FEEMTNNYVESSFWNFDALFQPQQHP-----ARDSHDTFFLKVPSTTRTPEVERVKRVHESGGYGSRGYYDWKREEANKNLLRTHTTAVSSRMLYALAQKPFVPKKYFSIDRVFRNEAVDRTHLAEFHQIEGLICDRGLTLGDLIGVLEDFFSRLGMSKLRFKPAYNPYTEPSMEIGKWVEIGNSGMFRPEMLLPMGLDVRVIAWGLSLERPTMILYGIDNIRDLFGHKVDLDLIKRN. 478
35 0.000e+00UniRef50_Q9Y285 Phenylalanine--tRNA ligase alpha subunit n=231 Tax=Eukaryota TaxID=2759 RepID=SYFA_HUMAN  ali  17  200.GSWRDRPFKPYNFLAHGVLPDSGHLHPLLKVRSQFRQIFLEMG--FTEMTDNFIESSFWNFDALFQPQQHPARDQ-----HDTFFLRDPAEAQLPMVQRVKRTHSQGGYGSQGYYNWKLDEARKNLLRTHTTSASARALYRLAQKKPFPVKYFSIDRVFRNETLDATHLAEFHQIEGVVADHGLTLGHLMGVLREFFTKLGITQLRFKPAYNPYTEPSMEVKKWVEVGNSGVFRPEMLLPMGLNVSVIAWGLSLERPTMIKYGINNIRELVGHKVNLQMVYD.. 489
36 0.000e+00UniRef50_A0A226MD39 Uncharacterized protein n=3 Tax=Archelosauria TaxID=1329799 RepID=A0A226MD39_CALSU  ali  19  224.GSWRTLPFKAYNFSALGLPPACGHLHPLLKVRSQLRQIFLEMG--FTEMTDNFVESSFWNFDALFQPQQHPARDQ-----HDTFFLRDPAEA--PEL-PANYMARVKKVHSQGGYGWKVEEARKNLLRTHTTSASARALYHLARQGKFPVKYFSIDRVFRNESLDATHLAEFHQVEGVVADRGLTLGHLMGILQQFFTKLGISKLRFKPAYNPYTEPSMEVKKWVEVGNSGVFRPELLLPMGLNVSVIAWGLSLERPTMIKYGITNIRELVGHRVSLQMIY... 512
37 0.000e+00UniRef50_A0A212F868 Phenylalanyl-tRNA synthetase alpha subunit n=2 Tax=Eukaryota TaxID=2759 RepID=A0A212F868_DANPL  ali  16  194.GAWKDLQFKPYNFDALGQPPDSGHLHPLLKVRSEFREIFLEMG--FTEMTNRYVESSFWNFDALFQPQQHP-----ARDAHDTFFISSPAVSQFPMLEKVKKVHSEGGYGSQGYYTWKLEEAQKNLLRTHTTAVSARTLY-KRADRHTPIKCFSIDKVFRNETLDATHLAEFHQVEGVIADKDLGLADLITVLDDFFKRLGFDKLQFKPAYNPYTEPSMEIEKWIEIGNSGVFRPEMLLPMGLDVNVIAWGLSLERPTMIKYGLNNIRDLVGPKVDLQMVQSN. 482
38 0.000e+00UniRef50_A0A2P4UXE9 Uncharacterized protein n=5 Tax=Caenorhabditis TaxID=6237 RepID=A0A2P4UXE9_CAERE  ali  15  255.GSWKDKQFKKYNFESLGVVPSSGHLHPLMKVRSEFRQIFFSMG--FSEMTNRYVESSFWNFDALFQPQQHP-----ARDAHDTFFVSDPAISTTDYLERVKTVHSKGGGSAGYNYDWKIEEAQKNVLRTHTTAVSARQLYQLAQEGFRPSKLFSIDRVFRNETLDATHLAEFHQVEGVIAEKNLSLAHLIGVFTEFFKKLGITNLRFKPTYNPYTEPSMEIAKWVEIGNSGMFRPEMLLPMGLDVNVAGYGLSLERPTMIKYGINNIRDLFGSKIDLEVVYN.. 543
39 0.000e+00UniRef50_A0A088AIQ1 Uncharacterized protein n=52 Tax=Pancrustacea TaxID=197562 RepID=A0A088AIQ1_APIME  ali  17  193.GAWKNKKFKPYNFAALGTTLEVGHLHPLLKVRSEFRKIFLEMG--FTEMTNNYVESSFWNFDALFQPQQHP-----ARDAHDTFFIAEPSH---STNFPIDYMEKVKKVHSEGRYDWKLEEAQKNVLRTHTTAVSARMLYKLMQQNKKPVKYFSIDRVFRNETLDATHLAEFHQIEGVIADYNLTLGDLIGILYEFFKKLGIIQLQFKPAYNPYTEPSMEIKKWIEIGNSGMFRPEMLLPMGLDVNVIAWGLSLERPTMIKYGLNNIRDLVGPKIDLEMVYNN. 483
40 0.000e+00UniRef50_G3WQG8 Phenylalanyl-tRNA synthetase alpha subunit n=13 Tax=Eukaryota TaxID=2759 RepID=G3WQG8_SARHA  ali  17  151.GSWRDVKFKAYNFSSKGILPEGGHLHPLMKVRTQFRQIFLEMG--FTEMTDNFIESSFWNFDALFQPQQHPARDQ-----HDTFFLKDPAEADFPMVERVKRIHSQGGYGSQGYYDWKMEEAQKNLLRTHTTAASARALYRLAQKKPFPAKYFSIDRVFRNETLDATHLAEFHQIEGVVADYGLTLGHLMGILKEFFTKLGITNLRFKPAYNPYTEPSMEVKKWVEVGNSGVFRPEMLLPMGLPISVIAWGLSLERPTMIKYGINNIRELVGHKVNLQMVYDN. 441
41 0.000e+00UniRef50_A0A261Y4Z5 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Bifiguratus adelaidae TaxID=1938954 RepID=A0A261Y4Z5_9FUNG  ali  16  155.GEWKTADFKPYNFNAIGLAPPGGHLHPLMKVREEFRRIFFEMG--FEEMTNKFVESSFWNFDALFQPQQHP-----ARDAHDTFFIKDPATSDADLMAKVKKTHEDGGDTGSTGYEWKVEEAEKLLLRTHTTAVSSYMLYKLAQEPEFPAKYFSIDRVFRNESVDATHLAEFHQLEGVIADRNLTLGDLIGFMDIFFKKMGIEKIRFKPAYNPYTEPSMEIKKWVEIGNSGMFRPEMLGPLGLDVRVIAWGLGLERPTMIKYGISNIRDLLGHKVNLSMVE... 444
42 0.000e+00UniRef50_T1JMN7 Uncharacterized protein n=3 Tax=Mandibulata TaxID=197563 RepID=T1JMN7_STRMM  ali  17  264..SWKEKKFKEYNFNALGVEPTCGHLHPLMKVRAEFRQIFLEMG--FTEMTNNFIESAFWNFDALFQPQQHP-----ARDAHDTFFVSKPAKAPSDYVQRVKTMHEDGGHGSEGYYNWKMEEAAKNLLRTHTTAVSARMLYKLAQQPEFPVKYFSIDRVFRNETLDATHLAEFHQIEGVIADRGLTLGDLIGTLHEFFKKLGISKLRFKPAYNPYTEPSMEIGKWVEVGNSGVFRPEMLLPMGLDVRVIAWGLSLERPTMILYGIDNIRDLVGHKVDLQMVRDN. 553
43 0.000e+00UniRef50_A0A1Y3B458 Phenylalanine-tRNA ligase alpha subunit B-like protein n=3 Tax=Bilateria TaxID=33213 RepID=A0A1Y3B458_EURMA  ali  16  22.GTWRTKTFKGYNFNALGIPPDRGHLHPLLKVREQFRQIFLEMG--FEEMTNNYVESSFWCFDTLFVPQKHP-----ARDLQDTFYLSDPAECDIPYMERIRSVHENGGNCGSIGYEWKESEARKNVLRTHTTAVSARMLYHAAQQYKRPIKLFSIDRVFRNETLDATHLAEFNQIEGVVADRNLTLGHLMGMTKAFFEKLGIHDIRFKPTYNPYTEPSMEMGKWVEIGNSGLFRPEMLKPMELDINVLGWGLSLERPTMIKYGISNIRDLVGHKIDLQMVYDN. 319
44 0.000e+00UniRef50_A0A0B1SLL8 Phenylalanine--tRNA ligase, alpha subunit (Fragment) n=4 Tax=Ecdysozoa TaxID=1206794 RepID=A0A0B1SLL8_OESDE  ali  17  78.GSWKNKTFKQYNFDALGVQPPCGHLHPLMKVRSEFRQIFFAMG--FTEMTNRYVESSFWNFDALFQPQQHP-----ARDAHDTFFVSEPLSTKFPMLERVKTVHSKGGGSAGYNYDWKIEEAQKNVLRTHTTAVSARQLYKLAQEGFKPTKMFSIDRVFRNETLDATHLAEFHQVEGVIAERNLSLAHLIGIFTEFFKKLGIENLRFKPTYNPYTEPSMEIKKWVEIGNSGMFRPEMLLPMGLDVNVAGYGLSLERPTMIRYGIDNIRDMFGPKVNLEMIYN.. 366
45 0.000e+00UniRef50_A0A2J7Q0D3 Phenylalanine--tRNA ligase alpha subunit n=4 Tax=Neoptera TaxID=33340 RepID=A0A2J7Q0D3_9NEOP  ali  17  211.GSWREEKFKPYNLDALGAPLNCGHLHPLLRLRAEFRQIFLEMG--FTEMTNNYIENSFWNFDALFQPQQHP-----ARDAHDTFFISNPQISS---HFPPEYLQKVKQVHSKGGYDWKIEEAQKNLLRTHTTAVSARMLYLLAKEGFKPSKYFSIDRVFRNETLDATHLAEFHQVEGVIADYSLTLGDLIGTLYEFFNKLGITKLQFKPAYNPYTEPSMEVGKWIEVGNSGIFRPEMLLPMGLDVNVIAWGLSLERPTMIKYGLNNIRDLVGAKIDLQMVHN.. 499
46 2.000e-98UniRef50_Q8TUA2 Phenylalanine--tRNA ligase alpha subunit n=75 Tax=root TaxID=1 RepID=SYFA_METAC  ali  17  209.GAWKGKKFRPYRLDIAPNPLYGVKIHPYRRLIEQMRQIFLEMG--FTEIKGGIIQSSFWNFDALFQPQDHP-----ARDMQDTFHLGSICQLPAEYSDKVAAMHESGGDIDSCGWGWDRELARRNVLRTHTTSVTIKYL---ADNPEPPVKAFCIDRAYRRETIDPTHTPEFEQLEGVVMDKDMSFADLLGLLAEFYHRMGFEEVRFRPGYFPYTEPSVEGLGWVELGGAGVFRKEVTEPFGIKEPVLAWGLGVSRLAMLKLGLKDLRLLYQSDID........ 482
47 2.000e-98UniRef50_A0A0L1KR47 Phenylalanyl-tRNA synthetase alpha chain n=2 Tax=Kinetoplastida TaxID=5653 RepID=A0A0L1KR47_9EUGL  ali  16  235..SWVNAEFKPYNLQAEGARPLAGSLHPLMRVREEYREIFLELG--FSEMTSNYIESSFWNFDALFVPQNHP-----ARDMQDTFFISDPGHSKPDAADYVRNVHENGGGCGSYAYDWSIEESRKNVLRTHTTAVTARILYQLAQKSNSPSKFFSIDRVFRNEEMDKTHLCEFHQIEGVVVDRNLSLVQMMTILKQFFHRIGIEKIRFKPAYNPYTEPSMEIFGWMEVGNSGMFRPEMLVPMGFNTTAIAWGLSLERPTMIKYGLKSIHDLFGHKIDISF..... 521
48 3.000e-98UniRef50_A3LRA4 Phenylalanyl-tRNA synthetase, beta subunit, cytoplasmic n=116 Tax=Eukaryota TaxID=2759 RepID=A3LRA4_PICST  ali  17  198..SWKEAEFKPYNFNSEGVYPTSGALHPLNKVREEFRQIFFSMG--FTEMSNQYVETGFWNFDTLFVPQQHP-----ARDLQDTFYLKDPAVAKPP--QDKQYWENIKAVHQDGRYPWKAEESLRMVLRTHTTAISSAMLHKLA-EDPKPVRLFSIDRVFRNEAVDATHLAEFHQIEGVLAGYDITLGDLIGFMEDFFGKMGVHGLRFKSAYNPYTEPSLEINKWVEIGNSGMFRPEMLESMGLPKNVLGWGLSLERPTMIKYGVSNIRELLGHKVLLDFIESN. 486
49 3.000e-98UniRef50_Q8SRG9 Probable phenylalanine--tRNA ligase alpha subunit n=13 Tax=Opisthokonta TaxID=33154 RepID=SYFA_ENCCU  ali  18  180.GSYRDLSFKHYNFNAEGNAPQCGSIHPLMKIREDFRRIFIELG--FSEMTNQYVESSFWNFDALFQPQNHPS-----RDAHDTFFLLNP---ELSTDFPSDYLKEVGETHRGGKYNWDIKEAQKNILRTHTTSVSARNLYRLAKKEFKPAKLFSIDKVFRNETVDATHLAEFHQVEGLVVGKGLNLTHLMGILREFFNRLGMGDIRFKPAFNPYTEPSMEVFGWIEVGNSGVFRPEMLRPMGFDVSVVAWGLSLERPAMIKYGLKNIRELVGHKVDIEFSR... 467
50 3.000e-98UniRef50_B6HC26 Pc18g05340 protein n=146 Tax=Fungi TaxID=4751 RepID=B6HC26_PENRW  ali  17  195.GSWKTAHLKPYNFNAKGAPTPSGTLHPLNKVRQEFRNIFFDMG--FEEMTNRFVETGFWNFDALFVPQQHP-----ARDLQDTFYISDPAVADPPRLDYKKYWDNVREVHEHGRYPWSADESLRLVLRTHTTSISTYMLHKLAAN-PRPARFFSIDRVFRNESVDATHLAEFHQVEGVIADFGLTLGGLIGFMEVFFAKMGIHKLRFKPAYNPYTEPSMEIGKWVEIGNSGMFRPEMLESMGLDLRVYGWGLSLERPTMIKYGVSNIRELLGHKVDLHFIETN. 504
51 3.000e-98UniRef50_A0A2D6JBP6 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Euryarchaeota archaeon TaxID=2026739 RepID=A0A2D6JBP6_9EURY  ali  16  203...WKGKNIRGYDINAKTQPYFGGALHPHTLATEKIRRTFLELG--FEEMRGNYVESTFWNFDALFQPQDHPS-----RDLADTFYLKKPEKSKLPDKKYVDAVKRAHETGTQGSSGWQYDWKRSLVLRTHTTAVSARWLTKL----KPPAKVFCIGRVFRNETVDYKHLPEFTQIDGIVIDENASFRDLLGYLKEFFTRLGFDKIRFRPAYFPYTEMSTEKKEWIELGGSGLFRPEVTEPLGINVPVLAWGLSIERPLMMNLGLKDIRSFYKNDLWLREVP... 483
52 4.000e-98UniRef50_A0A1V5X7R4 Phenylalanine--tRNA ligase n=1 Tax=Deltaproteobacteria bacterium ADurb.Bin207 TaxID=1852869 RepID=A0A1V5X7R4_9DELT  ali  16  225.GAWRDITLRPYDVTLPGKTVYPAKIHPLRKIMEQTRRAFLELG--FEEVVSPMVESAFWNFDALFQPQDHP-----ARDMQDTFYMLDPARIPLPPPEVVRRTHEHGGDTGSWGYKWSEREAERVVLRTHTTAATIRALAAHPN---PPYKAFCVGWTYRNETISFKHLPVFHQIEGIVIDEQASLATLLGTLTAFYQKMGFAKVRFKPAFYPYTEPSVDVGKWIEMGGSGIFRPEVSEPFGCKHPVLAWGLGLERLAMLRLGFSDIRQLYQGSLD........ 502
53 4.000e-98UniRef50_A0A1I3B690 Phenylalanine--tRNA ligase n=2 Tax=Planctomicrobium piriforme TaxID=1576369 RepID=A0A1I3B690_9PLAN  ali  14  223.GAWREITLRAYDVTLPAETVHPAKIHPLRKMIEQTRRAYLEMG--FTEVVSPIVESSFWNFDALFQPQDHP-----ARDMQDTFYMDEPSMTDLPLVDRVRRAHEDGGDTGSWGYKWSPERARQVVLRTHTTASTIRALARHPN---PPLKAFCVGWVCRNETMSYKHLPVFHQVDGIVIDEHASLATLLGTLETFYKKMGFKQVKFKPAFYPYTEPSVDVKKWIEMGGSGIFRPEVTEPLGCKHPVLAWGLGMERLAMIRYGLSDIRELYQGRI......... 500
54 8.000e-98UniRef50_V6M0E6 Phenylalanyl-tRNA synthetase alpha chain n=3 Tax=Eukaryota TaxID=2759 RepID=V6M0E6_9EUKA  ali  16  186.GAEALR-FKPLNFNARGKPVSVGALHPLLKFRTQFIAILTGMG--FQQMTANYLESSFWNFDALFQPQQHP-----ARDMHDTFFVAGYADFDLRNV-DKSYFEAVKAAHEAGYYIFDDKETCKNLLRTHTTAVSARRLYELAQDYKKPIKSFSIDRVFRNETLDATHLCEFHQVEGFICDVNVSLRDLMGTIKAFFKELGMENVRFKPTYNPYTEPSMEINKWIEVGNSGMFRPEMLRTMGFGPEVIAWGLSLERPTMIKYGINNIRDLIGPACDLDMI.... 472
55 9.000e-98UniRef50_A0A2D5YJR1 Phenylalanine--tRNA ligase alpha subunit n=25 Tax=Euryarchaeota TaxID=28890 RepID=A0A2D5YJR1_9EURY  ali  19  228.GTWSKGRFQRYSLETQAESAPQATLHPLTRFTEEIRGIFLQMG--FTEIEGDYVESAFWNMDALFIPQDHP-----ARELQDTLYLDDPKSFLLDDVEAVKAVHETGGDTGSSGYDWSREVAQQALLRTHTTVNTIRYLSEHS---EPPVRVFAVGRVFRREAVDATHMPEFTQVEGIIMEEEASFGMLIGVLKEFYRRMGFPDVRVRPAYFPYTEPSMFGDSWLELGGSGIFRPEVTAPFGIDTPVLAWGLGLERLAMLRLGLKDIRMLYQSDLWLKTAR... 509
56 1.000e-97UniRef50_A0A1Q6DTG3 Phenylalanine--tRNA ligase alpha subunit n=2 Tax=Archaea TaxID=2157 RepID=A0A1Q6DTG3_9EURY  ali  17  215.GSWEKKKFINYDIEAEAKPKYPGKRHPYQRLLDKVRRIFRDMG--FQEIKGNTVESSFWNFDALFQPQDHP-----AREMQDTLYLKKPDSSKLPLVEKTKSMHEKGNEINSKGWTWDKKLAEKPVLRTHTTATTIRYLYKN---PDPPQKVFSIDRAYRRETIDATHLPQFYQVEGIVSDKEVDFENLLGFLSEFYERMGFEEIRFRPGYFPYTEPSVELEEWVELGGAGIFRKEVTKPVNVNNPVLAWGLGIGRLAMLKLGLSDLRELYRSDIWLREVPI.. 499
57 1.000e-97UniRef50_M1V7X6 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Cyanidioschyzon merolae (strain 10D) TaxID=280699 RepID=M1V7X6_CYAM1  ali  17  230..SWRNATFKEFNFEAAGAPVDGGRLHPLLKVREEFRLIFLEMG--FTEMSNQYVESSFWNFDALFQPQQHP-----ARDAHDTFFLNEPALCKSPA--TEAYVERVRGVHDQGGYGWDHTEAMRNVLRTHTTAISARMLYRMARELNFARRMFSIDRVFRNETLDATHLCEFHQVEGWVAGPDLSLADLKGIISQFFRRIGMHRLRFKPTYNPYTEPSMEIGRWVEIGNSGIFRPEMLQPMGLPPNVIAWGLSLERPTMILYGLSNIRDLFGHRVSLQTIRDN. 533
58 2.000e-97UniRef50_UPI000846D055 phenylalanine--tRNA ligase alpha subunit-like n=2 Tax=Eumetazoa TaxID=6072 RepID=UPI000846D055  ali  15  184.GEWEELPFKPYNFDALGAVPARGHLHPLLKMRSEFRQIFLEMG--FAEMTNNYVEPSFWNFDSLFQPQQHP-----ARDAHDTFYV------------------KQSTGSRGYGYNWQLIEAEKNLLRTHTTAVSARTLYQLATRPNGPAKFFTIDKVFRNEALDATHLAEFHQVEGVIANVDFTLGDLIGTLQELFRKLGIEELQFKPTYSPYTEPSMEIAEWLEVGNSGIFRPELVLPMGLPPNVLAWGLSLERPTMIKYGINNISDLVGPRVDLKMVED.. 452
59 2.000e-97UniRef50_K3WA38 Uncharacterized protein n=11 Tax=Eukaryota TaxID=2759 RepID=K3WA38_PYTUL  ali  15  208..AWKRETFKPYNFNTLGLAVGGGHLHPLMKVRAEFRRVLMDMG--FQEMTNRYVESSFWNFDSLFQPQSHP-----ARDAHDTFFLTKPQKCLTVPEEYYERVHDMHGSIGHGRGAFKRETSMTNILRTHTTAISAQMLYKLANQPGGPQKYFSIDRVFRNESMDATHLAEFHQVEGVVADYDLSLGDLIGVIKAFFEKIGITKMRFKPAYNPYTEPSMEINKWTEIGNSGVFRPEMLRPMGLPENVIAWGLSLERPTMIKYRLSNIRDLFGHKVDLE...... 494
60 2.000e-97UniRef50_A0A2D4BJM7 Phenylalanine-tRNA ligase, alpha subunit n=2 Tax=Eukaryota TaxID=2759 RepID=A0A2D4BJM7_PYTIN  ali  16  93..AWKSETFKPYNFNTMGLTVGGGHLHPLMKVRAEFRRVLMDMG--FSEMTNRFVESSFWNFDSLFQPQSHP-----ARDAHDTFFLTKPASCLTVPEEYYERVHDMHENGGHGSIGHKRETSMKNLLRTHTTAISAQMLYKLANQPGGPQKYFSIDRVFRNESMDATHLAEFHQVEGVVADYDLSLGDLIGVIKAFFNKIGITQMRFKPAYNPYTEPSMEIKKWTEIGNSGVFRPEMLRPMGLPENVIAWGLSLERPTMIKYRLSNIRDLFGHKVDLENTRT.. 383
61 2.000e-97UniRef50_D3BCX3 Phenylalanyl-tRNA synthetase n=3 Tax=Eukaryota TaxID=2759 RepID=D3BCX3_POLPP  ali  16  190..SWKDETFK-FNHLALGEIPSSGFRHPLSKVKAEFKQIFIEMG--FEEMTANFVENSFWNFDALFQPQQHP-----ARDAHDTFFLKDPA---TSHDFTDDYLAKVHKVHQEGRYDWKLEEAEKNILRTHTTAVSSRMLYKLAQTGFKPKKYFSIDRVFRNETLDATHLAEFHQVEGVIADVDISLSHLIGIFTEFFKRLGITDISFKPAYNPYTEPSMEIFGRIELGNSGLFRPEMLLPMGLPPNVAAWGLSLERPTMIKYELNSIRSIFGNDLNINSIKSN. 476
62 2.000e-97UniRef50_Q6BFG1 Phenylalanyl-tRNA synthetase alpha subunit, putative n=3 Tax=Paramecium tetraurelia TaxID=5888 RepID=Q6BFG1_PARTE  ali  16  217.GEWKECEYKSINLNAEGEKISMGNLHPLLKVRKQFSQILIGLG--FEEMTNQFVESSFWNFDALFQPQKHP-----ARDAHDTFFCSDPEEVDTTLRDKVKSMHQTGGVGSIGYYEWSHEESRKNILRTHTTAVSSKMLYRIAQQYKFPKKYFSIDKVFRNETLDATHLAEFHQIEGVVIDKNASLGQLMGIIREFFRQIGINKLWFKPTYNPYTEPSMEIYGYVEIGNSGVFRPEMLAPLGFDVNVIAWGLGLERPTMIYYDIRDIRTMVGPEVKVETVRSN. 510
63 3.000e-97UniRef50_A0A1Q9MYP7 Phenylalanyl-tRNA synthetase alpha subunit (Fragment) n=1 Tax=Candidatus Lokiarchaeota archaeon CR_4 TaxID=1849166 RepID=A0A1Q9MY  ali  19  227.GEWKNVTLKSFNVAARGPALFGGKLHPVTLLINKVREVFLSMG--FTEIRGPMVESAFYNFDALFQPQDHP-----AREMHDTFYLDNPKTAKLPPEEYIRAVHETGGSTGSIGWKWSESIARQMILRTHTTATTIRRLSEIGRNKEPPARVFSIDRVFRNEKVDFKHLAEFTQIEGIVIDKGVTLSDLRGLLTSFFTRMGFSKVLTRPGYYPYTEPSEDHQRWFEMAGSGIFRPEVTEPWGIKDPVLAWGMGFERLAMLYFERKDIRDLYRNPLWLREVPV.. 517
64 3.000e-97UniRef50_A0A075FWD2 Phenylalanine--tRNA ligase alpha subunit n=14 Tax=Archaea TaxID=2157 RepID=A0A075FWD2_9ARCH  ali  18  222.GEWRNASLRPLNVESPAPTIYSGKKHPVRIFIDEVREIFVSLG--FQEVEGSIVQSSFWNFDALFTPQDHP-----AREIQDTFYIENSLEVDEQILKNVESVHKDGANTGSKGYQWNIEQARRMVMRTHTTCVSVKNLADNKPDEA---RVFSVGRVFRNEKVTFKNLVEFHQIEGIVVGKDVTLRDLMGLLTKFYKKLGFEKIKFWPSFFPYTEPSLQSGRWIELGGMGIFRPEVTRPLGVKNPVLAWGSGLERLVMLRYGIDDVRKLYENDLDLRGIPL.. 506
65 4.000e-97UniRef50_A0A0V0QTV2 Uncharacterized protein n=2 Tax=Eukaryota TaxID=2759 RepID=A0A0V0QTV2_PSEPJ  ali  17  200...WSELNFKPYNWNALGKEVDSGNLHPLQKVRKQFKEVLSEMG--FEEMTNNYVESCFWNFDTLFVPQKHP-----ARDLQDTFYISDPKVAKIDEREYLENVKKVKGDYGSIGYDFQEEESQKLVFRTHTTAASARMLYNIAQEAKKPRKIYSIDRVFRNEHLDATHLAEFHQIEGIIADKEVGLGHLMGVIEKFFNKIGIQKLMFKPTYNPYTEPSLEIYGYVEIGNSGVFRPEMLRPMGIDVQVLGWGLGLERPTMIQYGYSNIRELFGDKVDLKMVKKN. 492
66 4.000e-97UniRef50_A0A257AJW1 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Candidatus Bathyarchaeota archaeon ex4484_205 TaxID=2012510 RepID=A0A257AJW1_9AR  ali  20  220.GVWKKIGFKKYKVEASGPKIYPGKRHPLREIIDKIRRIFLEMG--FKEARGPIVESSFWCFDALFQPQDHP-----ARELADTFYLKG-LESKLPEVEKVKKTHENGWITGSRGYEWKEEIAKKSVLRTHTTAVSARYL----QKVSPPSKVFSIGKVYRNEKTDWRRLHEFFQVEGIVVDEEATFRDLLGYLSTFFRKLGFEKIRFRPAYFPYTEISEERDTWLELGGAGIFRPEVTEPFGIDCPVLAWGLGLERPIMLILGMRDIRDFYKNDLN........ 495
67 5.000e-97UniRef50_A0A058Z2M9 Phenylalanyl-tRNA synthetase alpha chain n=2 Tax=Opisthokonta TaxID=33154 RepID=A0A058Z2M9_9EUKA  ali  16  271............NIDYVRGRVPTGHLHPLLKVREEYRKIFLNMG--FTEMTNNFVESSFWNFDTLFQPQHHP-----ARDAHDTFFVRSPAKAALPTVEAVKKVHSEGDFGSIGHRTWKEDEAQKNILRTHTTAASARALKELADQGEFPVKYFSIDRVFRNETLDHTHLAEFHQIEGLIADRNLSLAHLLSTLKEFFRALGMKDLRFKPAYNPYTEPSMEVKKWIEVGNSGVFRPEMLRPMGLDVSVIAWGLSLERPTMILYGIDNIRDLCGHTIDLKLVKTN. 555
68 1.000e-96UniRef50_A0A098VT94 Uncharacterized protein n=1 Tax=Mitosporidium daphniae TaxID=1485682 RepID=A0A098VT94_9MICR  ali  16  192.GSWKDRPFKPYNFDSDGPKRPCGHLHPLLKVRSEFRQIFFEMG---------FVENSFWNFDALFVPQQHP-----ARDSQDTFFTESPAKANLPEVAQVQKIHMEGGFGSLGYRAWSVEETQKNVLRTHTTAVSARMLYALAKE------------VFRNESVDATHLAEFHQIEGVIADVNLTLGDLMGVLNSFFSKLGMKNLKFKPTYNPYTEPR--LQKWIEVGNSGIFRPEMLRPMGFDVSVLAWGLSLERPTMIKYKINNIRDLVGHKVDLNMIYSN. 452
69 1.000e-96UniRef50_A0A1D2W6I2 Phenylalanine--tRNA ligase alpha subunit n=3 Tax=Methanobacteriaceae TaxID=2159 RepID=A0A1D2W6I2_9EURY  ali  19  224.GSWKNLKFRGYDVHAEYPDFFPGKMHPLQRTIEDIRQIFLKMG--FTESKGSILESAFWNFDCLFQPQDH-----AAREMQDTFYIKEPRTVNLPLVENVRRAHENGGATGSWGYSWDVDVAKQSVLRTHTTCLSTRYLAEH----EPPIKMFSVGRVFRRETITYKHLPEFHQVEGIVAAEDLTFKNLLGYLKEFYRKLGFKA-RFRPAYFPYTYLSVEKKTWIELGGSGMFRPEVLEPLGVETPVAAFGIGIERLAMLRLGIKDIRMLYKSDI......... 498
70 1.000e-96UniRef50_Q648W3 Phenylalanine--tRNA ligase alpha subunit n=9 Tax=Archaea TaxID=2157 RepID=Q648W3_9ARCH  ali  19  250.GSWRGRKFKRYDVNLASKEVFPAKIHPYQRLLDRMRRIFTEMG--FVEIKGEVVQSAFWNFDALFVPQDHP-----AREMQDTFYLAARKPIDAPEIKNVEQMHEHGGSLNSTGWGWKRELGEELLLRTHTTAVTLSYLASH---LEPPVKVFCIDRVYRRETIDPTHIPEFDQLEGIVMDKGVTFSNLLGCLATFYNKIGFPSIRFRPGYFPYTEPSVEVRGWIELGGAGIFREEVTNPVGVDYPVLAWGLGIGRLAMISLGLTDIRDLYQPDIDLRNARI.. 532
71 2.000e-96UniRef50_J4GU14 Uncharacterized protein n=50 Tax=Agaricomycetes TaxID=155619 RepID=J4GU14_9APHY  ali  17  207.GSWKTATYKKYNFEAEGLQSNGGALHPLLKVREEIRNIFLEMG--FAEMTSCFVESGFWCFDALFVPQQHP-----AREVQDTFYLSDPATSLPP---PAAYYSRVSKVHEHGGYGWSDAESRKLLLRTHTTASSAAMLWKLAARCRGPAKLFSIDRVFRNETMDATHLAEFHQVEGVVADRGLTLADLIGFMRVFFKKMGIENLRFKPAYNPYTEPSLEIRKWVEVGNSGMFRPEMLEPMGFDVHVHGWGISLERPTMIRYGINNIRTLVGHKVAIEAVE... 523
72 2.000e-96UniRef50_Q382C5 Phenylalanyl-tRNA synthetase alpha chain, putative n=31 Tax=Trypanosomatidae TaxID=5654 RepID=Q382C5_TRYB2  ali  15  199.GSWRTTEFKAYNLAAAGREVSCGQLHPLLKVRQEFREIFMEMG--FQEMTDHWVESSFWNFDSLFIPQNHP-----ARDMQDTFFISKPA---TSELKQQDVVENVRKMHEKNFYTWKESEARRNVLRTHTTSCSAFWLHHLARNSPLPGRYYSIDRVFRNEEMDRTHLCEFHQIEGCVIDRNISLANMMHTFELFFRRIGVERLRFKPVFNPYTEPSMEIFGWIEVGNSGLFRPEMLVPLGFDVTVMAWGLSLERPTMIKYGLSSIHELFGHKVDLRFIRN.. 490
73 2.000e-96UniRef50_W9Y160 Phenylalanyl-tRNA synthetase alpha chain n=47 Tax=Eukaryota TaxID=2759 RepID=W9Y160_9EURO  ali  17  196.GAWKTAQLKPYNFKAKGTPAAAGALHPLNKVRQEFREIFFEMG--FEEMTNRYVETGFWNFDALFVPQQHP-----ARDLQDTFYISDPAKADPPYWDDVRAVHETGKGSIGYRYPWSADESLRLVLRTHTTAISTYMLHKLAQN-PRPARYFSIDRVFRNESVDQTHLAEFHQVEGVIADWGLTLGGLIGFMEVFFGKMGIKNLRFKPAYNPYTEPSMEIKKWVEIGNSGMFRPEMLEPMGLDMRIYGWGLSLERPTMIKYGVNNIRELLGHKVDLNFIKQN. 512
74 2.000e-96UniRef50_Q4WI02 Phenylalanyl-tRNA synthetase beta chain cytoplasmic n=11 Tax=Aspergillus TaxID=5052 RepID=Q4WI02_ASPFU  ali  19  195.GSWKTVTLKPYNFKAKGAPTPAGAFHPLNKVRQEFRNIFFEMG--FEEMTNRFVETGFWNFDALYVPQQHP-----ARDLQDTFYISDPATADPPREDPLNDPHRLKSVHEKPLYPWNADEALRLVLRTHTTSVSTYVLHKLAAN-PRPARYFSIDRVFRNEAVDATHLAEFHQIEGVIADFGLTLGGLIGFMEVFFAKMGIHQLRFKPAYNPYTEPSMEIGKWVEIGNSGMFRPEMLEPMGIDMRVYGWGLSLERPTMIKYGVSNIRELLGHKVDLNFIETN. 510
75 4.000e-96UniRef50_A0A0K0DL13 Uncharacterized protein n=3 Tax=Eukaryota TaxID=2759 RepID=A0A0K0DL13_ANGCA  ali  16  162............................ITQVRSEFREIFFSMG--FSEMTNRYVESSFWNFDALFQPQQHP-----ARDAHDTFFISDPAEFPKDYLERVKAVHSKGGGSIGYNYDWKIEEAQKNVLRTHTTAISARQLFKLAQEGFRPTKMFSIDRVFRNETLDATHLAEFYQVEGVIAERNLSLSHLIGVFTEFFKKLGIEDLRFKPTYNPYTEPSMEIKKWVEIGNSGMFRPEMLLPMGLDVNVAGYGLSLERPTMIRYGINNIRDLFGPKVDLQMIYD.. 423
76 4.000e-96UniRef50_A0A1E4FVX4 Phenylalanine--tRNA ligase n=1 Tax=bacterium SCN 62-11 TaxID=1660156 RepID=A0A1E4FVX4_9BACT  ali  17  215.GEWRNVDFRPYDVSLASEAVYPGKEHPFVSIIAQTRKVFLELG--FEETVSPYVESSFWDFDALFQPQDHP-----ARDMQDTFYISKPAECKLPRQEWVDEVHRNGGQTGSLGYDWNDKLIKQPVLRTHTTASSIRALAENPN---PPRKVFCVGPVFRRETVDYKHLPVFHQVDGIIIDEKASFASLLGTLEAFYRKMGFKKFQFRPAFFPYTEPSVEKEDWVEMGGAGVFRPEVTEPFGCKVPVLAWGLGLERLAMFRYELGSIGELYRARLN........ 492
77 4.000e-96UniRef50_A0A2U9CQN9 Putative interleukin enhancer-binding factor 3 n=1 Tax=Scophthalmus maximus TaxID=52904 RepID=A0A2U9CQN9_SCOMX  ali  15 1063.GSWKEKKFKPYNFDAMGVAPDCGHLHPLMKVRTQFRQIFLEMG--FTEMTNNFIESSFWNFDSLFQPQQHPARDQ-----HDTFFLSDPAEFPQDYLERVKKVHSEGGFGSQGYYDWKIEEAQKNILRTHTTAVSARMLYKLAQQEKFPVKYFSIDRVFRNETLDATHLAEFHQIEGVVADYGLTLGDLMGILHQFFTKLGITKLRFKPAYNPYTEPSMEVKKWVEVGNSGVFRPEML------------------PTMIKYGINNIRELVGHKVNLQMVYD.. 1332
78 4.000e-96UniRef50_D3E4E7 Phenylalanine--tRNA ligase alpha subunit n=53 Tax=Archaea TaxID=2157 RepID=D3E4E7_METRM  ali  19  226.GSWAKLKYRPYDINAEYPIFFPGKEHPLRRIIQEIREIFLNLG--FTEAKGEYLESAFWNFDSLFQPQDH-----AAREMQDTFYVKNPLTCDLPLVERVAKTHEDGGNTNSEGYDWDADIARQSVLRTHTTGISTQALAN----WELPIKMFSVGRVFRRETFDYKHLPEFHQVEGLVAAPGINYQNLLGTLKEFYKKLGFE-VRFRPAYFPYTYLSEEKESWIELGGCGMFRPEVLEPLGVKVPALAFGLGIERLAMIRYDLSDIRMLYKSDIWLREVPLE. 509
79 5.000e-96UniRef50_A0A1Z8YMJ3 Phenylalanine--tRNA ligase subunit alpha (Fragment) n=1 Tax=Euryarchaeota archaeon TMED85 TaxID=1986696 RepID=A0A1Z8YMJ3_9EURY :_  ali  20  102.GEWKDKSFQRYGVETKVEVEDFSTLHPLTRFTEDIRSIFLQMG--FTEIEGDYVESAFWNMDALFIPQDHP-----ARELQDTFYLSEFVINEKEIVESVKEIHENGGNTGSKGWGWSKETAQQALLRTHTTVGTIRYL---ADNPTPPARVFSVGRVFRREALDSTHLPEFTQVEGIIVEPEANFGMLIGVLKEFYRRMGFNDVRVRPAYFPYTEPSKFGDKWLELGGAGIFRPEVTAPFGIDCPVLAWGLGLERLAMLHLDIKDIRMLYQSDL......... 376
80 5.000e-96UniRef50_A0A060HBR9 Phenylalanine--tRNA ligase alpha chain n=3 Tax=TACK group TaxID=1783275 RepID=A0A060HBR9_9ARCH  ali  17  218.GKWKGVEFSALDVEAPAPAVYPGRSHPLVDIIEEVKEIFVGLG--FSEIDGPMVQSGFWNFDALFTPQDHP-----AREMQDTFYISGERQA---IPAGKEQIAKVSGVHKSGWGGWKPEEAERVVLRTHTTPVTLQHLAKKKPEVA---RFFSVGRVFRNEKVSYKHLVEFHQVEGVATAPKASLRDLMGLQKEFYARMGIKKVKFWPTFFPYTEPSDRLQKWVELFGMGIFRPEVTRPLGIKNPVLAWGGGLERIAMLRFGLDDVRDLYTNRVWLRSVP... 493
81 5.000e-96UniRef50_O28324 Phenylalanine--tRNA ligase alpha subunit n=10 Tax=Euryarchaeota TaxID=28890 RepID=SYFA_ARCFU  ali  16  191.GTWRGKQFLKYDITIPAKEIYGGKIHPYERIIEECRKVFLEMG--FTEIKGHYVQPAFWNFDALFQPQDHP-----ARDMQDTFYLDRYIDLEGEIVERVKATHENGWITGSTGWGWSLEKARQLVLRTHTTAITIHYLAEN---PEPPQKAFCIDRVYRRETIDATHLPEFDQLEGVVLDRDVGFKHLLGLLKEFFTKMGFEDVRFRPGYFPYTEPSVEGLGWVELGGAGVFRKEVTEPLGIRGKVLAWGLGIGRLAMLKIGLKDLRRLYLPDL......... 463
82 5.000e-96UniRef50_A0A1Q9N5P2 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Candidatus Odinarchaeota archaeon LCB_4 TaxID=1841599 RepID=A0A1Q9N5P2_9ARCH  ali  17  223.GGWRKAEFKKFDLESPVSRIYPGKLHPITLLIDEIREIFLEFG--FEEIESPLVENTFWNFDVLFVPQDHP-----ARDAWDTFYLKKPSRGDSEIILNVKAAHENGWVTGSWGYTWDRSEAEKLILRTHTTAATIRY---AATNPKPPKKVFCIDRVYRNERTDYRHLAEFTQIEGIIIDENASLRELLGFLKEFYNRLGFNKIRFRPGYFPFTEPSDKLNQWIEMVGAGIFRPEVTAPLGVRTPILAWGMGFERLAMLRLDLNDVRILYRNDIWLRSIP... 506
83 6.000e-96UniRef50_A0A226EPU4 Phenylalanine--tRNA ligase alpha subunit A n=2 Tax=Bilateria TaxID=33213 RepID=A0A226EPU4_FOLCA  ali  16  210.....KKNFKPYNFNAMGTTLQGGHLHPLLKVKAEFLSILTELG--FSEMTNRFVESSFWNFDALFVPQKHP-----ARDVQDTFFLARPENCRLPDEEYVARVEKVHGDYGSDGYQWRREETQRNIMRTHTTAITGRVLYDLAQQKPKPVKKFSIDRVFRNETLDATHLAEFHQVEGFVADRGLSLGHLIGIMKEFFGRLGIDQLRFKPAYNPYTEPSLEVKKWVEVGNSGLFRPEMLRPMGLDVRIIAWGLSLERPTMIRYGINNIRSLVGHKVDLRLVYSN. 497
84 6.000e-96UniRef50_G4YI34 Uncharacterized protein n=20 Tax=Stramenopiles TaxID=33634 RepID=G4YI34_PHYSP  ali  15  208..AWKKETFKPYNFKTMGLSVGGGHLHPLMKVRAEFRRVLMDMG--FQEMTNRYVESSFWNFDSLFQPQSHP-----ARDAHDTFFLTQPKHCLT---VPEDYYKRVHDMHENGGFGFKRETSMTNILRTHTTAISAQMLYKLANQPGGPQKYFSIDRVFRNESMDATHLAEFHQVEGVVADYDLSLGDLIGIIKAFFLKIGITQMRFKPAYNPYTEPSMEIKKWTEIGNSGVFRPEMLRPMGLPENVIAWGLSLERPTMIKYRLNNIRDLFGHKIDLEQTR... 497
85 8.000e-96UniRef50_A0A0F8DI86 Phenylalanine--tRNA ligase alpha subunit n=117 Tax=Dikarya TaxID=451864 RepID=A0A0F8DI86_CERFI  ali  16  200..SWDKATFKAYNFNALGADQGAGALHPLNKVRQEFRHIFFEMG--FQEMTNRYVESGFWNFDALFVPQQHP-----ARDLQDTFYISDPLVADPPRAEPTEYWDNIKAVHQDGKYPWAADEALRLVLRTHTTAISTAVLRRLAAQKGPPARYFSIDRVFRNEAVDATHLAEFHQVEGVIADYNLSLGGLMEFMEIFFNKMGLKDLKFKAAYNPYTEPSMEIGKLVEIGNSGMFRPEMLESMGLDLRVYGWGLSLERPTMIKYGISNIRELLGHKVDLNFIEKN. 502
86 1.000e-95UniRef50_A0A1V4UZ63 Phenylalanine--tRNA ligase alpha subunit n=3 Tax=Methanomicrobia TaxID=224756 RepID=A0A1V4UZ63_9EURY  ali  18  76.........RPYDVSLPADRIFPGKRHPYQRLIDNMREIMLEMG--FVEIKGPIVQTSFWNFDALFQPQDHP-----AREMQDTFYLN--SQGDIPDYARIKEMHECGGSVGSTGWGWSPEVARQEVLRTHTTGVTIKYLAEHPR---PPVKAFGIDRVYRREAIDSTHTPEFEQLEGIVMDESVSFCHLLGILKEFYGKMGFEEVRFRPGYFPYTEPSVEGLGWVELGGAGVFRKEVTAPFGIDHPVLAWGLGVSRVAMLRLGLKDLRLLYQSDIWLRQTPVSI 348
87 1.000e-95UniRef50_C5LM70 Phenylalanyl-tRNA synthetase alpha chain, putative n=1 Tax=Perkinsus marinus (strain ATCC 50983 / TXsc) TaxID=423536 RepID=C5LM70_PER  ali  16  223...........YNLTALARDLGGGHLHPLLKVKTEIRNILLLMG--FEEMTNRYLESSFWNFDALFQPQQHP-----ARDAHDTFFITSPARIPEDYMNAVKNMHEVGGYGSIGWYDWSEKESRKNILRTHTTAVSTRVLYEMRTGVFKPKKCFSIDRVFRNETLDATHLAEFHQVEGFVADRNLTLGNLIGVIREFFRRMGLTDLRFKPAYNPYTEPSMEIDKWVEIGNSGIFRPEMVRPMGIDVSVIAWGLSVERPTMIQYGIGNIRELFGHKMDVTSLKKN. 508
88 3.000e-95UniRef50_A0A075ANU6 Phenylalanyl-tRNA synthetase, class IIc, alpha subunit domain-containing protein n=1 Tax=Rozella allomycis CSF55 TaxID=988480 Rep  ali  17  573........FKEYNLNAMGIPPKCGHLHPLMKVREEFRNIFFVLG--FEEMTNNYVESSFWNFDALFQPQQHP-----ARDAHDTFFLKSP---KTSNKFPLDYLERVKKQHAEGGYDWKIEEAQKNLLRTHTTAVSARMLYKLAQQKEKPVKYFSIDKVFRNESVDATHLAEFHQVEGLIADYDLTLGHLIGVLDAFFKMLGLTDLEFKPAYNPYTEPSMEIKKRIEVGNSGIFRPEMILPMGFDVTVIAWGLSLERPAMIKYGYNNIRDLVGHKVPIESIERD. 856
89 4.000e-95UniRef50_F4PXN0 Phenylalanyl-tRNA synthetase n=1 Tax=Cavenderia fasciculata (strain SH3) TaxID=1054147 RepID=F4PXN0_CAVFA  ali  16  600..SWKDETFK-FNTLSMGTKPDSGFRHPLNKVKAEFKQIFIEMG--FEEMTSNYVENSFWNFDALFQPQQHP-----ARDAHDTFFLSDPKTSHDFTDEHLEKVRKVHGGYGSWGYDWKLEEAEKNILRTHTTAVSSRMLYKLANQPGGPKKYFSVDRVFRNESLDATHLAEFHQVEGLVAGYDISLSNLIGIFSEFFKRLGIEDIQFKPAFNPYTEPSMEIFGRMELGNSGLFRPEMLLPLGLPVQVAAWGLSLERPTMIKYGLNTIRDIFGNNLNIEFIQSN. 888
90 4.000e-95UniRef50_A0A0V1AYJ8 Phenylalanine--tRNA ligase alpha subunit B n=21 Tax=Trichinella TaxID=6333 RepID=A0A0V1AYJ8_TRISP  ali  15  200...WKEKKFKPYNFNAFGVVPVRGYLHPLMKVRTEFRQIFLEMG--FTEMTQRYVESSFWNFDALFQPQQHP-----ARDEQDTFFISKPMCTKNLPSEYVKRVEKVHSVGDYGGYEWKIEEAEKNVLRTHTTASSIRMLYEIAKKPFKPVRYFSIDRVFRNESLDATHLAEFHQVEGLIAGENLSLGHLMGILQEFYKRLGIEKLRFKPAYNPYTEPSMEIKKWVEIGNSGMFRPEVLLPLGLNVTVIAWGLSLER............................ 460
91 7.000e-95UniRef50_UPI000626BA27 phenylalanine--tRNA ligase alpha subunit isoform X2 n=2 Tax=Orussus abietinus TaxID=222816 RepID=UPI000626BA27  ali  16  153..............................KKRKLLHQIFLEMP------TNNFVESSFWNFDALFQPQQHP-----ARDAHDTFFVSEPRI---STKFPEEYLKRVKKVHSKGGYDWKIEEAQKNLLRTHTTAVSARMLYKLIQEGEKPVRYFSIDRVFRNETLDATHLAEFHQVEGVVADYNLTLGDLIGTLYEFFKKLGITQLDFKPAYNPYTEPSMEINKWIEIGNSGMFRPEMLLPMGIPENVIAWGLSLERPTMIKYGINNIRDLVGPKVDLQMVHDN. 409
92 7.000e-95UniRef50_O26837 Phenylalanine--tRNA ligase alpha subunit n=8 Tax=Euryarchaeota TaxID=28890 RepID=SYFA_METTH  ali  18  223.GAWRKLHYRGYNIDAEYPLVYPGKMHPLRRIIDEIRSIFLKLG--FTESRGPIVESAFWNFDCLFQPQDH-----AAREMQDTFYVKNPAVTDLPLVRAVQDAHETGGSTGSEG--WQYEWDRDVVLRTHTTCVSARFLSEN----EPPLKMFSVGRVFRRETITYKHLPEFHQVEGIVAGDEVNFRNLLGILREFYRKLGFE-VRFRPAYFPYTYLSPEKKSWIELGGAGMFRPEVLEPLGVETPVAAFGLGIERLAMIRFDIKDIRMLYQSDLWLRGLPV.. 505
93 7.000e-95UniRef50_A0A1J4UGC1 Uncharacterized protein n=2 Tax=unclassified Candidatus Micrarchaeota TaxID=1801634 RepID=A0A1J4UGC1_9ARCH  ali  17  201.GSWKGAHLREYNISAPSEEPLIGKRHIIAKLAKKISGIFTEMG--FEEMEGGMIESSFWNFDALFQPQDHP-----ARDLADTFYLEG----DSPLPKDSELVKRVKRSHQKGWYSWQKKEAEKAILRTHTTCVSARTLYEKCTGKKEGRKFFSIGKVFRNEATDYKHLAEFFQVEGIVMWEDATFSHLMGFLTEFYKKMGFEKIRFVPSFFPYTEPSLEKKCWMELGGAGIFRPEVSIPLCGRYPVLAWGLSLERPLMLSLGIEDIRSFYKNN.......... 471
94 9.000e-95UniRef50_A0A1Y2K4Q3 Phenylalanine--tRNA ligase alpha subunit n=3 Tax=Proteobacteria TaxID=1224 RepID=A0A1Y2K4Q3_9PROT  ali  17  227.GSWRNYQFRPYDVTLDSFKVAPGKVHPLIRMMEKTRRVFLEMG--FEEIESGYVDSSFWVFDALFQPQDHP-----AREMQDTFYVSNPGICDLPEVEAVRATHENGGETGSIGYDWSARVASTPVLRTHTTAATIRALGENPN---PPRKIFCVGPVFRRETVDYKHLPMFHQVEGVVVDKEASFAQLLGILKVFYGKMGFDKLQFRPAYFPYTEPSVEKQDWVELGGAGMFRPEVTEPMGCQTPVLAWGLGLERLAMISYGLSNLSQLYQARLN........ 504
95 9.000e-95UniRef50_A0A0R0M5F8 Phenylalanine-tRNA synthetase, alpha subunit n=1 Tax=Pseudoloma neurophilia TaxID=146866 RepID=A0A0R0M5F8_9MICR  ali  16  187.GEYKNVDFKPYNFKTALRK-ESGSLHPLRKVQTEIRNIFLELG--FTEMTNNYVESSFWNFDALFQPQNH-----SAREMHDTFFISDPSTYENPI--DPDLLKAVKEQHEKYLYDWSEKEARKNILRTHTTASSAKMLYKIAEDAKKACKLFSIDRVFRNESVDATHLAEFHQIEGLVLGKNLSIGHLMGVLNDFFIKLGLKDVSFKPTYNPYTEPSLEVGKLIEVGNSGIFRPEMLEPLGIEWRVIAWGLSLERPAMIKYGLNNIRELLGHKSDLKFIKD.. 475
96 1.000e-94UniRef50_A0A2J6WSJ9 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Aciduliprofundum sp. TaxID=2060325 RepID=A0A2J6WSJ9_9EURY  ali  19  202.GSWKNKELKRYDIRMFTPLPDMGREHPISEFISRVRRIFLSMG--FMEIDGDYIVPAFWNMDALFIPQDHP-----ARDMQDTFYMD--SVGNLPYAQTVKKIHENGGGISRGWYSWDSNLAVKNILRTHTTVNSIKYLYDHREED--IIRVFMIGRVFRRENMDPTHLPEFHQIEGIMVEPGSNFSMLLGTLHRFYSSLGFEKIKFKPSYFPYTEPSVEVGGWLELGGAGVFRPEVTLPLGIKNRVLAWGLGLERLAMLYYGLKDIRDLYIADLD........ 473
97 1.000e-94UniRef50_B0ERP0 Phenylalanyl-tRNA synthetase alpha chain B, putative n=11 Tax=Eukaryota TaxID=2759 RepID=B0ERP0_ENTDS  ali  18  189.GSWKDANWKEYNFNALGVYPKGGSRHQLSKVRMNFKNIFLEMG--FEEMTDMYVESSFWNFDSLYQPQQHP-----ARDAQDTFFLNEPATTSSADMNP-DYVARVKGDFGSIGWDWKVEEAQKTILRTHTTAVSSRTLAKLAAEPFKPIKCFSIDRVFRNETVDQTHLAEFHQIEGFIADRNIGLPQLIAVIKEFFTKMGLPDVRFKPAYNPYTEPSMEIGKFVEVGNSGVFRPEMLRTMGVDITVIAWGFGLERPTMISYGIKSIRSIFGPKTDLDFIKN.. 485
98 1.000e-94UniRef50_A0A2H9KZ25 Phenylalanine--tRNA ligase subunit alpha n=1 Tax=Candidatus Micrarchaeota archaeon CG10_big_fil_rev_8_21_14_0_10_45_29 TaxID=1974  ali  17  208.GSWKGKTFRKYGIGGDFPSTPAARRHPISRLREKICQIFSQMG--FEQMEGPLIESAFWNFDALFQPQDHP-----ARDLADTFYIDAPSPLPNPAL-----VKKVAEAHGGWGYEWESSAAQESVLRTHTTAVSARTLHDLQKD-PAPKKFFSIGKVFRNEATDYKHLAEFFQVEGIISWEGAQFPHLLGTLKAFYQKLGFEKIRFRPSFFPYTEPSLEIKEWIELGGAGILRPEVTLPLCSKYPVLAWGLSLERPLMLSGKISDIRTLYRNDL......... 477
99 1.000e-94UniRef50_A0A287UTW4 Uncharacterized protein n=9 Tax=Eukaryota TaxID=2759 RepID=A0A287UTW4_HORVV  ali  15  52.GDWKDLEFKDYNYGAQGQPIAIGYSQPLLEVLEAIQNIFVEMG--FSEMTNMFVESSFWNFDALFQPQQHP-----ARDSHDTFFLKAP--ATTPQL-PDDYLEKVKQVHKGYGYDWKRDEAEKNLLRTHTTAVSTRMLYKVVQNSFAPKRYYSIDRVFRNEAVDRTHLAEFHQIEGLICDYGLTLGDLIGVLEDFFSRLGMSKLRFKPAYNPYTEPSMEIKKWMEIGNSGMFRPEVLLPMGLPVNVIAWGLSLERPTMILNGINNIRKLFGPKVNFKVIKNR. 341
100 1.000e-94UniRef50_Q2FLL0 Phenylalanine--tRNA ligase alpha subunit n=52 Tax=root TaxID=1 RepID=SYFA_METHJ  ali  18  193.GAWKDLSLRRYDITKHPRPVWPGKIHPYQRMIDEMRRILLDMG--FTELHGSIIQGAFWNFDALFQPQDHP-----AREMQDTFHLAGKQE--LPVWEKVRDMHESGGETSSTGWKWDPEKAKATVLRTHTTSLSIQHLAAH---PEPPVKAFCIGRVYRREAIDPTHLPEFEQLEGIVMDTHVNFRNLLGYLKEFYGRMGFESVRFRPGYFPYTEPSVEGLGWVELGGAGIFREEVTAPWGITCPVLAWGLGVSRVAMLRMGLTDLRELYQSDID--WVRN.. 469
101 1.000e-94UniRef50_A0A256Y4L0 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Archaeoglobales archaeon ex4484_92 TaxID=2012529 RepID=A0A256Y4L0_9EURY  ali  15  194.GSWRESEFLKYDIQLPSREVYGGKVHPYEGIIQECRKIFLEMG--FKEIKGHYVQTSFWNFDALFQPQDHP-----ARDMQDTFYLDHYLDLDRKLVDKVKKTHENGWVTGSLGWGWDTEKARQLVMRTHTTAVTIHYL---AKNPNPPQKAFCIDRVFRREAIDATHLPEFDQLEGVVLDRDVGFRHLLGLLKEFFAKMGFEDIRFRPGYFPYTEPSVEGLGWIELGGAGVFRKEVTEPLGIRGKVLAWGLGIGRLAMLKIGLKDLRKLYLPDIN........ 467
102 4.000e-94UniRef50_A0A0B3ADH8 Phenylalanyl-tRNA synthetase alpha chain n=1 Tax=Archaeon GW2011_AR3 TaxID=1579365 RepID=A0A0B3ADH8_ARCG1  ali  15  213...WKDKKFRRYDLNIPVKQLFAGRRHYVREAIEYIRKIWLDMG--FREMTGPMVQTSFWNFDALFTAQDHP-----VREMQDTFFVQNPKSGKLPLVSLVRNMHEHGGGIGSKGYQWSESEARKNVLRTHTTCLSAQTIASLKL-ADLPAKFFSVGSNFRNETLDWSHLFELHQAEGIVIDENANMRHLIGYLKEFFRKMGFDKVRARPAYFPYTEPSMEIKKWVELGGSGIFRPEVTVPLGKDIPVLAWGLGVSRIIPDYYGITDIRDLFRNDL......... 490
103 5.000e-94UniRef50_A0A0F8VJ55 Uncharacterized protein (Fragment) n=7 Tax=root TaxID=1 RepID=A0A0F8VJ55_9ARCH  ali  18  203...WENFELKPFDVSKSGPRLKAGKIHPIINLINEIREIFLSMG--FTEIRGPIIESAFYNFDALFQPQDHP-----AREMQDTFYLKNPNIAHLPERDRVKETHESGGESGSWAYEWDEKIAKKTVLRTHTTATTMRRLAQYRDNEKVPVKVFCVDRVFRNEKVDKSHLAEFTQVEGIVIDDNVNLCDLIGLLSEFYRKMGFKKIFTRPGFFPYTEPSDKLGEWLEMGGSGIFRPEVTYPWGIKEPVLAWGQGLERIAMLYYNRTDIRDFYIN........... 481
104 5.000e-94UniRef50_A0A1Q3DVF8 Phenylalanine-trna ligase n=2 Tax=Lentinula edodes TaxID=5353 RepID=A0A1Q3DVF8_LENED  ali  16  208.GTWKTSTFKKYNFEAEGIPPAGGALHPLLKVREEIRNIFLEMG--FAEMTSSFVESAFWCFDALFVPQQHP-----ARDLQDTFYISDPVKSLPPE---PSYYKRVSTVHEHGGYGWSHEESSKLLLRTHTTASSTFMLYKLAARCRGPAKLFSIDRVFRNETMDATHLAEFHQVEGVVADRGLTLADLIGFMRVFFKKMGIEKVRFKPAYNPYTEPSLEINKWVEVGNSGMFRPEMLEPMGFDVRVHGWGLSLERPTMIRYGINNIRTLLGHKVSIE...... 522
105 9.000e-94UniRef50_A0A2P6VTV7 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Thermoplasmatales archaeon SW_10_69_26 TaxID=1919232 RepID=A0A2P6VTV7_9EURY  ali  19  228.GAWKDADIRSYDVKAFASAEHPGKRHPMRDIIEKIRRIYLDMG--FHELGGHYARSAFCNLDALFIPQDHP-----AREMQDTFYLADPHDEDPEVVEKVEAVHEAGGDTGSKGWDWSREEARRTLLRTHTT---VDTITRLAQNPEAPQRVFEIGRVFRKEKIDATHLPEFHQVEGIVVEEDASLDMLVGLLETFYEKMGFDDVRVRPAYFPYTEPSLEVDEWLEMGGAGIFRPEVTEPLGVDVPVLAWGLGLERLAMVVLGLDDIRDLYMSDV......... 503
106 1.000e-93UniRef50_A0A2P4Z2P1 Phenylalanine--tRNA ligase alpha subunit n=4 Tax=Cryptosporidium TaxID=5806 RepID=A0A2P4Z2P1_9CRYT  ali  15  211..SWENSEFKPYNFNAKGKRLPRGNIHPLTRTSRKFKRILSQMG--FEEMTNRWVESSFWNFDALFQPQKHP-----ARDSHDTFFLETPMELSNDHIDKVKKVHEVGGGSIGLSYNWSIEEASKNLLRTHTTAVSVRMLYKLALSFDNFQRYFSIDRVFRNESIDATHLAEFHQVEGLIVDKNLTLADLIGTLKTFYEKIGISDLKFKPAFNPYTEPSMEIKKWIEVGNSGLFRPEMLRPLGFDIVVIAWGLSLERPTMISYNIPNIRDLFSFK.......... 504
107 1.000e-93UniRef50_L2GWY9 Phenylalanine-tRNA ligase, alpha subunit n=1 Tax=Vavraia culicis (isolate floridensis) TaxID=948595 RepID=L2GWY9_VAVCU  ali  17  215....KGLEFKEYNFNT-KIRCESGNLHPLMKVKAEVKKIFLELG--FSEMTSRYVESSFWNFDALFQPQNHP-----ARDMHDTFFLANPEKTR---LTPTSYSRRVKDVHEESYRKWSLEESLKNVLRTHTTGCSARVLYEIGQNKENPIKLFSIDRVFRNESVDSTHLAEFHQIEGLMLGKNLSIGHLMGTLQAFYEKLNLKNIKFKPAFNPYTEPSMEMNKWIEIGNSGMFRPEVLEPMGIDWRVIGWGLSLERPAMIKYSLSNIRDLLGPKVDLEFIKD.. 495
108 2.000e-93UniRef50_A0A257A8X0 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Desulfurococcales archaeon ex4484_217_1 TaxID=2012518 RepID=A0A257A8X0_9CREN  ali  19  230..EWLIKEIKPYNIKAMPPRLYPGKKHFYLEFIDMIREILLSMG--FEEAEGPIIEVELWNFDVLFQPQDHP-----AREIHDTFRLKFPMKVDENIALKVKEVHERGGKAGSRGYKWSIDVAERLILRTQTTSVSVRFLAKRK---EPPIKMFTIGKVYRPDTIDAKHLPEFHQLDGIIMDKELNFRNLLGILQEFFRKLGIEKVKFKPSYFPFTEPSVEGYGWVETFGAGMFRPEVLEVLDVKYPTAAWGIGVDRVAMIIMGIDDIRDLYSSISYLRNRRV.. 511
109 3.000e-93UniRef50_A0A0G1L921 Phenylalanine--tRNA ligase n=1 Tax=Candidatus Jorgensenbacteria bacterium GW2011_GWA2_45_13 TaxID=1618662 RepID=A0A0G1L921_9BACT  ali  18  191.GSWKKSSFRKYDASAPVEIPPIAKRHMVSRLKRKIAGIFVEMG--FEEMQGPEIQSSFWNFDALFQPQDHP-----ARDLADTFYLKAASILPS----DKAMVSRVKKVHEKWGGSWLEENAEKTVLRTHTTAVSAAYLYRHCQ-GKTPKKYFSIGKVYRNEATDYKHLAEFFQVEGIVVFEKATFRDLLGCLKEFYRKLGFKKIRFQPSYFPYTEPSEKKKQWLELGGAGIFRPEVSLPLCSRYPVLAWGLSLERPLMLLNDMDDIRDFYRSNV......... 461
110 5.000e-93UniRef50_K7EPH2 Phenylalanine--tRNA ligase alpha subunit (Fragment) n=5 Tax=Eukaryota TaxID=2759 RepID=K7EPH2_HUMAN  ali  17  116.GSWRDRPFKPYNFLAHGVLPDSGHLHPLLKVRSQFRQIFLEMG--FTEMTDNFIESSFWNFDALFQPQQHPARDQ-----HDTFFLRDPAEAQLPMVQRVKRTHSQGGYGSQGYYNWKLDEARKNLLRTHTTSASARALYRLAQKKPFPVKYFSIDRVFRNETLDATHLAEFHQIEGVVADHGLTLGHLMGVLREFFTKLGITQLRFKPAYNPYTEPSMEVKKWVEVGNSGVFRPEMLLPMGLNVSVIAWGLSLE............................. 378
111 7.000e-93UniRef50_K0IH98 Phenylalanine--tRNA ligase alpha chain n=3 Tax=Thaumarchaeota TaxID=651137 RepID=K0IH98_NITGG  ali  16  214.GRWKQTKFSALDVEAPAPAVYPGRRHPLIDIIEEVKEIFVGLG--FSEIDGPMVQSGFWNFDALFTPQDHP-----AREMQDTFYISGQRQH---IPASDEQKKRIAKVHEKGWSKWDIKEAERVVLRTHTTPVTLRHLATIKPEVG---RYFSVGRVFRNEKVSYKHLVEFHQVEGVATAPRASLRDLMGLQKEFYAKMGIKKVKFWPTFFPYTEPSERLEKWVELFGMGIFRPEVTEPLGIKNPVLAWGGGLERIAMLRFGLDDVRELYGNRLWLRSVP... 490
112 7.000e-93UniRef50_A0A2N1JAN4 Oct1p n=1 Tax=Malassezia vespertilionis TaxID=2020962 RepID=A0A2N1JAN4_9BASI  ali  16  240.GSWKNADFKGYNFNAEGAVPTAGALHPLLKVRQEFRNIFFEMG--FTEMTNRFVDSSFWCFDSIFVPQQHP-----ARDVQDTFFVADPPAAELPE-EYLKRVVEVHEKGAFGSIGYRYPFDRKLVLRTHTTAVSAAMLYAIANQPGGPAKLFSIDRVFRNESTDATHLAEFHQVEGVVADYSLTLGDLIGFMEVFFAKMGVNNLRFKPAYNPYTEPSLEIKKWVEIGNSGMFRPEMLRPMGIPVNVLGWGLSLERPTMIRYGIKDIRHLLE............ 520
113 8.000e-93UniRef50_S7WA80 Phenylalanyl-tRNA synthetase subunit alpha n=1 Tax=Spraguea lophii (strain 42_110) TaxID=1358809 RepID=S7WA80_SPRLO  ali  16  233......KNLKDYNFNTAGNLPKNGALHPLNKIKEEFRQIFLQLG--FEEMTSRYVESSFWNFDALFQPQDHPS-----RDLQDTFFLSNPKTTDIPEMKKIKDIHSIGGYGSDGYKGWKEEETRKNVLRTHTTAISTKYLYEIMKQRKKPFKLFAIDRVFRNESLDATHLSEFQQIEGLVCDKNLNLSNLMGILEEFFKKLKFEKIKFKPAYNPYTEPSLEIKKWMEVGNSGIFRPEMLRPMGYDVRVIAWGLSLERPAMIKYGINNIRDLVGHTVGLDFIR... 521
114 1.000e-92UniRef50_A0A0N0BHB1 Phenylalanine--tRNA ligase alpha subunit B n=3 Tax=Aculeata TaxID=7434 RepID=A0A0N0BHB1_9HYME  ali  16  193.GAWKDKKFKPYNFDALGATLEVGHLHPLLKVRSEFRKIFLEMG--FTEMTNNFVESSFWNFDALFQPQQHP-----ARDAHDTFFIAEPSR---STNFPMEYMEKVKKVHSEGGYDWKIEEAQKNVLRTHTTAVSARMLYNLMQQGEKPVRYFSIDRVFRNETLDATHLAEFHQIEGVVADYNLTME-----------------------IFCYHEGL---KKWIEIGNSGMFRPEMLLPMGLPVNVIAWGLSLERPTMIKYGINNIRDLVGPKVDLEMVYNN. 450
115 1.000e-92UniRef50_A0A2A6D0F1 Fars-1 n=1 Tax=Pristionchus pacificus TaxID=54126 RepID=A0A2A6D0F1_PRIPA  ali  14  847.GSWKTTTFKKLNFEAMGVQPDSGHLHPLMKVRSEFRQIFFQMG--FSEMTNQYVESSFWNFDALFQPQQHP-----ARDAHDTFFISEPAKFPAEYLEKVKTVHSKGGGSDGYGYDWKEEEAQKNVMRTHTTAVSARQLYKLAQEGFKPTKMFSIDRVFRNETLDATHLAEFHQVEGVIADRNLSLSHVMGLFREFFRKCGIENLKFKPTYNPYTEPSMEIKKWVEIGNSGI------------------------PTMIRYGIDNIRDLFGSKVKLDMIYNN. 1110
116 2.000e-92UniRef50_A0A1J4JAF8 Phenylalanyl-tRNA synthetase, alpha subunit family protein n=1 Tax=Tritrichomonas foetus TaxID=1144522 RepID=A0A1J4JAF8_9EUKA  ali  16  222.GEWKDVDFAPLNFNALGSKISCGHEHPLLKVRYEFRQIFLQMG--FEEMTSKWVESSFWNFDSLFQGQQHPC-----RDMHDTFFLKTP-EYGNPIA-DQEYFQRVKTTHEKGGYEFDDKIPYTNILRTHTTAVSSRYLKMIADHYKAPRKFFSIDRVYRNETLDATHLAEFSQVEGFVIDKDLSLADLMSYIFEFFSRIGLNEIEFKPAYNPYTEPSMEIGKWIEVGNSGMFRPEMLNPMGLPENVVAWGFSLERPTMIDYKIDEIRKLEGPNVSLDLIEN.. 516
117 2.000e-92UniRef50_D8PAB6 Phenylalanine--tRNA ligase alpha subunit n=38 Tax=Bacteria TaxID=2 RepID=D8PAB6_9BACT  ali  16  228.GAWRTKRFRKYTISLRAPRIAAGKRHPYREFLDLVKLKLVSMG--FQEMRGTLVETEFWNMDALFMPQFHP-----ARDIHDVYFVKNPTHARTPYLTQVTQVHEKGTGAGSWGYTFDAERAKRLVLRSQGTAVSARTLASGASV---PGKYFSIARCFRYDQVDATHATDFFQVEGIVLGADINFRTLLGLLNLFAREVAAKEVKFLPAYFPFTEPSVEMHGWMELGGAGLFRPEVTTPLGVSVPVIAWGLGLDRMAMVALGIHDIRDLFSADL--EFIRT.. 509
118 3.000e-92UniRef50_A0A1W9MMT9 Phenylalanine--tRNA ligase alpha subunit n=6 Tax=root TaxID=1 RepID=A0A1W9MMT9_9EURY  ali  20  212..SWEGAEFRKYDVNVFVEPQYPAKVHPLTNLINQIREIFV--GTGFKEMQGNLIEPTFWDFDALFQPQDHP-----ARDMQDTFYLKNFSEIYGFE----KFKDKVKNAHEKGWYKWNEEDAKKFILRTHTTAVSAHYLTTLKKQ-DLPAKIFTIGKVFRNETIDFKHLPEFYQVEGIIVGEDVNFRNLLGILKNFYNSLGFEKIRFRPGYFPYTEMSVEKEQWMELGGAGIFRPEVVKPLGFECPVLAWGLGLDRIAALRLNLSDIRDLYISDID--WLRKN. 489
119 3.000e-92UniRef50_A0A2A5P130 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Candidatus Geothermarchaeota archaeon ex4572_27 TaxID=2012530 RepID=A0A2A5P130_9  ali  17  245.GRWRGVEFKEYDVSMPAPPVYGGKRHPLHQLIDEIREIFVSMG--FIEEWGPLIELAFWNFDALFQPQDHP-----AREMHDTFYLKEPLDGLGEVVERVRRTHEDGGDTGSRGYRWRLEEAARYVLRTHTTAVTARKVYEY---GERPVKIFAIGKVFRNETVDYKHLPEFYNVDGIVIDPRTNLRELLGVLKTVFERLGFRRVMFRPSYFPYTEPSVEVRGYVELAGSGIFRPEVTIPLGVRWPVLAWGMGVERILMMRYGIEDIRQIYRNDI......... 522
120 3.000e-92UniRef50_A0A235BN66 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=candidate division WOR-3 bacterium JGI_Cruoil_03_51_56 TaxID=1973747 RepID=A0A23  ali  15  226.GKWRDVVLKRYDPGLETAPRYPGKPHPLQRIIQETRRAFFEMG--FEEAASPVVETAFWDFDALFQPQDHP-----AREMQDTFYMRKPVQGRLPLVMRVGRTHENGGGTGSTGYEWNRSLAKRLVMRTHTTATTIRAL---AANPEAPRKVFCVGKVFRRENIDPTHLPEFVQIDGVIIDEQASFATLLGTLQEFYRKMGAEELKFRPSFFPYTEPSVEVGAWIEMGGAGIFRPEVTLPLGCKAPVLAWGLGLERLVMLRFGVPDMRKLYWCDID........ 503
121 5.000e-92UniRef50_J8ZYS9 Phenylalanine-tRNA ligase, alpha subunit n=1 Tax=Edhazardia aedis (strain USNM 41457) TaxID=1003232 RepID=J8ZYS9_EDHAE  ali  16  188.......KFKKYNFDTVGNLPEKGNLHPLMKVREEFRSIFLTLG--FTEMTNKYIESSFWNFDALFQPQNHPS-----RDSHDTFFIENPIDADNRYINKVKNIHEKGG-HGSLGYTWNIEEARKGILRTHTTSCSARHLYNEKLKKNKVYKLFSIDKVFRNETVDATHLAEFHQIEGVIIGENLTLGQLMGVIDEFYQRLGLRQIKFKPAFNPYTEPSMEMKKWIEIGNSGIFRPEMLKPMGFDITVFGWGLSLERPTMIKYNIKNIRDLVGHKVKLNFIK... 487
122 6.000e-92UniRef50_A0A147JWP5 Phenylalanine--tRNA ligase alpha subunit n=8 Tax=Euryarchaeota TaxID=28890 RepID=A0A147JWP5_9EURY  ali  18  257.GRWREVRLKKYDVTAPGVPIYPGKAHPLQQMIEELREILLEMG--FVEIKSRIVESEFWNFDALFQAQDHP-----AREIHDSFSLSRPRQTSLP---PPDLLNRVVRAHERGSTGWKYKFNTDVSRRPQTTAATVRYLSSH---PDPPAKVFCIDRVYRHEKIDYKHLAEFYQAEGIVMDKGLTLRDMLGYLKQIMVKLGLPKIRFRPGYFPYTEPSVEKKEWLEILGAGMFRPELLRPLGIRYPVLAWGIGFSRLSMIRLEIDDIRDLYNNDI......... 532
123 1.000e-91UniRef50_A0A1D2R333 Phenylalanine--tRNA ligase alpha subunit n=7 Tax=Euryarchaeota TaxID=28890 RepID=A0A1D2R333_9EURY  ali  19  223.GKWQEVELRRYNVDTFAPKMYGGAVHPMQRLILKIRDIFLQMG--FTEIETDFIHSCFWNMDALFIPQDHP-----ARDAQDTFYLKKPARLKLDETQKIKDMHEQGGPSTGWRYRWDLREAEKAILRTHTTVNTIKYLSEN---PDPPVKVFSVGRVFRREALDSTHLPEFQQIEGIVMEEGANLRMLIGILTEFYKKIGFEKIRIRPGYFPYTEPIQLGGKWLEYGGAGIFRPEVTSPFGVKHPVLAWGLGLERLVMLRYDIKDIRNLYFNDI......... 496
124 1.000e-91UniRef50_A0A2D6WQ32 Phenylalanine--tRNA ligase n=150 Tax=cellular organisms TaxID=131567 RepID=A0A2D6WQ32_9BACT  ali  19  217..EWKTAEFRSFDVTLEAATPRTGRSHPMQALIERIRAIFLEMG--FSELVDDYVQSAGWNMDALFIPQDHP-----AREMQDTFYLDQPSSIDLDVLQAWKAIHEHGGETGSTGWGYSTEVSQRPLLRTHTTVNTIQYLAEHPTEA---CRVFSVDRVFRKEAIDRTHLPEFHQIEGIIMEEGANLQMLVTTLKTFYAKMGYPEVRVRPAYFPYTEPSLEIGKWLELGGAGIFRPEVTEPLGITSPVLAWGMGLERLAMLVLGLDDIRQLYISDL......... 489
125 1.000e-91UniRef50_A0A2H9MF56 Phenylalanine--tRNA ligase alpha subunit n=8 Tax=Archaea TaxID=2157 RepID=A0A2H9MF56_9ARCH  ali  17  215...WKTQLIRPYDVTLPSTKINPGKKHYITQIIEYIRGIWTDMG--FKEMTGPLLDISFWNFDSLFQPQDHP-----ARDLADTFYMKIPEKGKLPLVEKVKLTHENGWDTGSLGYKWNPEFARRCVLRTHTTSLSARTIAKLKSE-DLPVKYFAVGRCFRNETLDWKHLAEFYQTEGIVVGEDVTFRQLQGYLRRFFEKMGFPKTRFRPGYFPYTEMSLEVKQWMELGGSGIFRPEVVKPLGKDVPVLAWGLGFDRIIMDKYKVDDIRKLYLSDL......... 492
126 1.000e-91UniRef50_A0A1W2THC7 Putative phenylalanyl-tRNA synthetase alpha chain n=27 Tax=Fungi TaxID=4751 RepID=A0A1W2THC7_ROSNE  ali  19  205.GRWQSVTFKKYNFNALGARQSHGAFHPLMKMREEFRQIFLQLG--FEEMSNQFVESGFWNFDTLFVPQQHP-----ARDMQDTFYLEDPVKIGSPHLGPGEYYQQYNIKEVHQRYPWSEDECLKLVLRTHTTAISTAMLHKLATETGGTARYFSIDRVFRNESVDATHLCEFHQVEGVIADYGLTLGGLMEFLTTFFEKMNVTNLQFKPAYNPYTEPSLEIGKIIEIGNSGLFRPEMLEAMGLDKNVYGFGLGLERPTMLKYGLTNIRELLGHQVDITSIQNN. 508
127 2.000e-91UniRef50_A0A0B3APE0 Phenylalanyl-tRNA synthetase alpha chain n=2 Tax=Archaea TaxID=2157 RepID=A0A0B3APE0_ARCG7  ali  18  110.GAWAKASFRRYDVATNVPQIHGGRRHYVEQAISHIKRIWLDLG--FTEMEGNLVQTAFWDLDALFVPQDHP-----AREMQDTFYLKEPSSGKLPKAQKIKDMHEHGGNTGSKGWGWSADLASKNLLRTHTTVLSAQTIAAL-KDSDIPAKYFTVGRVFRNEALSWKHLFEFTQVEGIVVDPEANFKHLKGYLSEFFQKMGFEKVRIRPAHFPYTEPSAEKKTWVELGGAGIFRPEMVVPLGKDVPVLAWGLGLERSIMEYYGFNDVRLLYQNDL......... 388
128 3.000e-91UniRef50_A0A2N1PRG6 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Candidatus Wallbacteria bacterium HGW-Wallbacteria-1 TaxID=2013854 RepID=A0A2N1P  ali  15  234.GKWRDVIFRKYDVQADAELIEQGKFHPFMKIIDQTRKVFLEMG--FDEVESPYAESGFWDFDALFQPQDHP-----AREMQDTFFLERPGTCSLPSAELVKNVHENGGSTGSWGYKWGEEKAVQAVLRTHTTASTIRAL---SRNPEPARKVFCVGRVFRRETIDYKHLPVFFQVDGIIIDKKANFASLLGTLEAFYRKMGFEKFQFRPAFFPYTEPSVEVRDWMEMGGAGIFRPEVTEPLGCDCPVMAWGLGLERIAIFRYGLNDIREIYMPDIWLREVP... 517
129 4.000e-91UniRef50_H8Z9Z9 Phenylalanyl-tRNA synthetase subunit alpha n=6 Tax=Nematocida TaxID=586132 RepID=H8Z9Z9_NEMS1  ali  17  199...ELAKNLKKYNFNIVTPSKYAGALHPLSMEREKVKNIFLQMG--FEEMDGKYIESSFWNFDALFQPQRHPARNE-----QDTFFMEDPANAKDPELERVRMVHTVGGFGSSGYKAWSLEESRKNVLRTHTTAVTTRLLYKKAQEHEYSRKYFSIDRVFRNETLDATHLAEFHQVEGIIMGVGLTISHLMGFMEEFFKNLGITKIKYKPAYNPYTEPSMEVFGWMEIGNSGMFRPEMLLPMGYPENVIGWGISLERPVMIGRQMNNIRDLVGHRVDLSFIRN.. 494
130 4.000e-91UniRef50_A0A1L1RLP1 Phenylalanine--tRNA ligase alpha subunit n=6 Tax=Euteleostomi TaxID=117571 RepID=A0A1L1RLP1_CHICK  ali  19  3..................................................TDNFVESSFWNFDALFQPQQHPARDQ-----HDTFFLQDPAEA--PEL-PANYMARVKKVHSQGGYGWKVEEARKNLLRTHTTSASARALYHLARQGKFPVKYFSIDRVFRNESLDATHLAEFHQVEGVVADRGLTLGHLMGTLQQFFTKLGISKLRFKPAYNPYTEPSMEVKKWVEVGNSGVFRPELLLPMGLPVSVIAWGLSLERPTMIKYGINNIRELVGHRVNLQMIYDN. 245
131 8.000e-91UniRef50_A0A136JXQ0 Phenylalanine--tRNA ligase alpha subunit n=2 Tax=Nitrospirae TaxID=40117 RepID=A0A136JXQ0_9BACT  ali  16  228.GTWRTKRFRKYTISLRAPRIAAGKRHPYREFLDLVKLKLVSMG--FQEMRGTLVETEFWNMDALFMPQFHP-----ARDIHDVYFVKEPTHARSPYLTRVVQAHEKGTGAGSTGWGYQFDVERRLVLRSQGTAVSARALAGGASV---PGKYFSIARCFRYDQVDATHATDFFQVEGIVLGADINFRTLLGLLNLFAREVAAKEVKFLPAYFPFTEPSVEMHGWMELGGAGLFRPEVTTPLGVSVPVIAWGLGLDRMAMVALGIHDIRDLFSADLDVRTMRGN. 513
132 8.000e-91UniRef50_G7YMK7 Phenylalanyl-tRNA synthetase alpha chain (Fragment) n=6 Tax=Eumetazoa TaxID=6072 RepID=G7YMK7_CLOSI  ali  17  210.GSWKTTRFKAYNFNALGAALPSGHLHPLLRVREEFSKILSDMG--FTEMTNNYIECSFWNFDSLFQPQQHP-----ARDAHDTFFISDPATTELSRVAPADYVDRVSKVHSQGSFGWLVSEAEKNLLRTHTTAVSARMLYALAKQTPIPVRYFSIDRVFRNETLDATHLAEFHQVEGLVADFGLGLGHLKAVIRAFFNKLGLTKLRFKPAYNPYTEPSMEIQKWVEIGNSGIFRPEMLRPMGLPETVIAWGLSLE............................. 475
133 8.000e-91UniRef50_A0A1V0N2M0 Phenylalanyl-tRNA synthetase subunit alpha n=3 Tax=Thermoplasmatales TaxID=2301 RepID=A0A1V0N2M0_9EURY  ali  19  202.GKWRDAKFRPYDLNSRVEPLNGAGLHPLTYLIEKVRKIFLEMG--FTEMHGHFIEYTGWNMDMLFIPQDHP-----ARDLQDTYYVKNPVEFENPILDKVKRVHEHGYGKYSGWYKWSEDEAKKLILRTHTTVNTIRYLYNHRD---KPQYIFSIEKVFRHESVDWKHLSELYQIEGAVYGSDVNLSTLKWLLTEFYSRLGFKNIRLIPSYYPYTEPSDINGKEVELGGSGIFRPEVTKPMELKEPVLAFGLGLERLAMLYYNFNDIREIYNSDLD........ 476
134 8.000e-91UniRef50_A0A1B8DJE2 Carbamoyl-phosphate synthase, large subunit n=11 Tax=leotiomyceta TaxID=716546 RepID=A0A1B8DJE2_9PEZI  ali  15  203.GAWKTAAFKPYNFKALGADQHAGALHPLNKVRTEFRQIFFEMG--FEEMTDKFVETGFWNFDALFVPQQHP-----ARDLQDTFYISDPKQGD----EAPRGDGKYGSIGYR--YPWSADETLKLVLRTHTTSISTHMLYKLAQTKGPPARYFSIDRVFRNETVDATHLAEFHQVEGVIADYDLTLGGLMEFMTIFFNKMGITDLRFKPAYNPYTEPSLEIFSFVEIGNSGMFRPEMLESMGLDMRVYGWGLSLERPTMIRTKCSNIRELLGHKVDLGFIQ... 485
135 9.000e-91UniRef50_A0A1B0CKY7 Uncharacterized protein n=1 Tax=Lutzomyia longipalpis TaxID=7200 RepID=A0A1B0CKY7_LUTLO  ali  14  193...........YNFDALGATVERGHLHPLLKVRSEFRQIFLEMG--FSEMTNNYVESSFWNFDALFQPQQHP-----ARDAHDTFFLTHPSKFPMDYLERVKKVHSVGEYGSQGGYDWKLEEAQKNILRTHTTAVSARMLYNTSASIG----------VFRNETLDATHLAEFHQVEGVIADVGLTLGDLIGTLYAFFSKLGITQLDFKPAYNPYTEPSMEINKWIEIGNSGLFRPEMLLPMNLDVNVIAWGLSLERPTMVKYGINNIRDLVGPKVDLKMQEL.. 461
136 1.000e-90UniRef50_A0A075GW94 Phenylalanyl-tRNA synthetase subunit alpha (FARSA, pheS) n=1 Tax=uncultured marine group II/III euryarchaeote KM3_193_D07 TaxID=1  ali  17  83...WRDARFKPFDVNAPAPTPSGGRPHPMQALIETIRSVFLEMG--FSEIEGDFVQSAGWNMDALFIPQSHPART-----MQDTFYLSEPEQVEVDS-EYLDLWAKVHEGHDTGSRGWGGEFDRDELLRTHTTVNTVRHIADNPHQ---PCRVFGIGRVFRQESIDRTHLPEFYQIEGIIHEAEANLPMLISTLKTFYSKMGFPDVRVRPAYFPYTEPSMWKGEWLELGGSGIFRPEVTEPLGTEWPVCAWGLGLERLAMLILELDDIRELYLPDL......... 354
137 2.000e-90UniRef50_B8P378 Predicted protein n=10 Tax=Dikarya TaxID=451864 RepID=B8P378_POSPM  ali  16  176.GSWKTSTYKKYNFEAEGLPPNGGAFHPLLKVREEIRNIFLEMG--FAEMTSSFVESGFWCFDALFVPQQHP-----AREVQDTFYLSGKRNPSTSLPPPASYYSRVSKVHEHGGYGWSDAETRKLLLRTHTTASSASMLYKLAAKCRGPAKLFSIDRVFRNETMDATHLAEFHQVEGVVADRGLTLADLIGFMRVFFKKMGIENLRFKPAYNPYTEPSLEIGKWVEVGNSGMFRPEMLEPMGFPKDVHAYNDSV-RGALRRYGISNIRTLVGHKVSIEGVET.. 502
138 2.000e-90UniRef50_A0A1G1GS94 Phenylalanine--tRNA ligase (Fragment) n=2 Tax=unclassified Nitrospirae TaxID=1298915 RepID=A0A1G1GS94_9BACT  ali  16  13.GSWKNKKFRAYNISLNPPRQSIGRKHPYKEFLDFVKYKFIGMG--FEEMRGPLVENEFWDMDALFMPQFHPARN-----IHDVYFVKEPRKIEEPFARNVAAAHKDGGKTGSTG--WRYAFDKRLILRSQGTAVSARTLASGPKV---PGKYFSIARCFRYDAVDATHAPDFYQVEGIVLGEEINFKTLLGLLKLFGQEIAAKEFQFRPAYFPFTEPSVELHGWMELGGAGMFRPEVTKPLGVNVPVIAWGLGLDRMAMVALGIQDIRDLFSKDLD--FIRTK. 295
139 2.000e-90UniRef50_A0A2D6PCS1 Phenylalanine--tRNA ligase alpha subunit n=7 Tax=Archaea TaxID=2157 RepID=A0A2D6PCS1_9ARCH  ali  15  279...WDKKTFRRYDIKINVPKIYGGKRHFVNQALDYARNIWLEMG--FKEMTGSIVQTSFWNFDALYTPQDH-----SVREMQDTFFIENPEKGQLPLMDRIKRMHENGGSIGSTGYPWNSEEARKNVIRTHTTVLSAQTLAEIKK-TELPVKFFGIGKCFRNETVDWSHLFEFNQTEGIVVDEDANLRHLIGYLKQFFKKMGFPEARFRPAYFPYTEPSLEIKKWIELGGAGIFRPEVVIPLGKDIPVLAWGPGIDRIVMDYYKIKDLRMLYKNDI......... 556
140 3.000e-90UniRef50_A2DJE6 Phenylalanyl-tRNA synthetase, alpha subunit family protein n=1 Tax=Trichomonas vaginalis TaxID=5722 RepID=A2DJE6_TRIVA  ali  15  209.GEWQNVDFAPLNFEAQGTKIPCGHEHPLLKVRAEFRNIFFQMG--FEEMTSKWVENSFWNFDSLFQGQQHPC-----RDMHDTFFLSNP-EFAQPIPDHDYFLRHVNGGNGSIGYDFSEQIPLTNIMRTHTTAVSSRTLKMLADEFKAPRKFFSIDRVYRNETLDATHLAEFHQVEGFIIDKNLSLGDLMRNIREFFSRIGLNDISFKPAYNPYTEPSMEIGREIEIGNSGMFRPEMLESMGIEYTVIAWGFGLERPTMIEYKIDEIRKLEGPNVSLDLIEN.. 503
141 3.000e-90UniRef50_T0MU27 Uncharacterized protein n=1 Tax=Thermoplasmatales archaeon I-plasma TaxID=667138 RepID=T0MU27_9EURY  ali  20  205.......TLRPYDPTLYAPRYLPGKIHPLSEFIEEVREVMLEMG--FKELKGQIVETAFWNMDMLFIPQNHP-----ARDMQDTFYLKGKGELDASKVRKVKRVHERGIAGSRGWYKWSKDEASKLLLRTHTTVNTIRYITEHPTEE---CKIFSVEKIFRRENLDAQHLAEFSQVEGVISGKGVTFGVLIDTLETFYHRLGVKDVWVKPSYFPYTEPSLFKGRDMELGGAGMFRPEVLKPWGIKYNVAAWGLGLERLLMTVLKLDDIRDIYRNDL......... 469
142 8.000e-90UniRef50_A0A1X0QG91 SYFA n=2 Tax=Hepatospora eriocheir TaxID=1081669 RepID=A0A1X0QG91_9MICR  ali  16  198........FKKYNFDTTGKIPQCGSLHPLLKMKDEFKRIFLEMG--FHEMTNQYVENSFWNFDSLFQPQNHPSRDE-----HDTFFVSKPASAK---LVNDEYLNKVKNIHEKGYMEWDVKESEKNILRTHTTAVTARYLYLKAGKRFEPVKLFSIDKVYRNETVDATHLAEFHQMEGVIAGYNLGLGDLMGIIKEFFNRLGISNIKFKPASNPYTEPSLEVNKWIEMGNSGIFRPEMIEPMGYDITVLGWGLSVERPSMIRYGLNNIRELVGHKVDLSFIKN.. 492
143 1.000e-89UniRef50_A0A2H9MT82 Phenylalanine--tRNA ligase subunit alpha (Fragment) n=1 Tax=Nitrosopumilales archaeon CG15_BIG_FIL_POST_REV_8_21_14_020_37_12 Tax  ali  18  33............DVEAKVPQVYVARTHPLKDTIDEIREIFVTLG--FSEIIGSMTQPSFWNFDALFTPQDHP-----ARELQDTFYLDG---ISAKKIGTPEQIKKVSASHKQGWRYWDINEARKMVLRTHTTCVTIKHLAEAKPDEA---RVFSVGRVFRNEKVSYKHLVEFNQIEGVVVGKNATLRDLMGIQKEFYKRIGITKIKFWPTFFPYTEPSDRLGKWVELFGMGIFRPEVTRPLGISKPVLAWGGGIERIAMLKYGLDDVREFYKNDLN........ 292
144 2.000e-89UniRef50_A0A256XPD6 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Thermofilum sp. ex4484_79 TaxID=2012527 RepID=A0A256XPD6_9CREN  ali  18  229.GEWRRIRIKKYDVTARPPVIYPGKKHPYLEFLEEVRRILIGMG--FEEVQGPLVELEFWNFDALFQAQDHP-----AREIHDSYILKHPREA---LLEENEYVKRIRDTHEKGWYKWDFSIARRLILRSQTTAVSVRTLYRRNR---PPLKVFTIDKVFRPETLDSKHSMEFHQVEGIVLAEGLNLKHLLGYLKQFALELGFKKIKFKPAYFPFTEPSVEKLGWIEILGAGLFRPEVLVPLGIDYPCLAWGIGIGRLAMIRLGIDDIRYLHSQDLN........ 508
145 3.000e-89UniRef50_A0A2H9MKF6 Phenylalanine--tRNA ligase alpha subunit n=2 Tax=unclassified Euryarchaeota (miscellaneous) TaxID=115531 RepID=A0A2H9MKF6_9EURY :  ali  20  218.GNWNEKKFRRYDVSTFAPSVYPGKVHPLTKIINEIREIFVSMG--FMEIEYDYIQPCFWNMDALFVPQDHP-----ARDMQDTFYMNKRIRVDKRIAEKIKKIHENGGNTGSEGWKWGMDEAEKTVLRTHTTVNSIRYLSEH---PEPPLKVFTIGRNFRRENIDSTHLPEFTQIEGILSEENADFNMLVGILKEFYKRIGFEKIKIKPSYFPFTEPSCKAGK-LEMGGAGIFRPEVTAPFNVKAPVLAWGLGLERLAMIRLGLKDIRALYMSDI......... 509
146 4.000e-89UniRef50_A0A0B5HV31 Phenylalanine--tRNA ligase alpha subunit n=20 Tax=Archaea TaxID=2157 RepID=A0A0B5HV31_ARCG3  ali  17  220.GSWQKKEFRKYDVEINVPKISGGKRHFTNQAVEYIKNIWLDLG--FREMTGNMVQTSFWDLDALFVPQDHP-----ARDMQDTFYLKTPKKGKLPDVKRVKATHENGWTTGSQGWKWDAEKAKENLLRTHTTVLSAQTIASLKKE-DLPAKFFAVGKCFRNETMDWKHLFEFYQVEGIVVDPDANFRNLLGYLKEFFRKMGYPDVRIRPGHFPYTEPSAEKKEWVELGGSGIFRPEVTKPLGTEVPVLAWGLGLDRIIKENWNIKDIRELYKNDL......... 499
147 4.000e-89UniRef50_A0A151BFX5 Phenylalanine--tRNA ligase alpha subunit n=4 Tax=unclassified Candidatus Bathyarchaeota TaxID=1700837 RepID=A0A151BFX5_9ARCH  ali  15  223.GKWREVEFQRYDVSAAPPTLHPGKKHFYLEFLEEVRDILVAMG--FEEVWGPYVETEFWNFDVLFQPQDHP-----AREIHDSYQLKHPRFGRLP---SRSLTLKVGKTHEDGWRTWNPEVARRLVMRSQTTAVSVRQLSARQN---PPVKVFCLSRVFRPDVLDAKHSMEFHQCDGIMGDWGLNLKHLLGFFEEFCGALGFKEVKFRPGYFPFTEPSVEVFGWVEVAGSGVFRPEVTLPLGASFPVLAWGAGIGRLAMVKLGIGDIRELHTRNLEL....... 500
148 4.000e-89UniRef50_A0A2G9LLP7 Phenylalanine--tRNA ligase alpha subunit n=6 Tax=Candidatus Altiarchaeum TaxID=1803512 RepID=A0A2G9LLP7_9EURY  ali  19  220..SWKGAEFRKYDVSVFVEPQYLAKFHPLTNLINDIREIFVGMG--FKEMRGNLIEPTFWDFDALFQPQDHP-----ARDMQDTFYLKNFVEVDG--FEKFKNPIR--DAHEKGWYQWNEEEAKKFILRTHTTAVSAHFITTLKKH-DLPAKIFTIGKVFRNETIDFKHLPEFYQVEGIVVSEDVNFRNLLGILKNFYNSLGFEKIRFRPGYFPYTEMSIEKEQWIELGGAGIFRQEVVKPLGFECPVLAWGLGLDRIAALRLNLSDIRDLYISDID........ 492
149 5.000e-89UniRef50_A0A1S4G6L9 Uncharacterized protein n=1 Tax=Aedes aegypti TaxID=7159 RepID=A0A1S4G6L9_AEDAE  ali  17  200.GIWKDLKFKPYNFDALGVPPERGQLHPLMKVRSEFRSIFLEMG--FSEMTNNFVESNFWNFDALYVPQQHPARDQ-----QATFFVSHP--------------------------KLSNKEAXKNVLRTHTTRVSARMLYKVARQEGGPVKYFSIDKVFRNKTLDATNLAEFYQVEGVVADNGLTLGDLIGTFNAFFNKLGITKLQYKPTINRCTEPSCFHPGWIEVGNSGVFHAEMLRSLGVPVNVIAWGLSLERPTMIKYGINNIRDLIGPKVDLKMVQD.. 460
150 6.000e-89UniRef50_A0A0B3B1G1 Phenylalanine--tRNA ligase alpha subunit n=2 Tax=cellular organisms TaxID=131567 RepID=A0A0B3B1G1_ARCG9  ali  20  222..EWKDKEFRSYDVKSQVPKLIGGRGHPLQETIDYIRTIFLDMG--FKEMEGPLVETAFWCMDSMWIPQDHP-----AREVQDTFYLN--KEGKLPIKELVKKVAEVHEGSKGYGYKFDENVAKQLLLRTHTTATTFRYFGER--NIKPPAKYFYIGRIFRNEAIDATHLPEFHQVEGFIMDEGLTLRDLMGYVKEFYNKMGINKIKFKPTYNPYTESSMEAGKWIELINSGIFRPEALEPYGIKVPVIAWGLGLERLAMMIHEQKDVRNMLGATSDLRWLR... 502
151 6.000e-89UniRef50_A0A2V2U3H4 Phenylalanine--tRNA ligase subunit alpha n=1 Tax=Thaumarchaeota archaeon TaxID=2026795 RepID=A0A2V2U3H4_9ARCH  ali  19  224.GKFNSVNLPPMDVQAPVRPLFPGRKHPIANLIDEISEIFVGLG--FTEIEGPITQSSFWNFDALFTPQDHP-----AREIQDTFYL---AQIKQDKFATEDQVHKISSAHKDGWYEWNIDDAKGIVLRTHTTAVTIKYLADNIPENA---RIFSIGRVFRNEKVSYKHLAEFTQIEGIVTGSRVSLQDLMGLQLEFYARLGIKKIKFWPTFFPYTEPSEKLEKWVELFGMGVFRPQVTKALGIHNPVLAWGGGLERIAMLRFGLTDVRDLYENKLWLRSIP... 500
152 1.000e-88UniRef50_I3D3U5 Phenylalanyl-tRNA synthetase, alpha subunit n=2 Tax=Nitrosopumilus TaxID=338191 RepID=I3D3U5_9ARCH  ali  17  109............DVEAKVPDVFVARTHPLKDTIDEIREIFVTLG--FSEIIGNMTQSSFWNFDALFTPQDHP-----ARELQDTFYLDG---ISAKKIATPEQIRKVSDSHKKNWRYHWDNEARKMVLRTHTTCVTIKHLAENKPDEA---RVFSLGRVFRNEKVSYKHLVEFNQIEGVVVGKDANLRNLMGIQREFYKRIGITKIKFWPTFFPYTEPSERLEKWIELFGMGIFRPEVTKPLGITKPVLAWGGGIERIAMLKYGIDDVREFYNNNL......... 367
153 1.000e-88UniRef50_V4M1C2 Phenylalanine--tRNA ligase alpha subunit n=5 Tax=Acidilobus TaxID=105850 RepID=V4M1C2_9CREN  ali  19  209.GEWKGSIIKPYDVTAEPPRLLPARKHPLAVFIEELKDIMVELG--FVEVEGPLIEVELFNFDALFQPQDHP-----AREIQDTLW---PDLPPSDISVYGELVERVKETHEKGWYPWNNEIASRRILRSQTTAVSIRVLSGR---PKPPIRFFTIDKVFRADPVDATHLSDFHQLDGIMGWPGYSFRDLLGFLTQFARKLGL-NIKFKPAYFPFTEPSVEGDSLVEVFGAGLFRPEVLRIAGVDYPVGAWGMGVERLALAKYGLKDVRDLYSKD.......... 474
154 2.000e-88UniRef50_A0A1F6QV41 Uncharacterized protein n=1 Tax=Candidatus Micrarchaeota archaeon RBG_16_36_9 TaxID=1801632 RepID=A0A1F6QV41_9ARCH  ali  14  164.GEWKSGKFRKYDVNAPAPKIYPGKKQPYIQVMEMVKEKLIGMG--FQEMKGPLVETSFWNDDALFMPQDHP-----ARGIHDVLFLKNPTKGTLP---DENLVAKVKATHEGGWVTWSKEEASKLLMRSQGTAVSARTLYENKDN---PAKYFMIDRNFRYDIIDAQHLMEFDHCEGIVIGENMTFRHLLGFLKEIAELFGAEKIKFKPGYFPFTSPSVELYGWVEAGGAGMMRPEVLRPLGLEKSVLAWGLGIGRLAMIALGIADIRMLYSDDL--EWLRNK. 446
155 3.000e-88UniRef50_A0A177B950 Uncharacterized protein n=1 Tax=Intoshia linei TaxID=1819745 RepID=A0A177B950_9METZ  ali  15  201...WSNYKFKEYNFAAEGLKHVGGNLHPLMKMRQHYRSLFLRMG--FSEMTNQFVESSFWNFDALFQPQKHPS-----RDLQDTFFTKEPSKAQNLPNKYVKIVAKVHGGYGSIGYNWKLCEAEKLVLRTHTTATTTKMLYNIAQKEKFPAKLFSIDRVFRNETLDSTHLAEFHQVEGVVVDYNLTLGNLMAIISHFFEQLGMTKLRYKPAYNPYTEPSMEIKKWVEIGNSGMFRQEMLRSMGFDENVIAWGLSLERPTMIKYNISNIRDMFGSKVKMSTIYNQV 490
156 3.000e-88UniRef50_I7MF63 Phenylalanyl-tRNA synthetase alpha chain, putative n=1 Tax=Tetrahymena thermophila (strain SB210) TaxID=312017 RepID=I7MF63_TETTS  ali  17  213...ELAKQFKKYNWNSVGKDIKTGNLHPLMKVRKQFREVLIEMG--FEEMTNQYVESGFWNFDALFQPQQHP-----ARDAHDTFFIREPAHLDPEYWERVKKTHEVGGGSIGYRYDWSYDEAKKNIFRTHTTAVSSKMLRQIAIEVFKPRKFFSIDRVFRNESLDATHLAEFHQIEGVIADKNVGLGELLGVITEFFAKIGITGLKFKPTYNPYTEPSLEIHGFIELGNSGVFRPEMLRPMGLDIQVLGWGLGLERPTMIQYKFKNIRDLLGYGVDMKLLKEN. 505
157 4.000e-88UniRef50_A0A256ZVB4 Phenylalanine--tRNA ligase subunit alpha n=2 Tax=Candidatus Aenigmarchaeota archaeon ex4484_14 TaxID=2012502 RepID=A0A256ZVB4_9AR  ali  19  172.......................GKQHIITTYIEKIRKIFIELG--FTELAGPFVESSFWNFDALYQPQDHP-----ARDMADTFFLKNPSVARLPIVEKVKAMHEHGGDSTGWGYSWSSEIAKQLVLRTHTTSVSARQLAK----TSGPGKFFCIGRVFRNETIDFKHLPEFTQIDGIVVDKDVGFKDLLGYLKEFYKRLGFKKIRFRPAYFPYTEMSEEKDEWLELGGAGIFRPEVTKPLGIEYPVLAWGLSLERPIMMR....................... 410
158 5.000e-88UniRef50_Q0W0X9 Phenylalanine--tRNA ligase alpha subunit n=4 Tax=Methanocella TaxID=570266 RepID=SYFA_METAR  ali  14  205.GSWQGKTFRKFDVSLPVQTEYGGRKHILRMGMDAVKRTLIEMG--FKEMEGPMVDAEFYVNDLLFMPQDHPARTHW-----DQFNLKEPKYIHLPLVERVRRVHRDGGSSGSLGYEWDETIARKLVLRGHTTSLTARYLAKHS---KPPQKYFSVSQVFRNDTIDVTHLLEFCQIEGWIMDDNLSMKELMGTFKEFYSRMGITVLKFKPTYNPYTEPSPKTGRWIEVGNSGMFREEMMEPYGINSTVVAWGLALERLMMINYGYTDIRDLHGPLCDINFLR... 487
159 5.000e-88UniRef50_A0A1W0E500 Phenylalanine--tRNA n=1 Tax=Enterocytozoon hepatopenaei TaxID=646526 RepID=A0A1W0E500_9MICR  ali  18  195.....EKKLKPYNFDVESNQVQCGSIHPLMKIKDEYKKIFLEMG--FTEMTNKYVESSFWNFDALFQPQNHPS-----RESQDTFFVNSLEEVDAKYLKRVSDIHSSTYDNIKEEFKWKIEEATKNILRTHTTAISARLLYKIAEKIRKTYKFFSIDKVFRNETVDATHLAEFHQVEGIVVGKELTLKELISVLQSFFKKLGIEKLRFKPAFNPYTEPSMEIGKWVELGNSGIFRPEMLLPMGFDVTIIAWGLSLERPAMIRYGLNNIRDLVGHKVDLNFIR... 492
160 6.000e-88UniRef50_A0A151BE09 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Candidatus Bathyarchaeota archaeon B24 TaxID=1779368 RepID=A0A151BE09_9ARCH  ali  17  211.GRWRSVVLKKYDVSLPSYRIPIGRLHFWRDILNHIRRVWVEMG--FKEMEGPILETCFWDYDALYVPQDHP-----ARDLQDTFYVKTPGRGRLPSPEKIRQTHEDGWTTGSWGYKWDVEEAKRTLLRTHTTAVSVRTLAAL-KEAELPAKFFSVGRVFRNEKPDRTHLCEFYQTEGIVVDENANMKHLVGYLKEFFKRLGFPEARFRPAYFPYTEPSLETGRWIELGGAGIFRPEVVKPLGRDIPVLAWGLGPERMVMLNYGLKDIRELVMNDL......... 490
161 7.000e-88UniRef50_A0A0G4KSF9 Uncharacterized protein (Fragment) n=1 Tax=Verticillium longisporum TaxID=100787 RepID=A0A0G4KSF9_9PEZI  ali  16  113....QTGDISPYNFKALGADQNSGALHPLNKVRHEFRQIFFEMG--FEEMTNKYVESGFWNFDALFVPQQHP-----ARDLQDTFYISDPKVAPGPESEDDKYWENVKQVHQDGKYGWEADESLKLVLRTHTTSVSTAMLHKLAGLKGPPARYFSIDRVFRNESVDATHLAEFHQVEGVIADYGLTLGGLMEFMEIFFNKMGITDLKFKPAYNPYTEPSMEIFSFVEIGNSGMFRPEMLESMGLDMRVYGWGLSLERPTMIKYGISNIRELLGHKDKLEAASN.. 413
162 9.000e-88UniRef50_B7XI98 Probable phenylalanine--tRNA ligase alpha subunit n=1 Tax=Enterocytozoon bieneusi (strain H348) TaxID=481877 RepID=SYFA_ENTBH  ali  19  181.......LLKKYNFNLSKVSRFFGSLHPLTKIKSEFKRIFLEMG--FSEMTGKYVESSFWNFDSLFQPQNHPS-----REIQDTFFLKVPRDVDSQYINRVESIHSSTSIPVDEGYDWSVAEAKKNILRTHTTAISSQMLYKLAQSNLKAIKLFSIDKVFRNETVDATHLAEFHQVEGLISGENLGIKELIHTIKTFFTKLNIHQIRFKPAFNPYTEPSMEIKKWIELGNSGIFRPEMLLPMGFPKNVIAWGLSLERPAMIKLGLKNIRDLVGHKISVEFIRD.. 480
163 1.000e-87UniRef50_A0A1A8XAF0 Phenylalanine--tRNA ligase alpha subunit n=56 Tax=Plasmodium TaxID=5820 RepID=A0A1A8XAF0_PLAMA  ali  18  282....KKYDIKEYNFFSSGKKIIKGTLHVLTKQMRIFKDIFISLG--FEEMTHNYVESSFWCFDALYIPQQHPS-----RDLQDTFFIKDPEIIDIGYIENVKRVHSVGDYGSFGWYEWKIEESKRNVLRTHTTSNSCRTLFKLAKEYNLPKKYFSIDRVFRNENLDSTHLAEFHQVEGLIIDKNLGLAHLIGTLSAFYKYIGIHKLKFKPAFNPYTEPSMESRKWLEVGNSGVFRPEMLRAMGFDVSVIAWGLSLERPTMIKYNVKNIRDLFG............ 565
164 2.000e-87UniRef50_W7JJX6 Phenylalanine-tRNA ligase, alpha subunit n=3 Tax=Plasmodium (Laverania) TaxID=418107 RepID=W7JJX6_PLAFA  ali  18  289....KKYDIKKYNFFSSGKKINKGNIHLLTKQMRTFKEIFFSLG--FEEMTHNYVESSFWCFDALYIPQQHPS-----RDLQDTFFIKEPETVDTEYIDNIKRVHTHGDYGSFGWYKWKLEESKKNVLRTHTTANSCRALFKLAKEYKKPKKYFSIDRVFRNENLDSTHLAEFHQVEGLIIDKNIGLSHLIGTLAAFYKHIGIHKLKFKPTFNPYTEPSMESKKWLEVGNSGIFRPEMLRSMGFEVSVIAWGLSLERPTMIKYNIKNIRDLFG............ 571
165 4.000e-87UniRef50_B1L7B9 Phenylalanine--tRNA ligase alpha subunit n=2 Tax=Candidatus Korarchaeota TaxID=51967 RepID=B1L7B9_KORCO  ali  17  205.GEWKKKKLKAYDVKASPPVVYPGKPHPYVYFLEEVREILIGMG--FTEVKSPIVESEFWNFDVLFQAQDHP-----AREVHDSYKLAYPEAADLSLVNRIARTHEDGWITGSWGYKWSFEIARRLILRSQTTAASARSLANGLEV---PSKIFAIDKVFRPEAPDKTHAFEFHQCEGVVLAEGMNVRNLMGFLAEFSKNLGFKEVKFKPAYFPFTEPSVEKLGWIEIAGSGLFRPEMLIPLGYDYPALAWGIGIGRLAMIKLGLEDIRELHSQNLDY....... 486
166 4.000e-87UniRef50_A0A2P8ZPM7 Uncharacterized protein n=1 Tax=Blattella germanica TaxID=6973 RepID=A0A2P8ZPM7_BLAGE  ali  15  189.GSWKEKNFKPYNFDALGVPPNCGHLHPLLRVRTEFRQIFLEMG--FTEMTNNFVENSFWNFDALFQPQQHP-----ARDAHDTFFVSNP---RTSSRFPPEYLQKVKQVHSKGGYDWKVEEAMKNLLRTHTTAVSARMLYLLAREGFKPSKYFSIDRVFRNETLDATHLAEFHQVEGVIADYNLTLGDLIGTLYEFFKKLGITRLQFKPAYNPYTEPSMEIGKWIEVGNSGIFRPEMLLPMGLPEN...................................... 439
167 7.000e-87UniRef50_A0A150J1M6 Phenylalanine--tRNA ligase alpha subunit n=10 Tax=Euryarchaeota TaxID=28890 RepID=A0A150J1M6_9EURY  ali  16  208...WRNVTLKRFDVSSDVKVVYPSRKHFVNQAIEYIRKIWLEMG--FREMSGPMIDTSFWVFDALFQPQDHP-----ARDMQDTFFVESFGQIDPKLSDKICAMHEHGGDINSWGYNWDKKISEEYVLRTHTTSLSVRTLSTLKPE-DLPAKFFSVGKVFRNEKLDWKHLFEFYQTDGIVVDEDANFKHLLGYLKRFLNKMGHSKIRFRPAYFPYTEPSIEKGEWVELLGAGIFRPEVVVPLGKDVPVLAWGPGFGRLIMEYYGLTDIRQKYMNDLDM....... 486
168 7.000e-87UniRef50_A0A2N9HQY2 Uncharacterized protein n=1 Tax=Fagus sylvatica TaxID=28930 RepID=A0A2N9HQY2_FAGSY  ali  17  1.....................................MIFLQMG--FEEMTDRYVESSFWNFDALFQPQQHP-----ARDSHDTFYLKDPSTTELPEVERVKRVHESGGYGSRGAYDWSREEANKNLLRTHTTAVSTRMLYMLAQKPFTPKRYFSIDRVFRNEAVDRTHLAEFHQIEGLICDRGLTLGDLIGVLHDFFSRLGMSKLRFKPAYNPYTEPSMEIKKWVEIGNSGMFRPEMLLPMGLDVRVIAWGLSLERPTMILYGIDNIRDLFGHKVDLGLIKTN. 306
169 8.000e-87UniRef50_A0A2J6H0Y5 Phenylalanine--tRNA ligase subunit alpha n=1 Tax=Candidatus Woesearchaeota archaeon TaxID=2026803 RepID=A0A2J6H0Y5_9ARCH  ali  16  209.GKWKDVEFREYDVEVNVPKINVGRKHFVNKSIEYMKRIWLDLG--FTEMSGDMVQTIFWDLDTLFVPQDHP-----ARQMQDTFYIKDPKSGKLPDLKKVKEVHENGGDTGSTGWKWSKDEASQNMLRTHTTVLSAQYLEKKNGEYKMPAKFFSVNKVFRNEALDWKHLFEFNQVEGIVVDPNANLKHLKGYLKEFFGKMGFTDVRMRPAHFPYTEPSVEKKTWVELGGAGIFRPEVTKTLGVEVPVLAWGLGMERIIVEYFGFKDLRDLYNNKLNL....... 490
170 8.000e-87UniRef50_T0ND13 Uncharacterized protein n=2 Tax=unclassified Thermoplasmatales (miscellaneous) TaxID=1919231 RepID=T0ND13_9EURY  ali  18  217.GSWKTIPFQRYDMNSRVERILGAGIHPISFLSRMVREIFLDLG--FTEMSGHYIEHAAWNMDALFIPQDHP-----ARDMQDTFYIDSSLEMEHPELEIFRKVHEKGIGYTGWGYRWSSEKAAELLLRTHTTVSTIRYLYEHKQA---PQAVFSVEKVFRHESVDWKHLAELHQIEGAYYGKDASLASLKWLMKEFYRRLGFTELRFIPSYYPYTEPSMINGKEMELGGSGVFRPEVTRPLGLKHPVIAWGLGLERLAMIYFGLDDIRDIYQSDLDLRSYRVKI 500
171 1.000e-86UniRef50_A0A1J4UJY2 Phenylalanine--tRNA ligase alpha subunit n=13 Tax=unclassified Candidatus Micrarchaeota TaxID=1801634 RepID=A0A1J4UJY2_9ARCH  ali  16  182.GAWHEKNYAEYDLKTVAAEAYPGKKNAYKEFLNEVRMRLVGMG--FREVHGPLVELEFWNMDALFMAQDHP-----AREIHDVFQVEDPCKGRKPLFERVRKAHEKGIGSTGWGYAWDPEVALRLVLRSQTTAVSARKLAE---GIHPPERLFCIGTVFRPDEIDWKHFIEFTQCEGIVADENTSFRELLGYLRNFAVEVFGKEIKFAPSYFPFTEPSVEGRGWAEVGGAGLFRPEMLEPLGVKVPVIAWGLGVDRLAMIRLGIDDIRDINAKDL......... 457
172 1.000e-86UniRef50_A0A1X1BIU4 Phenylalanine--tRNA ligase alpha subunit n=8 Tax=Piroplasmida TaxID=5863 RepID=A0A1X1BIU4_9APIC  ali  16  225...WSAEDMKPYNFFSSGKRIPRGALHPLTRTMRHFREIFTSMG--FEELTANYVESSFWCFDALYIPQQHP-----ARDSQDTFFTRVPELHDETRLNYIDAVAEAHGDARRWMYNWKIEESRKLVLRTHTTACTARLLKRMAENFDLPCKFFSIDRVFRNENMDATHLCEFNQVEGVMVGFGLGMGHLIGVLASFYAAIGIEKLRYKPAYNPYTEPSMEIKKWVEIGNSGIFRPEMLLPMGLPPSVVGWGLSLERPTMISHNIRNIRDLVG............ 509
173 2.000e-86UniRef50_A0A2H9QAV4 Uncharacterized protein n=4 Tax=unclassified Candidatus Micrarchaeota TaxID=1801634 RepID=A0A2H9QAV4_9ARCH  ali  17  228..AWKDVEIRGYNVLAPVEVPFAAKRHIVGRAIRRIKDIFLSLG--FEEMGGSLIEAGFWNFDVLFQPQDHP-----ARELADTFYLD--KAVKLGSGGERALIKRVKEVHENAWGTWLEAEASKCVLRTHTTAVSARYLAKLAGSKIK-KKYFSVGKVYRNESIDFKHLAEFHQIEGIIVDENATFADLLGTLKQFYSRLGFEKIRFMPSYFPYTEPSLEIKEWLELGGAGIFRPEVSKPLCGRYPVLAFGLSMERPLMLKLGISDIRILYENNMTL....... 503
174 2.000e-86UniRef50_A0A2G9P8L5 Phenylalanine--tRNA ligase subunit alpha n=1 Tax=archaeon CG10_big_fil_rev_8_21_14_0_10_43_11 TaxID=1975556 RepID=A0A2G9P8L5_9ARC  ali  19  217.......LFREYDIHVTAPRVYGGRKHVLREIEKRVKEIFIEMG--FEEMRSNFVDTAFWNFDVMFFPQDHPG-----REIMDTYYLDFPKEGNIPLAKKIKDIHETGGSTGSKGYEWSERVANQLLLRAHTTQTSFRYLAKGR---APPYKYFSVDRVFRNETLDATHLNEFHQIEGFVVAKGLTLKNLCGMFKEFYQKIGVNKVKFKPTYNPYTEPSMEIKKWLELGNSGMFRPETLKPLGITVPVIAWGLALERLVPFQYKVDDIRQVLGHFVDIDSIRN.. 493
175 2.000e-86UniRef50_A2BL75 Phenylalanine--tRNA ligase alpha subunit n=5 Tax=Pyrodictiaceae TaxID=2307 RepID=A2BL75_HYPBU  ali  18  208.GRWRTVRLRRYNVAAEPPRRRLGRLNFFVEFIEYLRDVMKEMG--FQEVDDAPVELEFWNYDVLYQPQYHPARSPT-----DTFYLSNPSRGELPELTPVAEAHEKGLAGSRGWYRWSQELAARLILRSHTTAVSARVLASKPR---PPFRFFTIGRVYRVETIDPRHLPEFHQLDGIASEDGVSLRWLLGLLAEFLERIGIREYKFRPAYFPFTEPSVEADQWLEVLGAGLFRPEMLAALGIDYPVAAWGMGIERLAMALYDLTDIRQLYSHDVFLENIPVR. 489
176 3.000e-86UniRef50_A0A075I5Y9 Phenylalanyl-tRNA synthetase subunit alpha (FARSA, pheS) n=4 Tax=Euryarchaeota TaxID=28890 RepID=A0A075I5Y9_9EURY  ali  18  216...WRDARFKPFDVNAPAPTPSGGRPHPMQALIEMIRSVFLEMG--FSEIEGNFVQSAGWNMDSLFIPQSHPART-----MQDTFYLSEPEQVEVEYLDLWARVHEHGHDTGSRGWEFDQEEAKKALLRTHTTVNTVRYIAENPHE---PCRVFGIGRVFRQESIDRTHLPEFYQIEGIIHESEANLPMLISTLKTFYSKMGFPDVRVRPAYFPYTEPSMWRGEWLELGGSGIFRPEVTEPLGTEWPVCAWGLGLERLAMLILELDDIRELYQPDL......... 487
177 3.000e-86UniRef50_A0A075HS04 Phenylalanyl-tRNA synthetase subunit alpha (FARSA, pheS) n=17 Tax=Thaumarchaeota TaxID=651137 RepID=A0A075HS04_9ARCH  ali  18  199.......KLDTGDVEADVPHVHAARIHPLKDTINEIRETFVHLG--FTEITGNLSQSSFWNFDALFTPQDHP-----ARELQDTFYLKD---LNAKQLATSTQIKNVSNAHKKGWRYYWDQEAKKMVLRTHTTCVTIKYLADKKPDEA---RIFSLGRVFRNEKVSYKHLVEFNQVEGIVVGKHITLRDLMGIQKEFYRKIGLTKVKFWPTFFPYTEPSERLGKWIELFGMGIFRPEVTKPLGITKPVLAWGGGIERIAMLKFGLDDVREFYNNNL......... 464
178 4.000e-86UniRef50_P57693 Phenylalanine--tRNA ligase alpha subunit n=10 Tax=Archaea TaxID=2157 RepID=SYFA_THEAC  ali  17  206.GEWKTKNFRKYDLNSPSSVIRSSLKHPMTYLIEEIREIFLNMG--FTEMGGHYIESTLWDMDSLFIPQDHP-----ARDMQDTFYV----EADSFDIDHPEISKKIRKIHEKGFYRWSDAEARKLVLRTHTTVSTARYLYEN---NEPPQAIFSVEKVFRHESVDWKHLAEFYQIEGAVYSKDVSVSTLKWILRDFYAKLGFNDIKLIPSYYPYTEPSRVNGKEVELGGSGLFRPEVLKILGLKAPVMAWGMGLERLAMMYYGLTDVRDLYNTDFFLSSFRFNI 488
179 5.000e-86UniRef50_A0A1J5H1U1 Phenylalanine--tRNA ligase alpha subunit n=19 Tax=root TaxID=1 RepID=A0A1J5H1U1_9BACT  ali  15  89LGKEK------IDITRPGKKVKIGHLHPLTLVQREVEEIFQSMG--FSVITGPEVETEWYNFDALNIPKDHP-----ARDMWDTFWLK--VEAD----QRARLPSPEGKASGGQGY--QRGLTQKFLLRTHTSPVQIRYMEKHQ----PPLRIIVPGRCFRHEATDASHEIQFYQLEGLVVDKNISAANFRAIIEEFLKRFLKTEIRLRPSFFPFTEPSFEKGKWVEMMGAGMVHPNVFKAAGLIPNGFAFGAGLDRLAMLKYKINDIRLFYSGDLR........ 355
180 5.000e-86UniRef50_S2E3M1 Phenylalanyl-tRNA synthetase, alpha subunit n=47 Tax=Archaea TaxID=2157 RepID=S2E3M1_9ARCH  ali  18  195............DVESKVPGVFVARTHPLKDTIDEIREIFVTLG--FTEVIGEFTQPSFWNFDALFTPQDHP-----ARELQDTFYLDG---ISAKKIGTVEQIRKISESHKKNWRYYWDNEARKMVLRTHTTCVTIKHLAETKPDES---RIFSLGRVFRNEKVSYKHLVEFNQIEGVVVGKNATLRDLMGIQREFYRRIGITKIKFWPTFFPYTEPSDRLGKWVELFGMGIFRPEVTKPLGITKPVLAWGGGIERIAMLKYGLDDVREFYNNNLWLRSV.... 459
181 6.000e-86UniRef50_A0A2R7Y4K7 Uncharacterized protein n=1 Tax=Desulfurococcaceae archaeon NZ3(B) TaxID=1973259 RepID=A0A2R7Y4K7_9CREN  ali  13  219.GSWRNVILKEFDLSIDVPEKPIKKKHPYVQFMNYVKEVLIGMG--FEEVKGPFLETALWNFDVLFVPQYHP-----ARRVSDVFYVSNVSVAEVDVLNKVKEIHE-----NSWRYSWSVEEALKTVLRTHTTPVSMRTIYAKK---GGEYRVFSFDRVFRPDTPDPTHLMEFHQLEGIIVGKSVTFKHLLGFFKEFARYLGMSDVKFKPAYFPFTEPSVEGFGWVEVFPGGMFRPEVTEAVGLPPEVAAWGIGIDRLAMIVLGLDDIRDLYTHDLDV....... 490
182 6.000e-86UniRef50_A0A2D6RJE2 Phenylalanine--tRNA ligase n=17 Tax=cellular organisms TaxID=131567 RepID=A0A2D6RJE2_9GAMM  ali  14  217....RGKKFRKYDISSQLPQIYGGRKHFVNQAIEYGKQVWLDLG--FKEMSGNKVQTSFWNFDALFTAQDHP-----VREMQDTFFIKGIKGSSTDIVKKVKQAHESGVSGSRGWYKWSEDEAKSLCLRTHTTCLSARTLASINPKTDLPAKFFAIGKNFRNETVDWSHGFEFNQSEGIVIDKDANLRHLIGYLKEFARKMGFEDIRIQPAYFPYVEPHPEKKQWIEVLAAGILRPEVVIPLGEDIPVLAWGPGFDRLMMLAYEMDDMRKLYSNDLDLRNKR... 499
183 2.000e-85UniRef50_Q5ZJQ2 Phenylalanine--tRNA ligase alpha subunit n=14 Tax=Euteleostomi TaxID=117571 RepID=SYFA_CHICK  ali  18  203.GSWRKLPFKAYNFSALGLPPTCGHLHPLLKVRSQLRQIFLEMG--FTEMTDNFVESSFWNFDALFQPQQHPARDQ-----HDTFFLQDPAEA--PEL-PANYMARVKKVHSQGGYGWKVEEARKNLLRTHTTSASARALYHLARQGKFPVKYFSIDRVFRNESLDATHLAEFHQVEGVVADRGLTLGHLMGTLQQFFTKLGISKLRFKPAYNPYTEPSMEVKKWVEVGNSGVFR.................................................. 442
184 3.000e-85UniRef50_A0A0M0BQP3 Phenylalanine--tRNA ligase alpha subunit n=2 Tax=root TaxID=1 RepID=A0A0M0BQP3_9ARCH  ali  16  219.GGWRDAFFQRYDVALPVPTLYPGKRHFISQVIDYIRRFWVELG--FREMTGPLLELAFWNFDALFQPQDHP-----ARDLADTFYMKRPRSGRLPDPERVRETHENGWTTGSTGYDWDPELARRCCLRTHTTSLSVNAIARL-GEEDLPAKFFSVGRVFRNETIDWNHLMEFYQTDGIVIGDGVTFRDMQGYLKAYIEGLGARRFRFRPGYFPYTEMSMEKGAWMELFGAGMFRPEVVKPLGREVPVLAWGPGFDRLVMQSYGINTIRELYGNDIFLRKARL.. 506
185 4.000e-85UniRef50_A0A0B3ARX7 Phenylalanyl-tRNA synthetase alpha chain n=26 Tax=Archaea TaxID=2157 RepID=A0A0B3ARX7_9ARCH  ali  16  227..SWRGKKFRRYDITSPVPSIAGGKRXXXXXXXXXXXXXXXEMG--FQEMSGDYIQNSFWNFDALFTAQDHP-----VREMQDTFFID--KNLELPEVKAVREAHETGVAGSSGWYKWDEEKAKKLVLRTHTTCLSAQTLANL-KISELPAKFFAVGKCFRNETVDWKHGFEFNQTEGIVIDKNANFRHLLGYLKEFFKKMGFEKIRFRPAYFPYTEPSVEKKEWLELGGAGIFRPEVVIPLGENIPVLAWGPGLDRTLMNYYGIKDLRELYKNDI......... 503
186 7.000e-85UniRef50_A0A2D6EVK5 Phenylalanine--tRNA ligase subunit alpha n=1 Tax=Candidatus Woesearchaeota archaeon TaxID=2026803 RepID=A0A2D6EVK5_9ARCH  ali  16  196.GSWKGKNFRRYDLTSVAPRLHGGKLQPYKKFLDSVRKQFISLG--FQEMDGPIVESDFWDMDALYMPQFH-----SARDIHEGYYVKNAPLAD----IDSGVMKRVKEAHEKGSTGWQYDFDIDHLLRTQGTACSARMLASKDLKIPG--KYFAMSRCFRYDVIDATHLPDFNQVEGIVVDKNLTLRHMIGLLKQFAKTFATEEVKVVPGYFPFTEPSVELFGWIELGGAGLFRPELVQPLAQDVQVLAWGIGVDRLGMFNLGIKDIRNLFSKDLYLRKAKV.. 480
187 2.000e-84UniRef50_B6AG10 Phenylalanyl-tRNA synthetase, alpha subunit family protein n=2 Tax=Cryptosporidium TaxID=5806 RepID=B6AG10_CRYMR  ali  16  210..SWEGSDFKPYNFFAKGKRLIRSHIHPLTRSLLKFKRILLHMG--FEEMTNRWVESSFWNFDALFQPQQHP-----ARDSNDTFFLNKPLELDEVHINRVRDIHQIGGGSVGLGYNWDIEEASKNILRTHTTAISARMIYYLALTNFKRKALFSIDRVFRNESIDSTHLAEFHQVEGLIIDRNLCLGDLLGTFSTFYEKIGISKLKFKPTFNPYTEPSMEVKKWIEIGNSGMFRPEVLRSLGLPIVVIAWGLSLERPTMIHYNIPNIRDLFS............ 501
188 2.000e-84UniRef50_A0A1Q9PBA8 Phenylalanine--tRNA ligase alpha subunit n=4 Tax=Candidatus Thorarchaeota TaxID=1706441 RepID=A0A1Q9PBA8_9ARCH  ali  16  216.GAWKEESFRPYNVGIVPAYANYGKKHPYAEFNDWLREIMVGLG--FTEWFGPYVETEFWGHDTLFVPQDH-----VSREVQDQFRVASPHITDRKYFKAVRAVHENGGDTGSKGWDWSEEIATRLCLRPHTTPVSMRYLYEHR---EGPQKMFIIDRNFRSETLSATHAQEFNQCEGIIMDKGLSLRDLLGYLTSICKAVGIEKLKFKPGQFPFTEPSVETFGWIELGGSGIFRPEVTQPLGIKEPVLAWGIGSGRLYMAAMGINDIRDLFSRDLN........ 493
189 2.000e-84UniRef50_A0A1Q7PZ44 Phenylalanine--tRNA ligase alpha subunit n=13 Tax=Archaea TaxID=2157 RepID=A0A1Q7PZ44_9ARCH  ali  16  216.GEWEKVKLRSYNVSSAVPRTFPGKYHPYLRFLRMVKRKLVALG--FREAVGPLVETAFINCDCLYMPQDHP-----AREIHDLYYVKDPLEEYGILVDRVAQTHENGWKTGSSGYKFSRDEASKLILRSHGTALSVRTMLSKDLQIPG--KYFAVARCFRPDMLDKTHLTEFNQAEGIILDPSLNLRNLLGILEMFAKEVAGDKVRFKPDYFPFTEPSVEGFGWMEFGGSGIFRPEVTEPLGVKVPVLAWGLGIDRLYMMSRKIQDIRQLFTSDL......... 494
190 2.000e-84UniRef50_A0A1F7RRM1 Phenylalanine--tRNA ligase (Fragment) n=1 Tax=Candidatus Schekmanbacteria bacterium RBG_13_48_7 TaxID=1817878 RepID=A0A1F7RRM1_9B  ali  15  5...................PVYPGKIHPFVKIQEETRSVFLSMG--FKEVTTSYVESSFWNFDALFTPQDHP-----AREMQDTFYLKTPSKTRIPLVEQIRKTHENGGDTGSIGWKWDDKKSQMPTLRTHTTAASIRALAAH---PEGPGKYFCIGPVFRRETTDYKHLPAFMQIDGIIVEENASFADLLGTLAEFYSKMGFAKFQFRPGFFPYTEPSVEKKDWVEMGGAGIFRPEVTIPLGCSVPVLAWGLGLERIAMFRY...................... 250
191 4.000e-84UniRef50_A0A1R4A6Q2 Phenylalanyl-tRNA synthetase subunit alpha n=4 Tax=Thermoplasmatales TaxID=2301 RepID=A0A1R4A6Q2_9EURY  ali  16  208.GTWKNRRFRTYDLNMPGKVTPRHGLHPLTVLINDVREIFLSMG--FEELKDPYVEFTGWNMDALFIPQDHP-----ARDMQDTFFLSTKKKVE-PDEDDRLLFRRAGKIHENGGYKWRPEEAEKLMLRTHTTASTMRSLHRTPKMEK---AVFSVDKVFRHESVDWKHLAEFHQVEGAIHARNANLGTLKWYLRKFYSALGFDHIELIPSYYPYTEPSLIDGKELEMGGSGLIRPEVTKALGLEYNVIAWGLGLERLALLYYGLNDLRKLYESDLWLQEYRLKL 493
192 5.000e-84UniRef50_A0A2G9PKZ0 Phenylalanine--tRNA ligase alpha subunit n=3 Tax=Candidatus Woesearchaeota TaxID=1801616 RepID=A0A2G9PKZ0_9ARCH  ali  15  262.GSWKKKGFRAFDVKAKLPEIYGGRKQHYRAFLDEVKQRFAAMG--FIEMTGPIVESEFWDMDVLFMPQFH-----SARDIHDAYYVKGPKYADLPLVKRVAASHEHGEGTAS--RGWRYRFDLKLLLRTQGTALSARTLASKELKIPG--RYFAIARCFRYDVIDATHNCDFFQTEGIVVEEGLTIKHLFGLLEMFAREFAADEIKITPAYFPFTEPSATLYGWIELGGSGIFRPEMTKPLGIEQPVIAWGIGIDRIAMFRLGITDIRTLFSNDL......... 539
193 5.000e-84UniRef50_K6UCB8 Phenylalanyl-tRNA synthetase beta chain n=2 Tax=Aconoidasida TaxID=422676 RepID=K6UCB8_9APIC  ali  16  147....KKYDVKKYNFFSSGKKMNKGNTHLLIKQMRTFKDVFVSLG--FEEMTHNYVESSFWCFDALYIPQQHPS-----RDLQDTFFIETPEFCEKGYIDNVKRVHSVGDYGSFGWYRWELKSTKKNVLRTHTTASSCRALFQLAKEYRKPKKYFSIDRVFRNENLDSTHLAEFHQVEGLIIDKNLGLSHLIGTLAAFYKYIGILKLRFKPTFNPYTEPSMESKKWLEVGNSGIFRPEMLRAMGFPPEVIAWGLSLERPTMIKYNIRNIRDLFG............ 429
194 6.000e-84UniRef50_E0SS25 Phenylalanyl-tRNA synthetase, alpha subunit n=1 Tax=Ignisphaera aggregans (strain DSM 17230 / JCM 13409 / AQ1.S1) TaxID=583356 RepID=  ali  15  196.GMWRKAVLKPYNVEANPPVVYPGKKHFFKEFIDMIREIMERLG--FVEVRDDYVIPEIWNFDILFQAQDHPS-----RDIHDILVVDGYANLDSDIVERTRNVHEFGGSCGSIGYSWSLEKASRLILRSHTTAVTARFLSIYR---EPPVRLYTIARVFRRDNPDARHSPEFTNFDGVIMEKDFSFRKLLGLLSQILRYMGIEKYRFKPAYFPFTEPSVEGYGWIEVFGAGMFRPEVLEILGVNSPVGAWGMGVERLAMVVYGIDDIRLLFSKDI......... 470
195 7.000e-84UniRef50_A0A1Q9C6S8 Putative phenylalanine--tRNA ligase alpha subunit n=1 Tax=Symbiodinium microadriaticum TaxID=2951 RepID=A0A1Q9C6S8_SYMMI  ali  17  784.GTWSSTTFKPFNLTNVSGVPTGGHLHPLNKVKTEMRQILMQMG--FEEMTNQWVESSFWNFDALFQPQQHP-----ARDAHDTFFMEEPSRAQD---IPEEYLAKVKEMHEKGGYDWSEDEAKKTLLRTHTTAVSARTLYKLGEEYRKPKKYFSIDRVFRNETLDATHLAEFHQIEGFVADRNIGLPQLIGTLRDFFSRIGISKLRFKPAYNPYTEPSMEIKKWIEVGNSGVFRPEMLLPMGLDVSVIAWGIGCESVLMLR....................... 1058
196 1.000e-83UniRef50_A0A2D6NDL1 Phenylalanine--tRNA ligase subunit alpha n=1 Tax=Candidatus Woesearchaeota archaeon TaxID=2026803 RepID=A0A2D6NDL1_9ARCH  ali  15  220.GTWKGKKFRSYDIKINVPKIFGGKRQPYSEFIEQVREKVVSMG--FVEMNGPIIELELYNFDALYQPQGHPARTWTA-----TYKIKEPKAGLLPILNAIKSAHETGGLTGSWGYNWNEKIASRLVPRAHDTAISPRFL---SKGVKIPGKYFSLVRCFRPDVIDSTHGVEFNQLGGFIVGKDLSFRNLLGLLKDFIEMTGAKEIKFLPDYFPFTEPSVQISGWMEVAGAGIFRPEMTEPLGIKEPVIAWGFGIDRLAMLKLEIEDIRDLFSQKLD........ 497
197 1.000e-83UniRef50_T1BJI9 Phenylalanyl-tRNA synthetase, class IIc, alpha subunit n=1 Tax=mine drainage metagenome TaxID=410659 RepID=T1BJI9_9ZZZZ  ali  15  90.GKWKDMRFRKYDLNLQGQHVDRIGRHPLRYLIKEIREIFLEMG--FTEMTGNYIESAGWNMDSLFIPQDHP-----AREMQDTFYLENFSTEELALFRKFGEVH-VNGVRGYSGYGWNIEESKKMVLRTHTTPNTIRYLSRIKAKEIG---LFSVEKVFRHESVDWKHLAEFHQIEGAVHSKSASLATLKWLMRYFYERLGFSEIRLVPSYYPYTEPSMINGKDVEMGGSGIFRPEVTKPLGLKYPVMAWGLGLERLALIYYGLEDLRELYQSDIWLRNFKIKI 375
198 1.000e-83UniRef50_A0A0Q1B973 Phenylalanine--tRNA ligase n=1 Tax=Desulfuromonas sp. SDB TaxID=1735325 RepID=A0A0Q1B973_9DELT  ali  15  226..KWENKKFRKYNIDLAPKPILSGRLHPYGRFLDLVRSKLTSMG--FMEMRGPVVESEFYNSDLLYMPQYHP-----ARDIHDIYLVKDPSKARLPILNNVAQAHRDGGRSGSWGYDFDVDKTQQLILRSQGTAISARTLASKPHI---PGKYFAIARCFRYDQVDATHAPDFFQIEGIVIEEKINFCHLLGLLSTFAKKLAGDNIKFVPGYFPFTEPSVEAHGWIELGGAGIFRPEITESVNILCPVIAWGLGLDRMAMNALKINDIRELFT--IDLEKIR... 505
199 2.000e-83UniRef50_A0A2D4BJU2 Phenylalanine-tRNA ligase, alpha subunit n=1 Tax=Pythium insidiosum TaxID=114742 RepID=A0A2D4BJU2_PYTIN  ali  15  482..AWKSETFKPYNFNTMGLTVGGGHLHPLMKVRAEFRRVLMDMG--FSEMTNRFVESSFWNFDSLCV----------------VFKPASCLTVPEEYYERVHDMHENGGSIGHGRGAFKRETSMKNLLRTHTTAISAQMLYKLANQPGGPQKYFSIDRVFRNESMDATHLAEFHQVEGVVADYDLSLGDLIGVIKAFFNKIGITQMRFKPAYNPYTEPSMEIKKWTEIGNSGVFRPEMLRPMGLPENVIAWGLSLERPTMIKYRLSNIRDLFGHKVDLENTRT.. 758
200 2.000e-83UniRef50_A0A2D6KWW9 Phenylalanine--tRNA ligase alpha subunit n=4 Tax=Candidatus Woesearchaeota TaxID=1801616 RepID=A0A2D6KWW9_9ARCH  ali  14  221.GSWKDKRLRAYDIKINVPKKYPGRKQPYRRFLETVRKKFSSLG--FTEMTGPTVETDFWNMDALFMPQFH-----SARDIHDAYYIKEPKYGEL----DEALMKKVKQAHENGFNTWQYKFDTKRLLRTQGTACSARMLTSENLKIPG--KYFALVRCFRSDVIDATHLVDFYQTEGIILEEGLNFRHLKGVLRMFAEEFCETDIKIVPGYFPFTEPSAELHGWIELAGSGIFRPEMCKPLGIDVPVLAWGIGIDRIGMFKLGIKDIRQLFSQDL......... 497
201 3.000e-83UniRef50_A0A023B7K5 Phenylalanyl-tRNA synthetase alpha subunit n=1 Tax=Gregarina niphandrodes TaxID=110365 RepID=A0A023B7K5_GRENI  ali  15  191.GEWRGAEFKPYNFNAAGIAPCFGSIHPLIKTMNMFRQILQQM--NFEEMTRRWVESSFWNFDALFQPQTHP-----VRDAHDTFFLKHPARLDGPYFERVKEIHESGDHESHGWFPWDAEESYKLILRTHTTAVTSRILYQKNPDVKIDRRFFSIDRVFRNETLDATHLAEFHQIEGIVASTTASLSELMGIIKTFFAKIGINDVEFKPAYNPYTEPSMEINKWTEIGNSGVFRPEMLRPMGLPEDVLGWGLSLERPTMINYNVKDIRELIGPKAKL....... 513
202 3.000e-83UniRef50_A0A1Q9P4E2 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Candidatus Heimdallarchaeota archaeon AB_125 TaxID=1841596 RepID=A0A1Q9P4E2_9ARC  ali  18  212.GSWRDTKLREYNLKASPPIFYGGRKQPYAAFLDDVKQKLCALG--FKEMRGPAVELEFWNFDALFQAQDH-----SAREWSDVYQVSEPKHGKLPEADYVENVKKAHEGYNTGSKGWRYKWNPRLVLRAHGTSVSARTLVDLEV----PSKYFSISRCYRPDTVDATHLSEFTQVEGIVVDPSITFRDLLGILKAFAVDIAEENFKFKPDYYPFTEPSVELNGWIEFGGAGIFRPEVTKPFGIEAPVIAWGLGIERLFMVKHGVADIRELFSHK.......... 486
203 7.000e-83UniRef50_A0A1J5X7V8 Phenylalanyl-tRNA synthetase alpha subunit n=1 Tax=Amphiamblys sp. WSBS2006 TaxID=1866961 RepID=A0A1J5X7V8_9MICR  ali  16  190..EWEKLSFKEYNYDALGKRERKGGLAPLMKMRDEFREIFLQMG--FTEMTDKYIETSFWNFDTLFQPQSHPS-----RDLQDTFFVSSCAESRIPLLATTRRAHEEGIEGSEGRYTWKLSETQKCILRTHTTAVTSRTLHEHSKQSPFPGRYFSIDRVFRNETLDATHLAEFFQVEGVIVDRNIGVAELISVLSSFFGRLGMEDLRFKPAFNPYTEPSMEVKKHVEIGNSGLFRPEMLQAYGFDVCAIAWGLSLERPAMIKFGVDDIRKLVGS........... 469
204 8.000e-83UniRef50_A0A2D6WWP8 Phenylalanine--tRNA ligase subunit alpha n=1 Tax=archaeon TaxID=1906665 RepID=A0A2D6WWP8_9ARCH  ali  15  153.GLWKNATLKPYNVTATGKRIYPGKKHPYRAFLEDTKLKLVEMG--FQEMTGPNIEMEFWNFDALYQAQNHPSRDWTETY-RMFYPKIGNVVNEKKIIDNVAKTHENGGKSGSTGYKWERAQAMQLMPRAHDTAISPRYLSEISGEIEIPGKYFSLVRCYRPDVIDATHGVEFNQFGGIIVDKNLSFRDLLGLLKDAVMEISAEDVKFYPDYYPFTEPSVQISGWVELAGAGIFREEVTKPLGIDETVLAWGFGIDRLAMFKLGITDIRDLFSRDLAL....... 437
205 9.000e-83UniRef50_A0A1D3DAH9 Phenylalanyl-tRNA synthetase alpha chain n=1 Tax=Cyclospora cayetanensis TaxID=88456 RepID=A0A1D3DAH9_9EIME  ali  16  242...WKQQELKPYNFFACGTKLRRGAPHPLMLVQKQFKHVLTAMG--FQEMTNQFVENSFWCFDALYMPQQHP-----ARDAQDTFFIKSPERSHPSMLSDVRVMHEQGGCGSTGWYTWSLDEATKNIMRTHTTAMTVRMMMRLQTGVFTPRKLFSIDRVFRNESLDATHLAEFHQVEGVVAGYGLSLGHLMGVMRTFYTAIGIEELRFKPTFNPYTEPSMEIFGWIEVGNSGMFRPEMLRPLGLDVVVIAWGLSLERPTMIKYGLSNIRELFGHKALLGGV.... 596
206 1.000e-82UniRef50_A0A2N1R393 Phenylalanine--tRNA ligase (Fragment) n=2 Tax=Bacteria TaxID=2 RepID=A0A2N1R393_9SPIR  ali  14  28.GSWKGAAFRSYNIMSRPARLIPGRRNPYVQFLESVKDKLVSLG--FEEFDGGLVETEFWNGDALFMPQFH-----SARDIHDVYYLAEPTKIEEPYLTRVAATHENGGATGSRGYGFDREFTKRLVLRSQGTVLSARQLPRAAV----PGKYFGIARCFRYDKVDATHLSDFYQTEGIVLGEDVNLRTLLGFLEMFAVEVAGKEVKYVPGYFPFTEPSVEVHGWFELGGAGIFRPEVTEPLGVSVPVLAWGIGIDRMALMALGLNDLRELFSYDI--ENVRLR. 309
207 2.000e-82UniRef50_A0A1Y4DQF6 Phenylalanine--tRNA ligase alpha subunit n=2 Tax=Bacteria TaxID=2 RepID=A0A1Y4DQF6_9BACT  ali  17  99............DLTLPGYPVAKGHRHPLSVAQDRMTDILSRLGFEWAE--GPWVEDEKHNFDLLNIPLHHP-----ARDAQDTFFVDG---------------------------------KMPLVLRTHTSNVQSRYMEKH----KPPLRIMAPGRVFRNDSLDATHSPVFHQIEGLYVDKHVSLADLKSDLTAFMKGLFGNKIRFRPSFFPFTEPSCKGNGWIEMLGAGVVHPNVLRNCGIDPEVYAFGMGVERLAMMMLNIKDIRTFYENDLRV....... 342
208 3.000e-82UniRef50_A0A0K0WJT7 Phenylalanine--tRNA ligase alpha subunit n=10 Tax=Leptospirillum TaxID=179 RepID=A0A0K0WJT7_9BACT  ali  16  222..SWKGGAFRPYSLETPPPRPMLGQSHPYREYLEEVRRQLVRLG--FEEMTGPIVESEFWNMDTLFIPQTHP-----ARDIHDIYFVRDPREVDKDILSRVRAVHAGEGETSRGWRQFNEKQARRLLLRSQGTALSARKLASGPKI---PGKYFALARCFRYEQVDQTHAVDFYQAEGIVVEEGASFRTLLGLLTLFAREVAGREVHFKPAYFPFTEPSVEVHGWMELGGAGLFRPEVLRPLGVNTPVIAWGLGIDRMAMMRLGLSDIRDLFSGSL......... 498
209 3.000e-82UniRef50_Q76KA8 Phenylalanine--tRNA ligase alpha subunit n=44 Tax=Archaea TaxID=2157 RepID=SYFA_THEKO  ali  15  214.GKWREVEFRKFDIKAPVRRIYPGKKQPYRAFLDKIRRRLIEMG--FIEMTDSLIETQFWNFDALFQPQNHP-----AREWTDTYQLKYPKVGSLPDEERVKAAHEHGGDTGSWGYVWSPERAMLLMPRAHGTALDARQL---AKGVEIPGKYFTIQRVFRPDVLDRTHLIEFNQIDGFVVGEDLNFRHLLGILKRFAVEIAGKKVKFLPDYYPFTEPSVQMSGWVEFGGAGIFREEMTKALGIDVPVIAWGIGIDRLAMFKLGIDDIRYLFSYDLWLREARL.. 499
210 4.000e-82UniRef50_A0A2E3J4G5 Phenylalanine--tRNA ligase n=2 Tax=Gemmatimonadetes bacterium TaxID=2026742 RepID=A0A2E3J4G5_9BACT  ali  16  253.GEWKGVDFRRYDLSIKPPRITIGRHHPYRAYLDSTRRKLLALG--FEEMKGPLVETEFWNMDALYMPQFH-----AARNIHDAYYVKEPTHVEEPYFSNVAEAHSTGGDTGS--RGWRYEFNRQLLLRSQGTALSARTLASGPNI---PGKYFGIARCFRQDDVDATHSADFFQVEGIVLGESINFRSLLGLLKLFALEIAQEEVRYVPDYFPFTEPSVELQGWIELGGAGLFRPELTRPLGVNVPVIAWGLGVDRMAMVALGIDDIRDLFSSDLD--FVRNE. 535
211 4.000e-82UniRef50_A4YIL1 Phenylalanine--tRNA ligase alpha subunit n=36 Tax=Sulfolobales TaxID=2281 RepID=SYFA_METS5  ali  17  191.GSWREYEFKPYNVEANPPFFPIGKTHYFRDFIEKVKDLMVGLG--FVEVSGDFVETEFFNFDMLFQPQDHP-----AREIHDSFVIEGKGNLPGSDL-----VRKVKEVHEKWWYSWSEDNARRLVLRSQTTAVTARVLSG----APKRIRAFTIGKVFRPDSIDATHLIEFHQMDGLVIEEDFTFRDLLSTLRDIFQGLGVKQVKFKPGYFPFTEPSVEGLGWVEMAGAGLLRKEVTEPAGVFSPAGAWGIGIDRLAMLFLGVKDIRDLYSLDIYLRSRRV.. 464
212 4.000e-82UniRef50_A0A0B3AHD8 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=archaeon GW2011_AR17 TaxID=1579375 RepID=A0A0B3AHD8_9ARCH  ali  14  209.GKWQGKKFRKYDVKINVPKIYGGRRQPYMEFLNKIKVQLVQLG--FKEMSGPLIETEFYNFDVLFQPQDHPARTWT-----DTYHLKYPTQGKLPVVNRVKNVHQDGGRTGSWGYKWDPKIAMQLMPRAHATAVSARQMVK---GIENPCKYFTISRVYRPDVLDATHLIEFNQLDGFVTDKSISFRTLLGMLKLFAIEIAGEEVKFFADYYPFTEPSVQISGWVELGGAGIFRPEITETLNIETPVMAWGLGIDRLAMFKLGIKDIRYLFSQDL......... 485
213 5.000e-82UniRef50_A0A256ZD92 Phenylalanine--tRNA ligase subunit alpha n=1 Tax=Desulfurococcales archaeon ex4484_204 TaxID=2012517 RepID=A0A256ZD92_9CREN  ali  11  220.GAWRNAIFKKYDLSIDVPTVYPVRKHPYIQFLNYVRYVISSMG--FFEVKGPYVESELWNFDILFVPQYHPARRDT-----DVYFIKG----LPPASEDEGLLKVVKEIHEYGWYRWDPLKALRLILRTHTTPVSIRTICER---GGGEYRAFSLDRVFRPDTPDPTHLMEFHQLEGIIVGRRVAFKHLLGFFKAFAKFLGLGEVRFKPAYFPFTEPSVEGFGWIEVFPGGMFRPEVLKAVGLEYNVAAWGIGIDRIAMLILGIDDIRNLYTNNL......... 488
214 5.000e-82UniRef50_A0A2J6N992 Phenylalanine--tRNA ligase subunit alpha n=1 Tax=Candidatus Korarchaeota archaeon TaxID=2056630 RepID=A0A2J6N992_9ARCH  ali  17  192.GRWKQG-LKPYDLSALPQPSRGGKKNFFQEFLSWVREILEDMG--FQESLGPYVETEFWNFDALFQAQDHP-----AREMHDVLYIEGKGKI-----NDEDLIRRVAREHEGWGYSWSLDKASSLVLRSQNTAVSARFLAEHKER---PIKMYSVDRVFRKDEIDQKHHIEFYQSEGIVVDKSLSLADLIGFLTQFARQLGFDEVRFYPSYFPFTEPSIEGYGWMEALPGGVFRPEVTRTLGTDEPVLAWGIGISRLAMAKFGLNDIRFLYSPDVD........ 458
215 5.000e-82UniRef50_A8BZP3 Phenylalanyl-tRNA synthetase alpha chain n=6 Tax=Giardia intestinalis TaxID=5741 RepID=A8BZP3_GIAIC  ali  14  239........IKPLNFESLGSVPHAGAFHPLMEMRRLFVEAFVGMG--FEQMKTPLVESSFWNFDALFQPQSHP-----ARDSQDTFFVGGYSQLDAELVERIRTAHESGGEAMRYRYVWKVSEALRNVLRTHTTAVSARVLYEIGQHYQKPRRFFSIDRVYRNETLDATHLCEFNQVEGMVIDRNLTLGNLIATLRAFFARLGMTQLKFKATYNPYTAPSMEIKRWVEVGNSGLFRPEVLLPLGLDVQVLAWGLSLERPTMIVHEISNIRDLIGPSTSLELIR... 529
216 6.000e-82UniRef50_A0A1J4UN97 Uncharacterized protein n=2 Tax=unclassified Candidatus Micrarchaeota TaxID=1801634 RepID=A0A1J4UN97_9ARCH  ali  15  204.GSWKKAAFKEYDVSTVLAPVSIGLRQHYKRLLHQVKEELVGLG--FKEVHGPLVETEFWNMDALFMAQDHP-----AREIHDAFQLEEPCKG---TVNDKALLARVKKAHEEGSIGWRYEWNSDLVCRSQNTGVSAR---NLAKGLETPARLFSIGKVFRPDVIDWKHFIEFTQCEGIVADENMNFRELLGYLKSFAIEIFGDDARFYPTYFPFTEPSVEMRGWVEVGGAGVFRPEMLEALGVNIPVIAWGLGIDRLAMIRLGLDDMRDLNSSDL......... 479
217 7.000e-82UniRef50_H9ZZU1 Phenylalanine--tRNA ligase alpha subunit n=3 Tax=Fervidicoccus TaxID=685950 RepID=H9ZZU1_FERFK  ali  15  208.GKWREVKFKEYNVEAEPPKVYPGIQHFYSKFIEKIKMILLELG--FKEVYGSIIEQEFWNFDVLFQAQDHPS-----REIHDTFWIDKEVKARKELIEKTREVHEYGGKTGSIGYKWDQEVAKRLILRTQTTVVSGRTL---SLSPEAPFRFFTIGKVFRPDVIDARHLPEFYQFDAIISEKDMSFSKFLGMLKLFFKKMGFEELIFKPAYFPFTEPSVEGYGYVEVFGAGMFRPEVLEIFDIKHPVGAWGMGLDRLAMALLNLSDIRMLYRNLENLRNSYSN. 492
218 7.000e-82UniRef50_A8ABV1 Phenylalanyl-tRNA synthetase, alpha subunit n=2 Tax=Ignicoccus TaxID=54258 RepID=A8ABV1_IGNH4  ali  14  192.GTWKDAEFKKFDLSVEFPARLPKRRHPLLEFHEYVKEVLVSMG--FEEVVGDYVTNAFWNFDVLLVPQFHPARSET-----DVFYASG-ARVPPP---PEGLLEEVAEVHREMWGYWRAEVALKVLLRTHTTVVSAQTMYSR---GGGEYRAFSLDRVFRSETLDPTHSMEFHQLEGIIVGKEVSFKHLLGFFKEFAKKLGLGEVKFKPAYFPFTEPSVEGFGWVEVFPGGMFRPEMLKPLGLDFSVAAWGIGIDRLAMLALGLSDIRDLYSNDL......... 459
219 1.000e-81UniRef50_A0A1G6YSX3 Phenylalanine--tRNA ligase alpha subunit n=3 Tax=Bacteroidetes TaxID=976 RepID=A0A1G6YSX3_9BACT  ali  12  93............DLTLPGDAIPLGSRHPISLMRHKIISIFQRLG--FAVAEGPEIEDDWHNFTALNMPEHHP-----ARDMQDTFYVD---------------------AGENAAVDW--------LLRTHTSNTQIREMEKGKL----PIRVICPGRVYRNETISARSHCFFHQVEGLYIDENVSFADLKQTLYFFVREMYGKDVRFRPSYFPFTEPICKKTGWVEILGCGMVHPNVLQNCGIDPEGFAFGMGVERPAMLKYGINDIRLFSENDVR........ 339
220 1.000e-81UniRef50_X1DWK7 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X1DWK7_9ZZZZ  ali  18  49.GTWKDYDIKPFDVTKPGPSLKAGKTHPLVNLINEIREIFISMG--FTEIRGPIVESAFFNFDALFQPQDHP-----ARELQDTFYLNNPKFAKLPEKDRVKATHENGGDSNSLGYQWDENIAKQTVLRTHTTATTMRRLAQYRNNDKTPVKVFCIDRVFRNEKLDKSHLAEFTQIEGIVIDENVNLSDLIGLLSEFYKKMGFEKIITRPGFFPYTEPSDKLGEWLEMGGSGIFRPEV............................................... 291
221 1.000e-81UniRef50_A0A257ANP0 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Candidatus Bathyarchaeota archaeon ex4484_205 TaxID=2012510 RepID=A0A257ANP0_9AR  ali  18  196.GKWKKTRFKPYNLAVTPPPLWIGKKNPYIEFVNMAREILIEMG--FEEYKGPWIEMEFYHFDALFQPQDHP-----ARELFDTFHVSFPEVGKIPELTKVKRTHENGWETGSRGYNWSERVASRRILRGQTTSVSIRYLTTHK---EPPIRMFTIDDCFRYDVMDATHSIQFKQAEGIVGERGITLKELFGILEEFAKRLGFKEIKFVPSYFPFTEPSCEALGWIECLGAGIFRPEVLKPLEIDFPVLAWGIGIDRLAMAILGINDIRKIRRPDL......... 471
222 1.000e-81UniRef50_A0A256Y590 Uncharacterized protein n=3 Tax=Archaea TaxID=2157 RepID=A0A256Y590_9ARCH  ali  15  225.GLWREKNFRQYDISSPVPKIQRGRRHPVKEVCNLIKNIFIQMG--FKEMIGPWVETAFWCMDSMWIPQDHP-----ARDVQDTFFIG--KQGNLPLVQRVREAHENGGETGSTGYKWNEKKAKELILRTHSTATTFRMFGLHNINYD--CKYFYIANTFRNEAIDATHLPEFLQAEGFIMADDLTLSDLMGFVKEFYSKLGIKKIKFKPTYNPYTEPSMEAHYWDELINSGIFRPEALYPYGIKKTVIAWGMGVSRMASLLAKKNNLRQLIGAGCDIDWIQN.. 507
223 1.000e-81UniRef50_A0A2U3CDS1 Phenylalanine--tRNA ligase subunit alpha n=1 Tax=Candidatus Heimdallarchaeota archaeon B3-JM-08 TaxID=2012493 RepID=A0A2U3CDS1_9A  ali  17  211.GEWRSLQLKKYKIATRPKHIPIGRKHPYLLFLQEVKEKLLGLG--FSEMRGPIVETEFWNFDALFAAQDHPAREPT-----DVYSIQDPPYGKLPLVNAVKTVHETGEPVGSRGYNWSPKKASLLLLRPQGTSVSARTLYNL----EIPAKFFSIARCYRPDSVDATHLSEFNQLEGIVCDPSITFRDLLGILKTFAVEVAATKVKFRPDYYPFTSPSVEKLGYIEFGGAGMFRPEVTAPFEIKDPVIAWGIGVDRLYMVKRGINDIRELFTQKLWLRTVPV.. 495
224 1.000e-81UniRef50_X1XK36 Uncharacterized protein n=3 Tax=Bilateria TaxID=33213 RepID=X1XK36_ACYPI  ali  16  1..........................................MG--FTEMTNNFVESLFWNFDALFQPQQHP-----ARDSHDTFFLDNPQ---TSENFPQEYLNKVKIVHSKGGYDWSLDEAKKDVLRTHTTDVSARMLYGLAKDFK-PTKYFSIDRVFQNETLDATHLAEFQQVEGVIADYNLTLGDLIGVLHMFFERLGMTEIKFKPAYNPYTEPSMEIFCYH--HNSGMFRPEMLLPMGLKVNVIAWGLSLERPTMIKYGINNIRDLVGPRVNLQMVQDN. 239
225 1.000e-81UniRef50_A0A2E8S8F6 Uncharacterized protein n=1 Tax=Euryarchaeota archaeon TaxID=2026739 RepID=A0A2E8S8F6_9EURY  ali  22  4...............................LIERIRSIFLEMG--FSEMVENYVQPAGWNMDALFIPQDHP-----AREMQDTFYLTNPEMIPIPLTSTWKSIHETGGETESVGWTFDESVSKKGLLRTHTTVNTIQYLHQKPTE---PCRVFAVDRVFRKESIDRTHLPEFHQIEGIIMEEGANLPMLVNTLKTFYAKMGIDEVRVRPAYFPYTEPSKWKGKWLELGGAGIFRPEVTEPLGCKWPVCAWGMGLERLAMLVLGLDDIRQLYISDL......... 247
226 1.000e-81UniRef50_A1RYS0 Phenylalanine--tRNA ligase alpha subunit n=9 Tax=Archaea TaxID=2157 RepID=A1RYS0_THEPD  ali  14  219.GGWREVVFKEFDLSVEVPQAGFGRKHPYLEFLDWVREILVSMG--FEEMKGPHVELELWNFDALFQAQDHP-----AREIHDTYFVKGGRVGDEELLRRIALTHENGWVTGSWGYKWDPARALRLILRTQTTAVSARTLYAR---GEGEYMCFSLDRVFRPENLDAKHSMEFYQLEGIIVGRRVTFRNLLGFFQEMSRRLGLGEVKVKPAYFPFTEPSVEGFGWIEVFPGGMFRPEVLAPLGLRVNVAAWGIGIDRIAMTVLGVDDIRVLFSQDLEY....... 497
227 2.000e-81UniRef50_A0A2D6P9D4 Phenylalanine--tRNA ligase subunit alpha n=1 Tax=Candidatus Woesearchaeota archaeon TaxID=2026803 RepID=A0A2D6P9D4_9ARCH  ali  17  218..KWESQRFRRYDVETPVPRLHIGKTQPYLDFLDELKLKLMQLG--FEEMEGPIIDTEFYNFDALYQPQNHPARTWT-----DVYKLKYPKEGDKKLVERVKNSHETGGDIDSTGYKWSEKIAKSLMPRSHTTSVSARKMSSNPKI---PGKYFTIGRVFRPDVLDATHLIEFNQLEGIVIGDELSFKNLLGILKKFAEEVGAKKIRFLPDYYPFTEPSEKLNKWVEFGGAGIFRPELTHPLGITQPVIAWGLGVDRMFQQRIKSKDIRELFSDNLWLREVKD.. 502
228 2.000e-81UniRef50_Q9Y9I6 Phenylalanine--tRNA ligase alpha subunit n=6 Tax=Thermoprotei TaxID=183924 RepID=SYFA_AERPE  ali  17  209.GEWRRLRFKPYNVKAEPPRVLPARRHFLAEFIERLRDILRELG--FREVRGPLVELELFNFDVLFQAQDHP-----AREIHDSLWIKSPRRGDLS--GYSDLVERVASVHERGWYRWSPEVASRYILRSQTTAVSARILATRPN---PPARFFTVGKVFRSDAVGPTRLPEFHQLDGIEGDEGYTFRDLLGRLDEIASMLGL-KLKFKPAYFPFTEPSVEGGRWLELFGAGMFRPEVLEAVGVDYPVGAWGFGIERLAMAFYGVSDIRKLYTRNVD........ 478
229 2.000e-81UniRef50_A0A1Q7LPS1 Phenylalanine--tRNA ligase alpha subunit n=6 Tax=Archaea TaxID=2157 RepID=A0A1Q7LPS1_9CREN  ali  15  219.GDWERVQLRTYNVSSNVPNTWPGRLHPYAKFLRNAKQQLIGLG--FQEVTGPLVEYAFINCDCLYMPQDHP-----AREVHDLFYLKDPSKGDLSIVDRVEETHENGDKTGSKGWRYSYSRDERLIMRSHGTALSVRAM--LSKNVKIPGKYFAVARCYRPDPLDKTHLMEFNQVEGIIIDPNLNLRNLLGVLEMFAKEIAGDKVRFKPDYFPFTEPSVEGYGWVEFGGSGIFRPEVTIPLGIKAQVLAWGLGIDRLYMMNKRIIDIRQLFSPDL--EWIRN.. 502
230 3.000e-81UniRef50_Q9A0I1 Phenylalanine--tRNA ligase alpha subunit n=1968 Tax=root TaxID=1 RepID=SYFA_STRP1  ali  14  98............DVTLPGRQMTLGHRHVLTQTSEEIEDIFLGMG--FQIVDGFEVEKDYYNFERMNLPKDHP-----ARDMQDTFYI-----------------------------------TEEILLRTHTSPVQARTLDQHDFS-KGPLKMVSPGRVFRRDTDDATHSHQFHQIEGLVVGKNISMGDLKGTLEMIIKKMFGDEIRLRPSYFPFTEPSCKKTGWIEILGAGMVHPSVLEMSGVDYSGFAFGLGQERIAMLRYGINDIRGFYQGD.......... 339
231 3.000e-81UniRef50_UPI00096A5873 phenylalanine--tRNA ligase subunit alpha n=1 Tax=Natronomonas sp. CBA1134 TaxID=1906246 RepID=UPI00096A5873  ali  15  211.GEWEDVEFAEYNVEADAEPVTGGKTHILRQTAESVKDTLVGMG--FQEMQGPHADADFWINDALFMPQDHPARTHWDRFTLDT----DPM-TDLPLVGRVEDAHRNGVGPDGEGYHWSREFAEEVALRGHTTSLSMRYLSEEIGDLEPPQRFFSVEKVYRNDTLDATHLLEFFQIEGWVMAEDLSVRDLMGTFEEFYAQFGITDIEFKPHYNPYTEPSFETGEIVEIGNSGIFREEVLSPLGVECDVMAWGLALERLLMLMYGFEDIRDVHGTLCDLDLLRN.. 497
232 3.000e-81UniRef50_A0A1A7T4I5 Phenylalanine--tRNA ligase alpha subunit n=72 Tax=root TaxID=1 RepID=A0A1A7T4I5_ENTFC  ali  16  35......................LGKKGPITEVLRGMRDLSAEERPKVNEIRDQAVEERKESLDVTLPGGTRHVLTQIMEEIEDTFVGMGYQIVEGTEIESDHYFERMNLPKDHPARDMQDTFSDDVLLRTHTSPVQARTMEKHDFS-KGALRMISPGKVFRRDTDDATHSHQFHQIEGLVVDKGITMGDLKGTLEVLLKELFGADIRLRPSYFPFTEPSCKYTGWIEILGAGMVHPNVLEMSGIDYSGFAFGLGPDRIAMLRYGVNDIRNFYLNDVR........ 339
233 4.000e-81UniRef50_A0A1Q9NJX9 Phenylalanine--tRNA ligase alpha subunit n=2 Tax=Candidatus Heimdallarchaeota TaxID=1936272 RepID=A0A1Q9NJX9_9ARCH  ali  17  207.GKWKNVSFKPYSLTTKPRTIYPGRYNPYKQFLDHLRIKLIGLG--FQEMKGPLVEQEFWNFDALNAPQDH-----AAREDSDILLINSPTHG---ILSKDEYVSNVAKTHEDGWKTHRYKWDPKLLLRPQGTSISARTL---AQIEKPPAKFFSIARCFRPDQIDATHDVEFDQTEGIICDPSLTFRDLLGMLKTFAVEVAGTDVRFRPDYYPFTSPSVELSGYIEFGGAGVFRPEVTQPFGIDYPVLAWGLGVGRLFMTKYNIKDIRELFTQNL......... 483
234 4.000e-81UniRef50_D0WN32 Phenylalanine--tRNA ligase alpha subunit n=7 Tax=Actinobacteria TaxID=201174 RepID=D0WN32_9ACTO  ali  14  103............DVTVPTRRNPRGARHPLTVLVEDVADFFIGMG--WEIAEGPEVEHEWFNFDALNFGPDHP-----ARQMQDTFYVSGVQTVEGAGAPDAGAADGTGDVEAQPG----------LVLRTHTSPVQGREM----LERGAPLYIACPGKVFRTDALDATHTPVFHQVEGLAVDKGLTMAHLKGTLDHFARAMFGPKTRLRPSFFPFTEPSAEMDGWIEWGGCGMVNPEVLRNAGIDPDGFAFGMGLERTLMFRHGIADMRDMVEGDVR........ 366
235 4.000e-81UniRef50_A0A1V4IGE1 Phenylalanine--tRNA ligase alpha subunit n=43 Tax=Bacteria TaxID=2 RepID=A0A1V4IGE1_9CLOT  ali  14  91.........DVIDISLPGRKNRVGRKHPLELALDGMKDIFISMG--FTIEDGPEVELDYYNFEALNIPKNHPARSE-----QDTFYIND-----------------------------------NVVLRTQTSPVQIRVMEN----QKPPIRMISPGKVFRSDAVDATHSPIFYQMEGLVVDKGITFADLKGTLEMFAKKMFGDDVKFRPHHFPFTEPSCKGSGWIELLGCGMVHPDVLRHGGIDPEVFAFGFGIDRMVMLKYALDDIRLLYESDMR........ 334
236 5.000e-81UniRef50_P17921 Phenylalanine--tRNA ligase alpha subunit n=2072 Tax=root TaxID=1 RepID=SYFA_BACSU  ali  12  94............DVTLPGNPVAVGGRHPLTVVIEEIEDLFIGMGYTVEE--GPEVETDYYNFESLNLPKEHP-----ARDMQDSFYI-----------------------------------TEETLMRTQTSPVQTRTMEKH--EGKGPVKIICPGKVYRRDNDDATHSHQFMQIEGLVVDKNISMSDLKGTLELVAKKMFGQEIRLRPSFFPFTEPSCKGTGWIEILGAGMVHPNVLKMAGFDPQGFAFGMGVERIAMLKYGIDDIRHFYTNDVR........ 336
237 6.000e-81UniRef50_A0A061HUU5 Phenylalanyl-tRNA synthetase alpha chain-like protein n=6 Tax=Eukaryota TaxID=2759 RepID=A0A061HUU5_CRIGR  ali  17  1..........................................MG--FTEMPDNFIENS-WNVDGLFQPQQHPACDQ-----HDAFFLKDPAEAQLPM----DYVQRVKWTHSQGSYTWKLEEARKNLLRTHSTAASARTLYSLAQKKPFPAKYFSIDRVFRNETLDATHLAEFHQIEGVIANHGLTLGHLMGVLREFFTKLGITQLLFKPAYNPYTQPSMEVKKWVEVGSSEVFRPEMLLPMGLNVSVIAWGLSLERPTMIKYGINNIRELVGNKVNTQMVYD.. 248
238 6.000e-81UniRef50_A0A2H6ID11 Phenylalanine--tRNA ligase alpha subunit n=4 Tax=Bacteria TaxID=2 RepID=A0A2H6ID11_9BACT  ali  15  93............DITIPGKYIPAGSRHPINRVLDEIVDIFLFMG--FTVEEGPEVEMDYYNFEALNIPRDHP-----ARDMQDTFY------VETDERQSSSPVDKEGAES-------------DVVLRTHTSPVQIRVMEK----QKPPLRFIAPGKVYRCDS-DVSHTPMFHQVEGLMVGEDITFANVKSVLKLFVQSLFSVDVRFRPSYFPFTEPSCKGTGWIEVLGAGMVHPKVFEGVGYDYTGFAFGMGVERLTMLKYGIDDIRLFYENDLR........ 349
239 6.000e-81UniRef50_A0A2T7IBJ6 Uncharacterized protein n=1 Tax=Theileria orientalis TaxID=68886 RepID=A0A2T7IBJ6_THEOR  ali  17 1066.GKWQEAEFKKYNFFSSGKRVNCGDLHPLVHSMYEFRRILTSMG--FQELTSRYLESSFWCFDAMYIPQQHP-----ARDTQDTFFLRDPERVDVKFFDPVEDVRAAHGNASKWQYEWSLEESMRTVLRTHVTPCTARKLKQIAEDHQKPCRYFAIDKVFRNEATDSTHLCEFHQVEGFVVGFDLGLADLIGIMETFYGAIGINPLKFKPAYNPYTEPSMEIFGWIEVGNSGIFRPEMLLPMGLPENVIAWGLSLERPTMVNSNIRNIRDLIG............ 1352
240 6.000e-81UniRef50_A0A0Q2M0Z3 Phenylalanine--tRNA ligase alpha subunit n=4 Tax=Thermococcus TaxID=2263 RepID=A0A0Q2M0Z3_9EURY  ali  15  213.GKWREVEFKRFNIHAPVRKLHPGKKQPYRAFLDKLRRRLIEMG--FIEMTDSLIETQFWNFDALFQPQNHP-----ARDWTDTYQLKYPKSGHLP---AEELVARVKAAHEHGGYVWSPKRAMLLMPRAHGTALDARQL---AKGVEIPGKYFTIQRVFRPDVLDRTHLIEFNQIDGFVVGEDLTFRHLLGILKRFAVEIAGKKVKFLPDYYPFTEPSVQMSGWVEFGGAGIFREEMTKALGVDVPVIAWGIGIDRLAMFKLGIDDIRYLFSYDLWLREARL.. 497
241 7.000e-81UniRef50_M0DT56 Phenylalanyl-tRNA ligase subunit alpha (Fragment) n=5 Tax=Archaea TaxID=2157 RepID=M0DT56_9EURY  ali  15  9.GEWRDAEFAEYNVEAEAETARGGRKHVLRRTADRVKDVLVGMG--FQEMEGPHADADFWINDCLFMPQDHPARTHWDRFALDV----DPMEIPDELIDRVESAHRDGWGEDGDGYHWSEDFAREVALRGHTTSLSMRYLSGIAAELEPPQRYFSVEKVYRNDTLDPTHLLEFFQIEGWVMAEDLSVRDLMGTFEEFYRQFGITDIKFKPHYNPYTEPSPETGEEIEIGNSGVFREEVTGPLGVECDVMAWGLALERLAMLTTGAEDIRDLHGTLADIDFLRN.. 295
242 7.000e-81UniRef50_UPI000781E3E4 phenylalanine--tRNA ligase subunit alpha n=1 Tax=Treponema endosymbiont of Eucomonympha sp. TaxID=1580831 RepID=UPI000781E3E4  ali  14  233.GEWKDGAFRRYNISVPPARIVPGRTNPYADFLEGVKDKLCSLG--FEEFDGPLVETEFWNSDALFMPQFHP-----ARDIHDVYSVKNPTHIDEPFLSNVAAAHENGGDTGSWGYAFDRDFTRRLILRSQGTALSAHRLAA----AKVPGKYFGVVRCFRYDKVDATHLSDFYQTEGIVLGEEVNLRTLLGFLEMFAVEIAGADVKYVPGYFPFTEPSVEVHGWFELGGSGIFRPEVTKPMGVNVPVIAWGIGIDRMALMALGLNDLRELFSTDI......... 508
243 7.000e-81UniRef50_J4DAE8 Phenylalanyl-tRNA synthetase n=2 Tax=Theileria orientalis TaxID=68886 RepID=J4DAE8_THEOR  ali  17  222.GKWQEAEFKKYNFFSSGKRVNAGDLHPLVHSMYEFRRILTSMG--FQELTSRYLESSFWCFDAMYIPQQHP-----ARDTQDTFFLRDPERVDVKFFDPVEDVRAAHGNAAKWQYEWSLEESMRTVLRTHVTPCTARKLKQIAEDHQKPCRYFAIDKVFRNEATDSTHLCEFHQVEGFVVGFDLGLADLIGIMETFYGAIGISPLKFKPAYNPYTEPSMEIFGWIEVGNSGIFRPEMLLPMGLDLTVIAWGLSLERPTMVNSNIRNIRDLIG............ 518
244 8.000e-81UniRef50_A0A0L0LIH2 Phenylalanine--tRNA ligase alpha subunit n=24 Tax=Parcubacteria group TaxID=1794811 RepID=A0A0L0LIH2_9BACT  ali  16  10........................HSHPLTLILQDVNRIFNEMG--FTVADGPEVETEFYNFDTLNIPEHHP-----ARDMWDTFWLK--------------------------------PLNARKLLRTHTSPVQVRFMEAN----KPPIKIIAPGKVFRHEATDATHEAQFYQLEGLVVGENVSLANLKWTLEEFFEKLFGKKIRFRPSYFPFVEPVCKGTGFIEIMGAGLVHPKVLESSGIDYSGFAFGCGVDRLVMLKYGVDDVRLLYQGDLRL....... 244
245 1.000e-80UniRef50_Q2IJB2 Phenylalanine--tRNA ligase alpha subunit n=6 Tax=Bacteria TaxID=2 RepID=Q2IJB2_ANADE  ali  12  95..........PIDVTLPGRRLPRGHRHPVTRATEDISAIFARLG--YEVASGPEIELDWYNFEALNIPPDHP-----ARDMQDTFY------VDESTLSPGGRTGAAPGGPARPGA---------VLLRTHTSPVQIRAM---KRIGGPPIRIICPGRVYRSD-YDQTHSPMFHQIEGLCVDEGITFADLKGTLAAFARAYFGTRTRFRPSYFPFTEPSCKETGWLEVLGAGMVHPRVLENGGVDPTGFAFGMGVERMAMLRYGIDDLRLYFENDLR........ 364
246 2.000e-80UniRef50_A0A0M2PS77 Phenylalanine--tRNA ligase n=11 Tax=Cyanobacteria TaxID=1117 RepID=A0A0M2PS77_PROHO  ali  15  214...WRSVQFKPYNIQDAVPNIPHGRPSILGECIQRIRTLFLTMG--FDEMAGTIVESAFWNFDALFTPQDHP-----AREVQDTFYLADPAALPLPADET--LVQRVQQVHEHHYDGWWPGEASRALLRAHTTPFTARQLYK---TQGQPGKYFSIDKVFRNENVDRTHLAEFHQIEGVVIGELLSIRSLMGYLGYFYEQLGFQDLKFKPTYNPYTEPSLESDSYLEVGNSGMFRREMLEPLGCEVSAIAWGLGLERIALLLYGVDRLSDLIGADSRI....... 485
247 2.000e-80UniRef50_H0EDX1 Putative Phenylalanyl-tRNA synthetase alpha chain n=1 Tax=Glarea lozoyensis (strain ATCC 74030 / MF5533) TaxID=1104152 RepID=H0EDX1_G  ali  14  105.GAWKTAAFKPYNFKSLGADQNAGALHPLNKVRHEFRQIFFEMG--FEEMTNRYVETGFWNFDALFVPQQHP-----ARDLQDTFYISDPKTADKPHAESQD---------DKGDYE-SYWENVQEV---HQDASQ-----KGPDGRPPPARYFSIDRVFRNETVDATHLAEFHQVEGVIADYGLSLGGLMEFMEIFFNKMGIEDLRFKPAYNPYTEPSMEIFSFVEIGNSGMFRPEMLESMGLDMRVFGWGLSLERPTMIKYKVS................... 354
248 2.000e-80UniRef50_A0A2V5NB25 Phenylalanine--tRNA ligase subunit alpha n=1 Tax=Verrucomicrobia bacterium TaxID=2026799 RepID=A0A2V5NB25_9BACT  ali  13  93............DFTLPGRRRALGKLHPLTQVTEDIVRVFRKIG--FAVADGPEIEDEYHCFDALNTPADHP-----ARDMQDTFYVSADASSPSPGGEGRGEGER-----------------KSLLLRTHTTSVQVRVLESQQ----PPVRIIVPGRVYRRDNADATHNPTFQQIDGVYVDKGVTVSDLKGTVEFVFQQVLGEKIRFRPHYFSYTEPIDFSSPWLEIAGCGMIHPAVFENVGYDPEVWAFGFGIERIAMIRYGISDIRLFYENDVR........ 345
249 2.000e-80UniRef50_A0A163VGG0 Phenylalanine--tRNA ligase n=3 Tax=FCB group TaxID=1783270 RepID=A0A163VGG0_9BACT  ali  16  223.GSWRGLRFRRYEMDIPAARIHSGRLHPYRVFLDSVRRKFLALG--FSEMRGSIAESEFWNNDALFMPQFHP-----ARDIHDAYFLRRFAPA-ADILAKVASAHRDGGDTGS--RGWSYDYDESRILRSQGTALSARWMASSPSV---PGKYFAIARCFRYDQVDATHLPDFFQVEGIVLGEDINLRHLVGLLRLFAERIAGTEHKLYPGYFPFTEPSVEMHGWMEMGGAGLFRPEVTKPLGVEVPVIAWGLGLDRMAMTAMGLADIRDLMTDDLRLRAMRVR. 508
250 2.000e-80UniRef50_D8IIE3 Phenylalanine--tRNA ligase alpha subunit n=25 Tax=root TaxID=1 RepID=D8IIE3_LACFC  ali  14  11............DVTLPGTPVAQGQPHVLQQIIDQLEDLFIGMG--YEVAVGDEVEQEVYNFEKLNLPKDHP-----ARDMQDTFYV-------TP----------------------------SVLMRTQTSPMQARMLEQHDFS-KGPLKMISPGKVYRRDTDDATHSHQFHQVEGIVVGEHVTMADLKGTLEVVAQNLFGDKVRLRPSYFPFTEPICKGTGWIEVLGAGMVHPNVLKMSGVDPEVFAFGLGPDRFAMLKYGVEDIRDFYQNDVR........ 254
251 2.000e-80UniRef50_A0A2H6GZS4 Phenylalanine--tRNA ligase alpha subunit n=7 Tax=Archaea TaxID=2157 RepID=A0A2H6GZS4_9ARCH  ali  14  219...WKGKKFRRYDVSSGVPAIHGGKRHFVNQAIDYGRKIWTDMG--FTEMTGNMIDSSFWVFDALFTAQDHPG-----REMQDTFFIN--KKSELPDKKLVKSVKDAHEGKIKGSKGWQYNWDEKEVIRSHTTNLSAKTLTNLKKEN-LPAKFFAIGKVLRNETLDWSHGFEFNQTEGIVIDKDANFRHLLGYLKQFFKKMGFEKIRFTPAYFPYTEPSVEKKVWLEIGAAGIFRPEVVIPLGEYIPVLAWGPGFDRAIMDYYKIKDLRELYKNDI......... 493
252 3.000e-80UniRef50_Q3APW3 Phenylalanine--tRNA ligase alpha subunit n=252 Tax=Bacteria TaxID=2 RepID=SYFA_CHLCH  ali  14  91............DLTLPGRRSFCGSEHPVQKVLGDMKSIFNAMG--FTIATGPELEVGNYNFDMLNFAPDHP-----ARDMQDTFFVR-------------------TGSGNTP----------DVLLRTHTSPVQIRVM----LDEKPPIRVICPGKVYRNEAISARSYCVFHQLEGLYIDKNVSFADLKATIYSFAQQMFGSDVRFRPSFFPFTEPSCKKSGWLEILGCGMVHPNVLRNCGIDPEGYAFGMGVDRTVLLRYKIDDIRLLFENDVRM....... 338
253 3.000e-80UniRef50_Q8ZX61 Phenylalanine--tRNA ligase alpha subunit n=15 Tax=Thermoproteaceae TaxID=2267 RepID=SYFA_PYRAE  ali  17  194.GRWRNYTLKPFDLNIEPPEYPAPVPHFFNEFLDYVREVMIGLG--FEEVRGPVLEVEFWNFDALFQAQDHP-----AREVHDTFYVQWSGPLETP---PEHLMESVGRVHEKWRYKWDRKKALNPVLRTQTTATTIRALAER---GDGEYKVFTIGRVFRPEKLDPKHSMEFHQLDGIVVGPGLTFKHLLGQLEEIAKALGMTKVKFRPAYFPFTSPSVEKLGWVEFGGAGIFRPEVTEPLGVKKSVLAWGWGLDRIAMILLGIDDIRELFTKDL......... 463
254 4.000e-80UniRef50_I0GK52 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Caldisericum exile (strain DSM 21853 / NBRC 104410 / AZM16c01) TaxID=511051 RepID=I0  ali  15  93............DITAPGLIVERGHEHILNKVIEEVKSIFISMG--FDVFSGPDIETDYYNFEALNIPEHHP-----ARDMQDTFY-----------------------------------LAEKMLLRTQTSPMQIRTME----SQKPPIRMIAIGRCYRRDALDSSHSPQFHQIEGLVVDKNISFANLKATLSEFSKKMFGEKVRFTPSYFPFVEPVCKYTGYLEMGGSGMVHPNVLRNVNIDPEGFAFGWGIERIAMVKYGIPDIRYFLQNDMR........ 333
255 4.000e-80UniRef50_A0A2T9X105 Phenylalanine--tRNA ligase alpha subunit n=2 Tax=Sulfolobales TaxID=2281 RepID=A0A2T9X105_9CREN  ali  13  191.GAWKNAKIRPFNVEAFPRFFHLGKKHFFREFLERIRDVMRSLG--FSEVSGDYVEMELYNFDLLFQPQDHP-----AREIHDSFTLLKARSAPGDLMERVRRMHE-----ESWKYRWNQETALRLMLRSQTTAVTARILATK---PEPPVRVFTIGKVFRPDTIDATHLIEFHQLDGLVIEEGYSFRDLLSDLKEIFYRMGVKEVKFKPAYFPFTEPSVEGLGWVEMCGAGMLRDEILRTVDVSTQAGAWGIGLDRLAMLFNHLNDIRLLYSYDV......... 457
256 4.000e-80UniRef50_UPI000C1D660D phenylalanine--tRNA ligase alpha subunit, cytoplasmic-like n=1 Tax=Olea europaea var. sylvestris TaxID=158386 RepID=UPI000C1D6  ali  17  226.........................................................SFWNFDALFQPQQHP-----ARDSHDTFFLKEPS---TTKILPEDYVERVKGVHESGGYEWKREEANKNLLRTHTTAVSTRMLYALAQDFA-PKKYYSIDRVFRNEAVDRTHLAEFHQIEGLICDRGLTLGHLIGVLEDFFSRLGMSKLKFKPAYNPYTEPSMEIGKWVEIGNSGMFRPEMLLPMGLDVQVIAWGLSLERPTMILYGIDNIRDLFGHKVDLGLIKRN. 459
257 5.000e-80UniRef50_A0A1F2V1K6 Phenylalanine--tRNA ligase alpha subunit n=4 Tax=unclassified Acidobacteria (miscellaneous) TaxID=305072 RepID=A0A1F2V1K6_9BACT :  ali  15  89............DITLPGRAPVLGHRHPLSLIRDEVIEIFTRLG--YQVLEGPEVEDDYHNFEALNMPEEHP-----ARDMQDTLYLQTPLMPSDPEMPGDLKGSPLHSAP--PLT----------LLRTHTSAMQIRHMEKHA----PPVRLVAIGPVYRRDNLDLTHTPMFHQVEGLVVGKGVTLADLKGTLSAMAEALFADFIRFRPSFFPYTEPSCKRTGWIEILGSGMVHPAVFEAVGYEVTGFAFGMGVERVAQLKWGVDDIRLFYENDLR........ 363
258 6.000e-80UniRef50_A0A1J1J0D7 CLUMA_CG019055, isoform A n=1 Tax=Clunio marinus TaxID=568069 RepID=A0A1J1J0D7_9DIPT  ali  15  198.GAWKNLKFKDYNFDAMGAQPASGHLHPLLKVRSEVADIFVQMG--FQEMTNNYVESSFWNFDALFQPQQHP-----ARDAQDTFFITNPQKFPTEYLQRVKKSHEEGGGSIGYRYDWSLNDAQKNVLRTHTTAVSARMLYKLANQEGGPTKYFSIDKVFRNETLDATHLAEFHQVEGVIAGVDITLGDLMGIIGGFFAKMGLTDIEFKPAYNPYTEPSMEI............................................................... 418
259 6.000e-80UniRef50_B1ZQM9 Phenylalanine--tRNA ligase alpha subunit n=49 Tax=Bacteria TaxID=2 RepID=B1ZQM9_OPITP  ali  12  93............DPTLPSPDAGPGTYHPLTLVREEMCRILRKVG--FTVADGPEVETEFYCFDALNTPPDHP-----ARDAQDTFY-----------FPDNARFGNVSKKHAH----------EKYLLRTHTSSVQIRTM----LKGEPPIRIVSPGRVYRRDTTDATHSANFHQLECLYVDKHVTVRDLKALLDYIFASLLGTKTRFRPHYFGYTEPSFEVKEWIEIGGCGMVDPAVFAAVGYDPEGYAFGMGLERLAMLLYGIDDIRYFYQNDLR........ 341
260 7.000e-80UniRef50_A0A0G1Z0B3 Phenylalanine--tRNA ligase alpha subunit n=24 Tax=root TaxID=1 RepID=A0A0G1Z0B3_9BACT  ali  15  91..........RIDVTRPGLKHARGHIHPISRVIKDIVSIFSSMG--FEVVEGPEVETEYYNFDALNIPANHP-----ARDMWDTFWLK-----------PESRTHADSISADGRGKLQRESAMEKLLLRTHTSPVQVRYMENH----NPPLKIIVPGRAYRYEATDASHEFQFFQLEGLVVDRQISIANFKGVIQEFFSRLFKKEVRLRPSFFPFVEPICKKSGWLELAGAGMVHQNVFKAAGYTPQGFAFGFGIDRIAMMKYKIPDIRLFHSGDLR........ 363
261 9.000e-80UniRef50_A8AWJ8 Phenylalanine--tRNA ligase alpha subunit n=431 Tax=Bacteria TaxID=2 RepID=A8AWJ8_STRGC  ali  17  39......................LGKKGSLTEVLKGMKDISAEMRPIIQEMEEQLVKLAEESLDVTLPGGSRHILSQTSEEIEDIFIGMGYQVVDGFEVEKDYYFERMNLPKDHPARDMQDTFTEEILLRTHTSPVQARAMDAHDFS-KGPLKMISPGRVFRRDTDDATHSHQFHQIEGLVVGENISMANLQGTLQLIVQKMFGQDIRLRPSYFPFTEPSCKKTGWIEIMGAGMVHPRVLEMSGIDYSGFAFGLGQERVAMLRYGINDIRGFYQGDIR........ 343
262 1.000e-79UniRef50_A0A1L9GVE9 Phenylalanine--tRNA ligase subunit alpha n=4 Tax=Archaea TaxID=2157 RepID=A0A1L9GVE9_MICA2  ali  16  215..AWTESGFRPYDVEAPVAEAYPARRHPMKEFMELVRRMWVSQG--FIETAGPMIESSFWNFDALFSPQDHPT-----REMQDTFFLSNPEILGIAEKELLKRVARM---HKKGWNSWNEDISFQPVLRTHTTSVSAHNIYGNSSMLEYPIKLFSIGKVFRNESIDYKHLAELHQLDGIVIGRGLGVADLKGTLEQFYKGLGF-KVKFKPSYFPFVEPGDEHGDWIELCGGGIIRKEITKALGTDMRVIAWGAGLDRL-MFKYGINSLSELYKNDI......... 486
263 1.000e-79UniRef50_A0A2G6LY03 Phenylalanine--tRNA ligase n=1 Tax=Candidatus Fermentibacteria bacterium TaxID=2044591 RepID=A0A2G6LY03_9BACT  ali  16  239.GSWKNGQFRRYQVDIPPARIHTGRLHPYGIFLNTVRSKLLAMG--FREMKGSLAESEFWNNDALFMPQFHP-----ARDIHDAYYLEDGVSVSPPEEEAVRKAHEDGGET--GGRGWEYTFDWKRILRSQGTALSARRLASEPNI---PGKYFGIAKCFRYDQVDATHLPDFYQVEGIVLGEKINLRHLLGLLKLFSEEVAGTEYKFVPAYFPFTEPSVEIHGWMEMGGAGLFRKEVCLPLGVDVPVIAWGLGLDRMALMALGLSDIRDLVTPDLKLRSIRIR. 524
264 2.000e-79UniRef50_Q4FQ65 Phenylalanine--tRNA ligase alpha subunit n=63 Tax=Bacteria TaxID=2 RepID=SYFA_PSYA2  ali  15  117............DITLPARGGQKGHLHPVTMITQRMQQYFIQAG--FNVATGPEVESDYYNFEALNIPSHHP-----ARAMHDTFY-----------------------------------FDAHYLLRTHTSPVQIRTMEKN----EPPIRIICPGRVYRNDS-DQTHSPMFHQLEGLMVTESSTFAELKGLISEFLEAFFAKEVRFRPSFFPFTEPSAEVGKWLEVMGCGMVHPQVLTNCGIDYTGFAFGMGIERFAMLYYGIDDLRLFFQNDVR........ 345
265 2.000e-79UniRef50_A7GTL0 Phenylalanine--tRNA ligase alpha subunit n=372 Tax=Bacteria TaxID=2 RepID=SYFA_BACCN  ali  12  94............DVTLPGRPVETGCHHPLTAVVEQIEDVFIGMG--YEVAEGTEVEKDYYNFEALNLPKDHP-----ARDMQDTFYI-----------------------------------TEETLLRTHTSSVQARTMENNK--EKGPIKIICPGKVYRRDDDDATHSHQFMQIEGLVIDKNIRMSDLKGTLQVFVKKMFGEEIRLRPSFFPFTEPSCKGTGWIEILGAGMVHPNVLEMAGYDYQGFAFGMGAERIAMLKYGVDDIRHFYTNDVR........ 336
266 2.000e-79UniRef50_A0A150LPM6 Phenylalanine--tRNA ligase alpha subunit n=6 Tax=Bacillaceae TaxID=186817 RepID=A0A150LPM6_9BACI  ali  13  251............DVTLPGRPVRRGNHHPLTRVIEEIEDLFIGMG--YTIAEGPEVEKDYYNFEALNLPKGHP-----ARDMQDSFYI-----------------------------------TEEILLRTHTSPVQARTMEKHQ--GRGPVKIICPGKVYRRDNDDATHSHQFTQIEGLVVDENIRMSDLKGTLREFARKMFGEEIRFRPSFFPFTEPSCKGTGWIEILGAGMVHPNVLEMAGFDYTGFAFGMGPERIAMLKYGIDDIRHFYQNDIR........ 493
267 3.000e-79UniRef50_A0A1V6M1Y2 Phenylalanine--tRNA ligase alpha subunit n=34 Tax=Bacteria TaxID=2 RepID=A0A1V6M1Y2_9BACT  ali  11  91..........LFDISLPGKPQFVGKKHPLTQTIDDVKEVFACLG--FDVAYGPEVELEYYNFEALNIPADHPSRTDF-----DTFYIKD-----------------------------------DVLLRSQTSTVQIRIMEN----QKPPIRIIAPGRVYRPDTVDARHSFMFHQVEGLLVDEGVSFADLKGVLYQFIKAYFGQNIRFRPSFFPFTEPSAEVDGWVEILGAGMIDPNVFKAVGEKYTGFAFGMGVERITMLKYGIGDIRLFYENDLR........ 333
268 5.000e-79UniRef50_A0A1N6LXQ1 Phenylalanyl-tRNA synthetase alpha chain n=1 Tax=Babesia microti (strain RI) TaxID=1133968 RepID=A0A1N6LXQ1_BABMR  ali  16  205.GTWMEYEIKPYNYYSSGKRMLMGQIHPISKCIEEFSYILTCMG--FEELPSCYVTSSFWSFDALYMPQQHPSRDQ-----QDTFFTKDPESVPKDYLENVKKVHGNGKDFGSTGYQWDIKESEKLIMRTHLTSGTSRLLKKMAEEIGLPIRYFIIEKVFRNESIDSTHLAEFHQMEGIVFGENQSLSHLIGILDMFYKKIGLTEIKYKPAYNPYTEPSMEINKWIEVGNSGIFRPEMLLPMGLPSNVLGWGLSIERPTMIKYDIHNIRDLVG............ 491
269 6.000e-79UniRef50_B2KBL6 Phenylalanine--tRNA ligase alpha subunit n=8 Tax=Bacteria TaxID=2 RepID=B2KBL6_ELUMP  ali  14  99............DLTLPGWPVANGHKHPLTIAMDRMTAILSKLGFVWAE--GPQIEEEKYNFDFLNIPLHHP-----ARDVQDTLII--------------------GGGAKKG-----------MVLRSHTSNVQVRYMEKN----KPPLRIMSPGKVFRRDDIDASHSPVFHQIEGLYVDKNVSLADLKSDLTAFMKGLFGNKVRFRPSFFPFTEPSCKGTGWKEMLGAGIVHPNVLRNVGIDPEGYAFGMGVERLAMLMLGIKDIRAFYENDLRI....... 345
270 6.000e-79UniRef50_A0A256YRD1 Phenylalanine--tRNA ligase subunit alpha n=1 Tax=Candidatus Aenigmarchaeota archaeon ex4484_224 TaxID=2012503 RepID=A0A256YRD1_9A  ali  14  135.GIWRVVKFKKFNVRAEGKKEYPGKIHPYIQLINLVRQKLLSLG--FKEVNGPLVELNFWNCDALFMPSDHPARS-----IHDIFLLKNPKFGE---IKDKKVWENVKKAHLNGFNTWDENLAKRYILRSHGTAVSARTLAKL-KEKDLPFKMFTIAKVFRPDVIDAKHFIEFDQVEGIVVAKNLNFKHLLGFLKEIAVEIFGKKVKFKPSYFPFTEPSVEGFGWTEFGGAGIFRKEVTYPLGIKYPVLAWGLGLGRLAMQILKINDIRYLFSDNLD........ 413
271 8.000e-79UniRef50_A0A1J4VHR0 Phenylalanine--tRNA ligase alpha subunit n=2 Tax=unclassified Candidatus Omnitrophica TaxID=1047005 RepID=A0A1J4VHR0_9BACT  ali  13  95............DITLPGKKPMLGRQHPLTQVETEICDIFGRLG--FKAFEGPEVETEYNNFEALNIPLEHPS-----RDAFDTFYIKEFSGSRVDELTSLGPKNKTLGTSE-----LANSRTCKLLLRSHTSPAQIRAL----KACHPPMAVVVPGRVYRPDAVDASHSFMFHQVEGIAVSEKIRFSDLKGVLMAFATEMFSEKLRFRPSFFPFTEPSCKKSGWLEIGGCGMVHPYVLKSGGCDPKVFAFGMGVERIAMLKFGIKDIRMFFENDIR........ 365
272 9.000e-79UniRef50_E7NUI0 Phenylalanine--tRNA ligase alpha subunit n=65 Tax=Spirochaetes TaxID=203691 RepID=E7NUI0_TREPH  ali  14  277.GEWKGQAFRSYNIQLPPARVLSGRPSAYSDFLEGVKDKLCSLG--FEEFDGPLVETDFWNSDALFMPQFH-----AARDIHDVYYIKNPTHIEEPFLSRVAEVHKTGGNTGSWGYQFDRDFTRRLLLRSQGTVLSAHQLAK----AKIPGKYFGIVRCFRYDKVDATHLSDFYQTEGIVLGKNVNLKTLLGILKMFAVEIAGTEVKYVGGYFPFTEPSIEVHGWFELGGSGILRPEVTRAMGVDVPVLAWGIGIDRMALMALGLNDLRELFSSDI--EAVRLR. 558
273 1.000e-78UniRef50_A0A2H9M1E3 Phenylalanine--tRNA ligase subunit alpha n=4 Tax=unclassified Archaea (miscellaneous) TaxID=93506 RepID=A0A2H9M1E3_9ARCH  ali  13  222...WESTDFRRYNVKEAVPKKYYGKLHPYQEFIEKTKDKFASMG--FKEMTGPYVENNFTNCDALFMPQDHP-----ARGIHDIFYIKEPEKTEL--KEYKNFLKKVKKAHEKGIKGFDEEFTKKHVLRSQTTSASVRMLMNEDLEIPG--KYFVIDRNVRPDVIDWKHGAEFLQMEGIVLGEDMNLRSLFGLLRMFAEKVAVEKYKIMPDYYPYTEPSAWRGKWMELGGAGIFRKEVTEPLGVKVPVIAWGLGFDRAFMAERSINDIRQLFTNDLWLRNAEVK. 505
274 1.000e-78UniRef50_A0A1Q9NLC6 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Candidatus Heimdallarchaeota archaeon LC_3 TaxID=1841598 RepID=A0A1Q9NLC6_9ARCH  ali  15  231.GKWKDVILRPYKVEIPVPPYLPGKRHFYWQTIDYVRQVWLSLG--FQEMEGTIVQTSFWNFDTLFVPQDH-----TAREEQDTFFIKHPKKVDNEIFDEVAQTHLNGGNTGSNGWGFKKEISERLVLRTHTTCLSAKTIKTLR-EKGYPAKYFAVGRCFRNEKIDWKHLAEFDQVEGIVVDPSVTFQDLLGYLNAFYKALGYKGTRFRPGYYPYTEPSVLKNEWIEMGGSGVFRPEVVIPLGEDIPVLAWGPGIGRMVSERYSLVDIRSQYENNLD........ 512
275 2.000e-78UniRef50_A0A2M9DR54 Phenylalanine--tRNA ligase alpha subunit n=14 Tax=root TaxID=1 RepID=A0A2M9DR54_9DELT  ali  13  91............DVSLPGRPMPQGALHPVTQVSAEICDIFEKLG--FTIGEGPEVETDHYNFEALNIPKHHP-----ARDMQDTFYV-----------------------------------ADDIVLRTHTSPMQVRMMEK----TDPPLRVIAPGKVYRCDS-DITHTPMFHQVEGLMVDTNVSFGDLKGILTTFVHRMFGTAVRFRPSFFPFTEPICSKTGWLEVLGSGMVHPAVFESAGYDYTGFAFGMGVERIAMLKYRIDDIRKFYDNDIR........ 330
276 2.000e-78UniRef50_A0A0G0D5A9 Phenylalanine--tRNA ligase alpha subunit n=43 Tax=root TaxID=1 RepID=A0A0G0D5A9_9BACT  ali  15  91............DVTAPGKKIKRGHLHPITIVQRDIEDIFTSMG--FEIADGPEVESEFYNFDAVNVPEEHPG-----RDMQDTFWIS-----------KEEGREKGTGT----------------VLRTQTSSVQVRYMQTH----KPPFRIIIPGRVFRQEATDASHEHTFHQFEALVVGKKVSVANFLYIAETFFSQFFGKKVRLRPSYFPFVEPSCKQTGWLEVGGAGMVHQNVFEAAGYKYQGFAWGFGLERLAMMKYKIDDIRHFHGGDVR........ 339
277 3.000e-78UniRef50_E1QNX6 Phenylalanine--tRNA ligase alpha subunit n=10 Tax=Thermoprotei TaxID=183924 RepID=E1QNX6_VULDI  ali  13  228.GAWRNVVIKRFDLSIPTPQAPIVTKHFFSEFLKFVKEVFISLG--FEEVYGPHIELELWNFDALFQAQDHP-----AREIHDTYFLKYPSILDGELMNRIARTHEDGWITGSWGYKWDPGRAVRLVLRTQTTSVSVRTLYKR---GDGEYRAFTIDRVFRPEVLDPKHSMEFHQADGIVVGENLSFKHLLGILEALARGMGLRKVMFKPAYFPFTSPSAEGYGWIEFVGSGIFRPEVVMPLGIKRSVLAFGMGLDRIAMILMNIEDIRDLFSRDINV....... 506
278 3.000e-78UniRef50_A0A1M5XK47 Phenylalanine--tRNA ligase alpha subunit n=9 Tax=root TaxID=1 RepID=A0A1M5XK47_9CLOT  ali  15  82..KEKNSKLEIIDISMPGNRKSLGHKNPLQLTLDSINEIFLSMGFAIEE--GPEVELDHYNFEALNIPKNHPARGE-----QDTFYIND-----------------------------------DVVLRTQTSPVQIRTMEN----QKPPIKMISPGKVYRSDAVDATHSPIFYQIEGLVVAEGITFADLKGTLELFTKKMFGDKTKFRPHHFPFTEPSCKGSGWIELLGCGMVHPQVLRNCGIDPEVFAFGFGLDRMVMLNYAIDDIRLLYEADMR........ 334
279 3.000e-78UniRef50_A0A1I4SMZ9 Phenylalanine--tRNA ligase alpha subunit n=53 Tax=Bacteria TaxID=2 RepID=A0A1I4SMZ9_9DELT  ali  13  88........IEPFDVTVPGRRPAVGSIHPITQTAREIARIFVQMG--FEIVEGPEVELDYYNFEALNIPKDHP-----ARDMQDTFYVS-----------------------------------EDVVLRTHTSPIQIRVMEKR----KPPVQIIAPGKVYRCDS-DMTHSPMFHQVEGLMVGKNVSFADLKGVLTLFVHQMFGTHVRFRPSFFPFTEPSAEVTGWLEILGCGMVDPAVYGYVGYDPEGFAFGMGIERIAMLKWGINDLRMFFENDIR........ 331
280 3.000e-78UniRef50_A0A256Z871 Phenylalanine--tRNA ligase subunit alpha n=2 Tax=Thermoprotei TaxID=183924 RepID=A0A256Z871_9CREN  ali  15  218.GSWREALFKKFDLGVEIPTIHPKKKHPYIQFLNYVRYVISNMG--FKEFKGPYVESELWNFEVLFVPQYHPSRRGT-----DVYFIRN---EDLNIDIPEDIIARVKNIHERLSYSWDINKALRPILRTHTTPVSMRAIYEL---GGGEYRLFSLDRVFRPDTPDPTHLMEFHQLEGIIVGKKVTFKHLLGFFKEFAKRLGLGDVIFKPAYFPFTEPSVEGYGWIEVFPGGMFRPEVLESVGLKYKVAAWGIGIDRIAMIFLGIDDIRDLYTNDLDV....... 489
281 3.000e-78UniRef50_A0A2H0LDW5 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Candidatus Omnitrophica bacterium CG11_big_fil_rev_8_21_14_0_20_64_10 TaxID=1974  ali  13  97..........RFDPTLPGVVPRAGRLHPLTQTIREIIAIFQELG--FSAVEGPEAETDHNNFEALNIPADHPSRESF-----DTYYLAG---AQTP-------------DTGH--RTPDTDAAARWLLRSHTSPVQIRYMRTH----KPPFQIVVPGRVFRRDAVDATHCFQFHQVEGLAVGPDLSFGDLKGVLEAWARRMFGTEIRFRPHYFPFTEPSAEVRGWLEIMGCGMVHPNVFKAVGLPPAGFAFGMGVERIAMIRHGIQDIRFFFENDL......... 342
282 4.000e-78UniRef50_A0A1F4NPJ0 Phenylalanine--tRNA ligase alpha subunit n=3 Tax=candidate division Kazan-3B-28 TaxID=1798534 RepID=A0A1F4NPJ0_9BACT  ali  14  80.....KAEVELFDPTIPGLHPPLGRLHPLTQTTNELVKLFRGLG--FSVADGPEVETEENNFNLLNIPDNHP-----ARDAWDTFWLK-----------------ESVGSKFNPSADGQNS---KFLLRTHTSPVQIRYMKEHR----PPIRIIAPGRTFRYEAEDATHSSVFYQLEGLLIDRGITVAHLKAVIDTIVKDILGSEVRLRPSFFPFTEPIWFKGHWLELMGCGMVHPTVLKNGDIDPTGFAFGLGIDRITMLKHGIDDIRLFLSGNLD........ 330
283 5.000e-78UniRef50_A0A256XTD0 Phenylalanine--tRNA ligase subunit alpha n=1 Tax=Candidatus Woesearchaeota archaeon ex4484_78 TaxID=2012531 RepID=A0A256XTD0_9ARC  ali  14  223.GDWKKKNFRRYDVTINVPKFFGGKLQSYRYFLDWVRSKFVALG--FQEMNGPIVESDFWDMDALFMPQFH-----SARDIHDAYYVKRPKFADIP----SSLIKKVKAAHESGANTWRYSFDKRCLLRTQGTACSARMIGSGKLEIPG--KYFGITRSFRYDVIDATHLPDFYQTEGFVVEEGLSLRHLIGLLRMFAKEFAADEIRIVPGYFPFTEPSAEKLGWVELGGAGIFRPEVVKPLGKHVSIIAWGMGIDRIGMFKLGLTDIRQLFSHDL......... 500
284 5.000e-78UniRef50_A0A2R6BZ14 Uncharacterized protein n=8 Tax=Candidatus Marsarchaeota TaxID=1978152 RepID=A0A2R6BZ14_9ARCH  ali  17  222.................EPFYQRGKKHFYIEFLEIVKEILISMG--FEEMFGPYVEYEFWNFDALFVPQDHP-----AREVQDKFNISNKDLILDPSITP-EIAENVMKTHLNGWKTWRNKWEMSLILRSHTTAVSIR---KLAQGVHNEFKYFTIDRNFRRDAIDATHLPEFHQCEGIIGGEGLNLKNLFGILEAFSKSLGVEKIRFKPGYFPFTEPSVEKLGWIEAAPGGIFRPEVTLPLGIKVPVLAWGIGITRFAMVYYNLSDIRELFSQNLD........ 484
285 5.000e-78UniRef50_A0A1E8CHY8 Phenylalanine--tRNA ligase alpha subunit n=5 Tax=root TaxID=1 RepID=A0A1E8CHY8_9GAMM  ali  12  93............DVTLPGRRQSAGGLHPVSRTIDRIQRLFESVG--YSVAEGPEIEDDYHNFEALNIPGHHP-----ARAMHDTFYI-----------------------------------NPSTVLRTHTSPVQVRVMEQ----GKPPFRMICPGRVYRCDS-DLTHTPMFHQIEGLLIAENVSFADLKGTLEDFLRAFFEADVRFRPSYFPFTEPSCKQTGWLEVLGCGMVHPSVLEASGIDYRGYAFGMGVERLAMLHYGVNDLRLFFENDLR........ 332
286 6.000e-78UniRef50_A0A0B5HKG9 Phenylalanyl-tRNA synthetase alpha chain n=4 Tax=Archaea TaxID=2157 RepID=A0A0B5HKG9_ARCG5  ali  15  201LGMPEFREARAYNIQDAVPRLYPGKKQPYIQFLNIIRRKLIQLG--FKEMYAPLITQEFYNFDVLFQPQNHPARSWT-----DTYQLKAPRKGRLPIVNSVKAAHEHGGNTESIGYTWSEDIAEKVMPAAHGTAHSARQLVQ---GIEVPGKYFAIARCYRPDVMDASHLIEFNQLEGFIVGENLNFRSLLGMLKQFATEIAGEAVKFYPDYYPFTEPSVQKLGWVEFAGAGIFRPEMMHALGIEEPAIAWGMGIDRLAMFKLGIKDIRYLFSDDLD........ 479
287 7.000e-78UniRef50_A0A2N2EZB8 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Elusimicrobia bacterium HGW-Elusimicrobia-1 TaxID=2013763 RepID=A0A2N2EZB8_9BACT  ali  13  99............DLTLPSVGVPRGRTHPLSDTMEEISSIFVSLG--FAVADGPEIEDDYHNFAALNFPDSHP-----AKEMQDTFYVS--------------------------------SEGAEKLLRTHTSPVQIRSM----KGGTPPFKFIAPGRVYRHEAVDATHSYVFHQVEGFCVDKKTNLADLKTVLETFIEKFFGKKVRFRPSYFPFTEPSCKNSGFIELLGAGMIHPNVLSNCGLDPNVYAFGIGVERFAMQKYGVDDMRLFYKNEMR........ 342
288 8.000e-78UniRef50_A0A142HLK8 Phenylalanine--tRNA ligase alpha subunit n=4 Tax=Bacteroidetes TaxID=976 RepID=A0A142HLK8_9BACT  ali  13  91...........FDYTLPPVPHALGTRHPLSLVREQMLRIFSRIG--FAVAEGPEIEDDWHNFTALNFPENHP-----ARDMQDTFFVMG-EGVNGQMGEEANEGPAGESPEHSPI---HSSTHSPMLLRTHTSTVQVRVMENEPL----PIRRVMPGRVYRNEAISARAHMLFHQVEGLYIDEGVSFADLKQTIYYFVRELFGEDIRFRPSYFPFTEPICKGTGWVEIGGSGMVDPAVLENCGIDYSGYAWGMGIERIAMLKYQVKDLRLFTENDVR........ 363
289 1.000e-77UniRef50_A0A0G0J6S0 Phenylalanine--tRNA ligase alpha subunit n=34 Tax=Parcubacteria group TaxID=1794811 RepID=A0A0G0J6S0_9BACT  ali  15  96.........DRIDISAPAKKISQGHLHPLTLIQRKIEDIFQSIG--FEVVEGPEIETEYYNFNALNIPADHP-----AREMQDTFWLQTPSKLQTP----------------------------KLLMRTQTSSVQIRYAENHQ----PPIRIISPGRVFRFEATDQTHDIQFHQIEGLMIDKNISLANLKGVLEILFKKLYGKEVRFRPSYFPFVEPVDFRGKWMEIAGAGMVHPKVLNTMKIDWQGFAFGMGLERLAIIKYGIDDVRLFSSGDLR........ 335
290 1.000e-77UniRef50_A0A0S8E3H8 Phenylalanine--tRNA ligase alpha subunit n=10 Tax=Bacteria TaxID=2 RepID=A0A0S8E3H8_9BACT  ali  11  98............DVTLPGIRQALGHRHLITQVTEEICDIFIRLG--FVVVEGPEIETEYNNFTALNIPLEHPS-----RDMFDTFYIKSHVTRNT-----------LHVKDKKPGDVRRETCDR-LLLRSHTSPVQIRAM----QSRKPPLAVVVPGKVYRPDAVDASHSFMFHQIEGFMVDYNIGFSDLKGTLEFFTKSVFGTKMRFRPHFFPFTEPSAEVKGWLEILGSGMIHPNVFRHVGYDPSGFAFGMGVERIAMLKYGINDIRLFFENDLR........ 361
291 1.000e-77UniRef50_C7DGH8 Transcriptional regulator, TrmB n=1 Tax=Candidatus Micrarchaeum acidiphilum ARMAN-2 TaxID=425595 RepID=C7DGH8_MICA2  ali  16  207.GAWRNFAFKKYDMGAETPEVYPGRLHPVHEFINVIRNIWMRMG--FTEGSGHIIEPAFWNFDALFSPQDHPT-----RDMQDTFFLSNPERINLPEKELVEKVKEMH--KKNWGRRWSAETAAEAVLRTHTTSISAHYIKEYGNGYGAPAKLFYVGKVFRNESIDYKHLAELYQYDGIIIGDDLGLSELIGTLKLFYSQLGGFKIKIKPSYFPFVEPGSEHNDWIELCGGGVIRKEITEALGTDKSVLAWGGGLDRLMFSRLGMESLTDLYKNDVD........ 481
292 1.000e-77UniRef50_A0A1Y1RJX9 Phenylalanine--tRNA ligase alpha subunit n=9 Tax=Bacteria TaxID=2 RepID=A0A1Y1RJX9_9BACT  ali  12  97............DVTLPGVRQRSGKIHIIQQTLDEISSIFKGLG--FSVADGPEIESDYYNFDALNIPKDHP-----ARDMWDTFYI--------------------------------DDQTDRTVLRTHTSPVQIRTMERRQ----PPVRIIVPGRVYRNEAIDASHHAVFYQVEGLYVDNNVTFRDLKGVLSYFSRQMFGDNVRFRPSFFPFTEPSCKYTGWVEILGCGMVDPAVYRYVNYDPEGYAFGLGVERIAMLRYQINDIRLFLDNDVR........ 340
293 2.000e-77UniRef50_O83938 Phenylalanine--tRNA ligase alpha subunit n=12 Tax=Spirochaetes TaxID=203691 RepID=SYFA_TREPA  ali  13  271.GAWKTQHLRRYNVHIPPARIIPGRSNAYADFLEHIKDRLVALG--FQEFDGPLVETDFWNADALFMPQFHP-----ARDIHDVYYLKHPTHAPTPFLSRVAATHERGADSGSLGYSFDRDFTRRLLLRSQGTALSARHL----PTAHIPGKYFGIARCFRHDQVDATHLADFYQTEGIVLGTDVNVCTLLGMLKILATEIAGQEVRYVGGYFPFTEPSIELHGWFELGGAGLLRPEVTDPLGVHVPVMAWGLGVDRMALLALGISDVRELFSPDI--ESVRLRV 553
294 2.000e-77UniRef50_D5U0B9 Phenylalanyl-tRNA synthetase, alpha subunit n=9 Tax=Desulfurococcaceae TaxID=2272 RepID=D5U0B9_THEAM  ali  15  223........IKEFDLSIPVPRLPSVRKHPFMEFIDDLRDIMVSLG--FEEVKGPHVEAEFWNFDVLYQAQDHP-----AREIHDTF----FVKSDARASISSQLMERARSVHEKGWYKWSPERAMRLVLRSQTTAVSARAIFER---GEGEYRVFTIDRVFRPENLDAKHSMEFHQLDGIIVGKNVNFKHLLYFFKELAAALGIKEVWFKPGYFPFTEPSVEGYGWVEVFPGGVFRPEVMEILGAPVKAVAWGIGVDRLAMQVLGIDDIRMLFATDL......... 484
295 2.000e-77UniRef50_A0A1H3CUH4 Phenylalanine--tRNA ligase alpha subunit n=12 Tax=Bacteria TaxID=2 RepID=A0A1H3CUH4_9BACT  ali  13  92............DWSLPGDPVAIGSRHPLSLVRNQIVSIFKRLG--FAVAEGPEIEDDWHNFGAMNLPEDHP-----ARDMQDTFYISR---------------------------------NPDWLLRTHTSSVQARVMEK----QKPPIRVICPGRVYRNETVSARAHCFFHQVEGLYIDENVSFADLKQTLYFFVQEMFGKKVRFRPSYFPFTEPICKHTGWVEILGSGMVHPKVLENFGIDPNGFAFGMGVERITQLKYQVNDLRLYSQNDLR........ 334
296 3.000e-77UniRef50_B0R806 Phenylalanine--tRNA ligase alpha subunit n=257 Tax=Archaea TaxID=2157 RepID=SYFA_HALS3  ali  15  210.GEWADVEFADYNVAADAADHTPGKTHVLRQAAERVTDVLVGMG--FQEMAGPHVDADFYINDCLFMPQDHPARNHWDR-----FALSNPARIELPLVERVERAHREGAGDDGDGYHWDEDFARALALRGHTTSLTARHLAGLADDVEAPARYFSVEKAYRNDTLDATHLLEFFQIEGWVLADDLSVRDLMGTFREFYSQFGIHDLQFKPTYNPYTEPSPETGELIEIGNSGIFRPEMLDPLDVDGDVMAWGLALERLLMLMTGFEDIRDVHGTLCDVGFLRN.. 497
297 5.000e-77UniRef50_A0A257B394 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Chloracidobacterium sp. CP2_5A TaxID=2012633 RepID=A0A257B394_9BACT  ali  13  117............DVTLPGLARRRGRAHPLTQIRERIEDIFVAMGYAVE--DGPEVDTVFYNFDALNIPPDHP-----AREMTDTFYIND-----------------------------------ELALRSQTSNVQIHAMQRRR----PPLRVIAPGRVFRRDEPDATHNPMFFQVEGLNVARGITMADLKGTLQAFLTRLFERPVRFRPSYFPFVEPVCKRTGWIELGGSGMVHPNVLRACRIDPSGFAFGFGIDRMAALLYGIDDIRLYFENDLR........ 357
298 5.000e-77UniRef50_A5N254 Phenylalanine--tRNA ligase alpha subunit n=579 Tax=root TaxID=1 RepID=SYFA_CLOK5  ali  18  24............DIESIRIK-YLGKKGELTHILRGMKELSKEERPIIGKLANDIXXSRVKGIDITMPGGRRHPLEQVLEDMKEIFVSMGFTIEEGPEVELDYYFEALNIPKNHPARGEQDTFNDNLVLRTQTSPTQIRTMEK----QKPPIKMISPGKVYRSDSVDATHSPIFYQMEGLVVDKGITFADLKGTLELFARKMFGDKTKFRPHHFPFTEPSCKGEGWIELLGCGMVHPQVLRNCNIDPEVFAFGMGVDRMVMLKYGIDDIRNMYESDMR........ 334
299 7.000e-77UniRef50_A0A202DKP3 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=bacterium F11 TaxID=1932698 RepID=A0A202DKP3_9BACT  ali  13  93............DLTLPGRAHPQGRSHPILQTIDEICDIFKSIG--FQIVVGPDIETDFHNFTALNIPQNHP-----ARDMHDTFYLN---------LNDSLCKQK----------------NQPLLLRTHTSPVQIQLM----KKVKPPVRIVAPGRVYRHEAIDATHAAIFHQIEGLVIDEKISFADLKGTLSYFVHQYFGKKVRFRPSYFPFVEPGAEMDNWMEILGAGMVHPQVLRNVGYDPTGFAFGMGIERIVMARYQIPDIRYFLESDLR........ 338
300 9.000e-77UniRef50_Q319M1 Phenylalanine--tRNA ligase alpha subunit n=48 Tax=Terrabacteria group TaxID=1783272 RepID=SYFA_PROM9  ali  17  113............DVTIPSIGTPPGSKHPLISTQDEIIDIFCGLG--YTVESGPEIESDFYNFESLNIPKNHP-----ARDMQDTFY-----------------------------------LDENRLLRTHTSPVQIRYLEKN----PPPVRIIAPGRVYRRDAVDATHSPVFNQVEVLCIDQDINFSHLRGTVLTFLKTFFGDPVRFRASYFPFTEPSAEKGKWLEVMGCGMVDPKVLEKLGIDWTGFAAGLGVERFCMVRHQIDDIRKFYTNDLR........ 340
301 1.000e-76UniRef50_A0A1D8AZL3 Phenylalanine--tRNA ligase alpha subunit n=32 Tax=root TaxID=1 RepID=A0A1D8AZL3_9BACT  ali  13  93............DPSLPSPDAGPGTRHPLTQVREEMCRILRKAG--FTIADGPEVETEYYCFDALCTPAEHPARAE-----QDTFYFPGNAVFNTPRKVP----------------------GEKYLLRTHTSSVQIRTM----LQGEPPIRIVSPGRVYRRDTSDATHSANFHQLECLYVDKNVTVRDLKALLDYIFASLLGKKTRFRPHYFGYTEPSFEVKDWIEIGGCGMVDPAVFEGVGYDPEVYAFGMGLERLAMLVYGIDDIRYFYQNDVR........ 341
302 1.000e-76UniRef50_Q6LQ72 Phenylalanine--tRNA ligase alpha subunit n=574 Tax=root TaxID=1 RepID=SYFA_PHOPR  ali  11  93............DVSLPGRRIENGGLHPVTRTVERIEQFFGELG--FSTESGPEIEDAFHNFDALNIADDHPARTD-----HDTFF-----------------------------------FNPDLMLRTHTSGVQIRTMEH----GKPPFRFIAPGRVYRND-YDQTHTPMFHQVEGMLVDENVNFAQLKGILNEFLCNFFEEEVRFRPSFFPFTEPSAEVGKWLEVLGCGMVHPNVLRSVGIDPEGFAFGMGVERLTMLRYGVNDLRSFFENDLR........ 321
303 1.000e-76UniRef50_A0A2R6F7M7 Phenylalanine--tRNA ligase subunit alpha (Fragment) n=1 Tax=Halobacteriales archaeon QH_8_67_36 TaxID=1919164 RepID=A0A2R6F7M7_9E  ali  17  82.GEWADVEFTEYNVEADAEDVSHGTEHILRQTANRVKDTLVGMG--FREMEGPHVDAQFWINDCLFMPQDHPARTHW-----DQFALERPEEIDLPEVSRVRSAHKEGVGPDGEGYHWAEDVARGLDLRGHTTSLSMRYLSGHETELEPPKRFFSVEKVYRNDTLDPTHLLEFFQIEGWVMAEDLSVRDLMGTFTEFYEQFGITDLEFKPHYNPYTEPSPETGEVVEVGNSGIFREEVLSPLGVDCDVMAWGLSLERLLMLMYGFEDIRDVHGTLCDLELLRT.. 369
304 2.000e-76UniRef50_G2LI60 Phenylalanine--tRNA ligase alpha subunit n=12 Tax=Bacteria TaxID=2 RepID=G2LI60_CHLTF  ali  14  121............DVTLPGLVRRRGRAHPLTQIRERIEDIFVAMGYAVE--DGPEVDTVFYNFDALNIPPDHP-----ARDLTDTFY-----------------------------------LDDELALRSQTSNVQIHAMQRR----KPPLRIIAPGRVFRRDEPDATHNPMFFQVEGLNVAPGITMGDLKGTLQVFLTRLFERPVRFRPSYFPFVEPICKHTGWIELGGSGMVHPNVLRACGIDPTGFAFGFGIDRMAALLYGIDDIRLYFENDLR........ 361
305 2.000e-76UniRef50_A0A2M7B9G3 Phenylalanine--tRNA ligase alpha subunit n=3 Tax=Candidatus Tagabacteria TaxID=1817918 RepID=A0A2M7B9G3_9BACT  ali  15  96.........DWIDITAPGKKISRGHIHPISRVLKEVTSIFESMG--FEVVEGPEVETEHYNFDALNIPKEHP-----ARDLWDTFWIK--------------------------------PLKNGLLLRTHTSPNQIRYMEKHQ----PPLRIIVPGQVFRYEASDSSHGIQFYQLEGLMVDKTTSVANFKALIEQFFKKLFKENIRIRPGYFPFVEPGDRSDKWLEVIGAGMIHPQILKNVKLDPSGFAFGMGLDRITMMKYKIDDIRLFHSGDLR........ 331
306 5.000e-76UniRef50_A0A0G0Y6Z3 Phenylalanine--tRNA ligase alpha subunit n=18 Tax=unclassified Bacteria TaxID=2323 RepID=A0A0G0Y6Z3_9BACT  ali  14  5....................IKKGTIHPLSLLAEEAYRAFSELG--FEIATGPELESDWYNFYALNFSKDHPAL-----DMQDTFWIKEPPR-------PSGTPPQAGGEKNPPRLDKEGAGGSKSVLRTHTTTVTARAIEQAGKDGRLPAAFISIGKVFRNEATDATHEMQFYQIDGAMVGENVSLADLKGVLTHFYKKMLSDEVEFRPSFFPFTEPSKFKGKWLEMMGSGVLHPNVLKNCGLDPQGFAFGGGLDRIAMIKWGIPDVRLFYQGDLRLN...... 261
307 6.000e-76UniRef50_A0A2G3B5Y3 Putative phenylalanine--tRNA ligase alpha subunit n=2 Tax=Capsicum TaxID=4071 RepID=A0A2G3B5Y3_CAPCH  ali  17  163.................EKSPYRSYSGKFTEVRRQVQTIFLNMG--FEEMTNNYVESSFWNFDALFQPQQHP-----ARDSHDTFFLKVPS---TTKMLPEDYVERVKEIHESGGY-------------------------QSRGKPFAPKKYYSIDRVFRNEAVDRTHLAEFHQIEGLICDRGLTLGDLIGVLHDFFSRLGMSKLRFKPAYNPYTEPSMEIKKWVEVGNSGMFRPEMLLPMGLDVRVIAWGLSLERPTMILYGIDNIRDLFGSKVDLSLIKRN. 404
308 6.000e-76UniRef50_A0A256YWM8 Uncharacterized protein n=1 Tax=Desulfurococcales archaeon ex4484_42 TaxID=2012520 RepID=A0A256YWM8_9CREN  ali  17  2...................................FREIMRDLG--FEEIDGDYVELEFWNFDALFQAQDHP-----ARDIHDTLQVLNPQLGSLKGIEDVKEVHENGGSCGSWGYRWSLDIARRVILRTHTTALTIKYLAYHK---EPPIRVFTIGRVFRAESIDYKHLPEFYQLDGIIMEKGFTFRKLLGLLKEVAYRIGVKELKFKPGYFPFTEPSVEGYGWVEVFGAGLFRPEILHALGVKYPVGAWGLGLERFAMAVLGFNDIRDLFSYDV......... 244
309 6.000e-76UniRef50_A0A2N2EUR3 Phenylalanine--tRNA ligase alpha subunit n=3 Tax=unclassified Elusimicrobia TaxID=1797919 RepID=A0A2N2EUR3_9BACT  ali  14  91............DETLPGRPFSVGGRHPLSIIRNKIVEIFFSMG--FSLVEGPLMEDDWHNFTALNVPEFHPS-----RDMHDTLYLEG---------------------------------KDNILLRTHTSPVQVRVMKHN----KPPLAVIVPGKCFRNDAIDASHFPVFHQVEGLWVDKDISLADLKGVLSAFVHRLFGNKVRFRPSYFPFTEPSVEHGGFMEIMGAGMVHPEVFRNSGYKYQGFAFGMGIERIAMIYYGLADIRDFYNNDLR........ 331
310 7.000e-76UniRef50_K0C0P2 Phenylalanine--tRNA ligase alpha subunit n=22 Tax=Bacteria TaxID=2 RepID=K0C0P2_CYCSP  ali  13  94............DVTLPGRGQSVGGVHPVTRTMRRIEQIFNRVG--FDVATGPEVEDDFHNFEALNIPSHHP-----ARAMHDTFY-----------------------------------FDEHTLLRTHTSPVQIRVMENQQ----PPLKVIAPGRVYRCDS-DITHTPMFHQVEGFVVDKDINFADLKGVISAFLKAFFEKKVRFRPSYFPFTEPSAEVTGWLEVLGCGMIHPEVFRHINIDFTGFAFGMGVERLTMLRYKINDLRLFFENDL......... 332
311 9.000e-76UniRef50_B0VGJ1 Phenylalanine--tRNA ligase alpha subunit n=9 Tax=Candidatus Cloacimonetes TaxID=456828 RepID=B0VGJ1_CLOAI  ali  15  83..AWKKNEAKAGDLTMPGIFSSRGGLHPLTIIRREIDEVFLGLG--FEIAEGPDIDDDFHNFDALNTPLDHPSRN-----LADTFYLEG------------------GG-----------------LLRTHTSTVQVRVMEK----YPPPIKIISPGRCYRNDKPDPSHSPVFHQVEALVVDKGISLADMKDMLSQFASIMFGKDVRIRPHFFPFTEPSCKYSGWLEMGGAGMVDPNVFDILGIDYTGYAFGLGIERIAMLKYNIPDMRILYENDLRM....... 335
312 1.000e-75UniRef50_A0A2H9QE33 Phenylalanine--tRNA ligase subunit alpha n=2 Tax=unclassified Diapherotrites TaxID=1046942 RepID=A0A2H9QE33_9ARCH  ali  12  227......KIIRNYNIQDPVEEVYPGKKQPYYKFVDEIKQKLVSLG--FKEMENPLIVQEFYNFDVLFQPQNHPARTWT-----DTYKLKKPTHGKLPIVETIKNAHENGGKAESMGYEWSEKIAEQLMPSAHGTAHSARQLVK---GIEVPGKYFTLARCFRPDVVDATHLIEFNQMEGFVVGKDFTLRKLLGLLKEFAVEIAGEKVKFLPDYYPFTEPSVQLNGWVEFGGAGIFRAEITENLGIKEKCLAWGLGMDRLAMFKLKLNDIRELFSQNLD........ 499
313 1.000e-75UniRef50_T2K094 Lysine--tRNA ligase n=3 Tax=cellular organisms TaxID=131567 RepID=T2K094_CROWT  ali  14  118....LKKLTDTGDIIGVKGSIKRTEKGELSVKVKEYEILTKSLPDKWHGLTDTEKRYRQRYVDLIVNPQVRRRRAQITASIRRYLDNQGFIEIETPVLQS-----EAGGAEARPFITYHNTLEMDLYLRIAT------ELHLKRLIVGGFEKVFEMGRIFRNEGVSTKHNPEFTSIELYQAYADYN--DMMELTEAIITT-AAEEVLGTLNITYQGEQIDLSTPWRRVTMNDI----VKEKSGLDFEAF.................................... 350
314 1.000e-75UniRef50_A0A1G8XEC2 Phenylalanine--tRNA ligase alpha subunit n=9 Tax=Halobacteria TaxID=183963 RepID=A0A1G8XEC2_9EURY  ali  14  210.GEWETVEFTDYNVEADADDIEPGRKHALREMADRVKDVLVGMG--FQEMQGPTVDADFWIHDCLFMPQDHPARTHWDR-----FAIENPDDVPDDIVDRVKTAHSDGVGEDGEGYHWDEDFARQLALRGHTTSLTARHLAGEALDLEPPQRFFSVEKAYRNDELDATHLLEFFQIEGWVMAEELSVRDLMGTFTEFYEQFGITDLEFKPTYNPYTEPSPETGELIEIGNSGIFRPEMLEPLEVDCDVMAWGLALERLMMLATGAEDIRDVHGTLVDLEYLRTE. 498
315 2.000e-75UniRef50_F3GF95 Phenylalanine--tRNA ligase alpha subunit n=6 Tax=Bacteria TaxID=2 RepID=F3GF95_PSESJ  ali  14  2..............TLPGRGQTSGGLHPITRTLERIEQFFTHIG--YGIAEGPEVEDDYHNFEALNIPGHHPARS-----MHDTFY-----------------------------------FNANMLLRTHTSPVQVRTMESQQ----PPIRIVCPGRVYRSDS-DITHSPMFHQIEGLLVDRDINFADLKGTIEEFLRVFFEKEVRFRPSYFPFTEPSCKQTGWLEVMGCGMVHPNVLRMSGIDPEGFAFGMGVERLAMLRYGVNDLRLFFDNDLR........ 239
316 2.000e-75UniRef50_A0A1H3VSJ1 Phenylalanine--tRNA ligase alpha subunit n=12 Tax=Bacteroidetes TaxID=976 RepID=A0A1H3VSJ1_9BACT  ali  12  89..........KFDLSLPGDFVGVGTRHPLSIVRGRIVSIFKKLG--FAIAEGPDIEDDWHNFGAMNLPEDHP-----ARDMQDTFYIS---------------------------------QNPSWLLRTHTSSVQARVME----SQKPPIRVICPGRVYRNETISARAHCFFHQVEGLYIAENVSFADLKQTLYFFVQEMFGKKVRFRPSYFPFTEPSCKHTGWVEILGSGMVHPNVLENFGIDYTGFAFGMGVERITQLKYRVNDLRLYSQNDIR........ 333
317 2.000e-75UniRef50_A0A2I0Q5W7 Uncharacterized protein n=10 Tax=Archaea TaxID=2157 RepID=A0A2I0Q5W7_9EURY  ali  16  193...........FDINAPVAQISASRRHPYNEVATLVRKIFLEMG--FQEMEGPLVETTFWCMDSMFIPQDHP-----ARDVQDTYFVKKGMLPNKSLVEKVKEIQETGGDTGSTGYQWKEELADDLILRTHSTATTFRTLYFKQLKNVEKCKYFYIARSFRNETTDATHLCEFAQAEGFIMADGLTLADLKGFIKEFYAKLGVTKIRFKPVYNPYTEPSMKLKKWSALINSGIFRPEALAPYGITKPIIAWGIGFNRLVALLTKTSDVRDTLGPICDLNWLSNR. 468
318 2.000e-75UniRef50_A0A2M7DC19 Phenylalanine--tRNA ligase alpha subunit n=6 Tax=Bacteria TaxID=2 RepID=A0A2M7DC19_9BACT  ali  13  6............DVSLPGEKQANGHLHPFSQAINQLADIFLSMG--FEVVEGPELETDFYNFQSLNYPPFHP-----ARDMQDTYFVKNPH------------------------------GKENLVLRTHTSNVQVRTMEKR----TPPLRVCTFGRCFRHDAIDASHEQVFYQVEGFVVDKEISVSNLIFTMKSILSAFFEKEVRLHPSYFPFTEPSCKGSGWLEIGGSGMIHPNVLKAAGYKEQGFAFGWGLDRLTMLKYKINDVRWFHSGDLR........ 251
319 2.000e-75UniRef50_A5GMH3 Phenylalanine--tRNA ligase alpha subunit n=42 Tax=cellular organisms TaxID=131567 RepID=A5GMH3_SYNPW  ali  17  103............DVTAPPLGVPMGHRHPLISTTEEIVDLFCGLGYQVEE--GPEVETDHHNFTALNIPPDHP-----ARDMQDTFYLKD-----------------------------------NLLLRTHTSPVQIRHLETN----PPPVRIVAPGRVYRRDAVDATHSPVFHQVEVLAIDEGLDFSHLRGTVMAFLKAFFGDPVRFRASYFPFTEPSAEVGRWLEVMGCGMVDPAVLEGLGLDPEGFAAGLGVERFCMVRHGIDDIRRLYTSDLR........ 330
320 3.000e-75UniRef50_A0A0P8UXL9 Phenylalanine--tRNA ligase alpha subunit n=15 Tax=Bacteria TaxID=2 RepID=A0A0P8UXL9_9CLOT  ali  13  94............DISMPGREKIIGHRHPLISVMEELENVFMNMG--FSVVQGPEVETVYNNFDALNSPENHPSRDPS-----DTFYI-----------------------------------TEDILLRTHTSPVQIRVM----KQVKPPLRIVSAGRTFRFDDVDDTHSPMFHQFEGLVIDKNITMANLKDTIYKFVTEIFGEKVRFRPHYFPFTEPSAEGTGWMEILGCGMVHPKVLKNCGIDPEGFAFGLGIDRIAMVKYGINNIRLLFENDMR........ 335
321 3.000e-75UniRef50_A0A1V4Y322 Phenylalanine--tRNA ligase alpha subunit n=28 Tax=Bacteria TaxID=2 RepID=A0A1V4Y322_9DELT  ali  15  94............DVTLPGRGIRYGRLHPVTQIRREITEIFSMLG--FSVEEGPEVETDYYNFEALNIPKNHP-----ARDMQDTFYVE-----------------------------------ENIVLRTHTSPVQIRTMEKR----KPPVRILSPGRVYRPDS-DVSHTPMFHQIEGLLVDRGITFGDLKGTLTFFIRKVFGEAIRFRPSFFPFTEPSAEVDGWLEILGSGMVDPQVFINVGYDPEGFAFGLGLERIAMLKYGVSDIRLFYEND.......... 331
322 4.000e-75UniRef50_A0A0R3SUU6 Uncharacterized protein n=1 Tax=Hymenolepis diminuta TaxID=6216 RepID=A0A0R3SUU6_HYMDI  ali  14  650.GSWKDLKFKKYNFKALGAFPEGGHLHPLLRVRAEFRRILMDMG--FSEMTNNYVESSFWNFDSLFQPQQHP-----ARDAHDTFFLSDPASTDLDYLERVKKTHEVGGFGSKGRYDWQLSEAAKNLLRTHTTAVSARMLYQLAQQKEKPQRYFSIDRVFRNETLDATHLAEFHQVEGVFADYGLNLGHLKAVIRAFFDHLGLHQLRFKPAYNPYTEPSMEI............................................................... 872
323 4.000e-75UniRef50_A5GUT5 Phenylalanine--tRNA ligase alpha subunit n=41 Tax=cellular organisms TaxID=131567 RepID=A5GUT5_SYNR3  ali  17  103............DVTLPPVYTPAGHRHPLLSTTDAIVDIFCGLG--YRVVEGPDIESDYYNFSALNIPEEHP-----ARDMQDTFYLPG-----------------------------------DRLLRTHTSPVQIRHLESN----PPPVRVIAPGRVYRRDAVDATHSPVFHQVEVLAIDEGLDFSHLRGTVSHFLKAFFGDPVRFRASYFPFTEPSAEVGRWLEVMGCGMVDPAVLEGMGLDPEGFAAGLGVERFCMVRHGIDDIRRLFTSDLR........ 330
324 5.000e-75UniRef50_A0A2R4ZNJ0 Phenylalanyl-tRNA synthetase, alpha subunit n=2 Tax=unclassified Desulfurococcaceae TaxID=132567 RepID=A0A2R4ZNJ0_9CREN  ali  18  159....KGIYIKPYNVEAEPAKIYPAYRHFYVDFLEMLREIMLSLG--FDEISDDLVVPELWNFDVLFQAQDHP-----AREIHDTLVVEG-EEADLGI--YSDLLERVSREHSRGWYKYDRSIASRLVMRSQTTAATIRYLHYHR---EPPVRAFIIGRVFRFDRIDAKHLPEFHQLDGIAMERDMSLRKLLGILTQITKALGFREVIFKPGYFPFTEPSVEGYGYVEIFGSGLFRPEVLRMAGVKHNVAAWGMGVDRLAMAYLAINDIRELYTPEID........ 425
325 7.000e-75UniRef50_D1C4D6 Phenylalanine--tRNA ligase alpha subunit n=105 Tax=root TaxID=1 RepID=D1C4D6_SPHTD  ali  16  32.....................YLGRKGEVTSLTRRLGALPPEERPAFGQAVNALKTTLQGSFDDITLPGRLHPVTQMIREVTDIFAHLGFQTVEGPEVEDAYYFDALNIPKEHPARDVWDTESREIVLRPHTSPMQIRTMEQ----STPPVRVVVPGRCYRYEALDATHEWHFHQIEGLAVDERITMSDLKGVLAEFARQIFGRKVRFRCDYFPFVEPVCKGTGWIEILGAGMVHPNLLINVGYDPTGFAFGMGVERLVMLKYGVQDIRAFYQGDVR........ 337
326 7.000e-75UniRef50_A0A0G1KZ67 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=candidate division Kazan bacterium GW2011_GWA1_44_22 TaxID=1620410 RepID=A0A0G1K  ali  15  91............DVTLPGIRPEIGHLSPLTYINRELVDIFKELG--FEVAEGPEAETESNNFDLLNIPANHPARDQW-----DTFWLK-----------------------------QVKDGNDNTLLRTHTSPVQIRFMLAHQ----PPIRIIAPGRAFRYEAEDATHSAVFSQIEGLMIDKEINVAHLKATVLHFVRRILGEEIRLRPSFFPFTEPSCSHKGWLELMGAGMVHPQVLRNVGIDPEVFAFGAGIERLTMLKYGITDIRLFLNGDMR........ 337
327 7.000e-75UniRef50_A0A1I2QX15 Phenylalanine--tRNA ligase alpha subunit n=3 Tax=Bacteria TaxID=2 RepID=A0A1I2QX15_9FIRM  ali  13  86......KKLKVIDVTLPAKRNKIGHRHPNTLVLDEVERIFTGMG--YEVVEGPELEYDYYNFEALNIPANHP-----AKDEQDTFYI-----------------------------------DDKILLRTQTSPVQVRVMEK----QKPPIRMIAPGRVFRADEVDATHSPSFHQIEGMVIDKNVTFSDLKGTLTMFVQQMFGKKVKFRPHHFPFTEPSCKGEGWIEILGCGMVHPRVLRMSGIDPEGFAFGVGLERISLLKYEIDDMRLLYEND.......... 332
328 8.000e-75UniRef50_A0A059F3A1 Phenylalanine-tRNA ligase, alpha subunit n=1 Tax=Anncaliia algerae PRA339 TaxID=1288291 RepID=A0A059F3A1_9MICR  ali  19  176.......TLKKYNFDSKGLAINHGSLHPLLKFKAEIKKIFLEMG--FIEMTSRYVESAFWNFDSLYQPQDHPSRDEITEEIKDFSYENNFKHFNREEMQQEKYLERVKKTHEEGLYKWSKEESSKVTLRTHTTAVSARYLYNMTEG----ERFFSIDRVFRNETVDSTHLPEFHQVEGLLIGDNLNLSDLIQTITLFFNKLGIKELKFKPAYNPYTEPSAEVYGWIEIGNSGVFRPEMIRTMGYDKTALGFGLSVERPAMIMYGCDNIRDLMGNRVNLEFVK... 506
329 8.000e-75UniRef50_A0A2D8U350 Phenylalanine--tRNA ligase alpha subunit n=3 Tax=Proteobacteria TaxID=1224 RepID=A0A2D8U350_9GAMM  ali  15  89.....DKKIDNFDVTMPSRQISIGSLHPITKIMNYSIDIXQDL--KFECVEGPEVEDDFHNFTALNIPESHP-----ARAMHDTFYLED-----------------------------------GNLLRTHTSSVQIRAMREK----EIPIRIIAPGKVYRKDS-DITHTPMFHQIEGLYIDKDVSFSNLKSIINIFLKSFFEEKIRFRPSYFPFTEPSAEVKSWLEILGCGMVHPNVLEMANINYSGYAFGLGVERLAMLKLGISDLRLFYENDLR........ 329
330 9.000e-75UniRef50_H9UCV2 Phenylalanine--tRNA ligase alpha subunit n=11 Tax=Bacteria TaxID=2 RepID=H9UCV2_FERPD  ali  16  101............DPTMPGARRARGHLHIITKVQKELEDIFISMG--FSVVEGPEIEQPWFNFDALNTPEWHP-----ARDAHDSFYIND-----------------------------------EYMLRTHTSPVQIRTM----LSRKPPLAIVAPGRVYRRD-YDATHLPMFTQMEGLYVDHDVTVKHLKYFLEEFARRLLGEKVRLRPSYFPFTEPSFEVDRWFEVLGAGMVHPNVFKNVGYDPEGLAFGLGIERIAMVKYGVKDIRDLVRNDIR........ 328
331 9.000e-75UniRef50_A0A2G6F6F5 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=bacterium DOLZORAL124_38_8 TaxID=2044884 RepID=A0A2G6F6F5_9BACT  ali  16  103...................PPKTGAIHPLNQVQRQVETIFSSMG--FEIADGPHLETEWNNFDALDIPEHHP-----ARDMQDTFWVNN--EAENPH--------------------------ENRVLRTQTSDVQIRMM----KEFGAPLRLISPGRVFRNEDVDATHDAVFYQVEGLLIDKDISLAHLKGTITTMLSKLFEKKIRLRPGYFPFVEPGFEVGKWLEFMGAGMVHPNVLKNGGIDPNGFAFGFGLTRLAMMKYGITDIRYLLSPKID........ 336
332 9.000e-75UniRef50_A0A249KTB1 Phenylalanine--tRNA ligase alpha subunit n=13 Tax=root TaxID=1 RepID=A0A249KTB1_9ACTN  ali  14  95............DITLPVNRRHRGGLHPISIIKNEVSDFFIEHG--YAVAEGPELESGWLNFDALNIPADHPART-----MQDTFF-----------VEPVE---------------------SGMVLRTHTSPVQIRTM----LTQTPPIYVICPGRTFRADELDATHSPVFHQVEGLVVDKGITMAHLKGTLDNFARHMFGPDVRLRPSFFPFTEPSAEVDRWIEWGGCGMVNPKVLQSCGIDYSGFAFGMGLERTLMVRHGITDMHDIVEGDLR........ 326
333 1.000e-74UniRef50_A4G615 Phenylalanine--tRNA ligase alpha subunit n=210 Tax=Bacteria TaxID=2 RepID=SYFA_HERAR  ali  15  93............DITLPGRGRGTGGIHPVMRTWQRVEEIFGSIG--FDVADGPEIENDWTNFTALNSPENHPARS-----MQDTFYIEG-----------------------------NDTQGKPLLLRTHTSPMQVRY----ARMNKPPIRVIAPGRTYRVDS-DATHSPMFHQVEGLWIDENISFADLKGVYLNFVKAFFETDVRFRPSYFPFTEPSAEKGRWLEVSGAGQVHPNVMRNMGFDPEGFAFGSGLERLTMLRYGINDLRLFYEGDLR........ 332
334 2.000e-74UniRef50_B9J7G4 Phenylalanine--tRNA ligase alpha subunit n=198 Tax=cellular organisms TaxID=131567 RepID=SYFA_AGRRK  ali  13  93............DVSLPVRPAERGRIHPISQIVDEITAIFGDMG--FSIAEGPDVETDYYNFTALNFPEGHP-----AREMHDTFF-----------FQP-------------------DEKGERKVLRTHTSPVQIRTMEA----QKPPIRIIIPGKTYRQDS-DATHSPMFHQVEGLVIDKTANVANIRWVLEEFCKTFFEVDMRFRPSFFPFTEPSFEGTDWMEILGCGMVHPNVLRHGGLDPDGFAWGMGLDRIAMLKYGMPDLRDFFNADVR........ 339
335 2.000e-74UniRef50_A0A1W2CHM4 Phenylalanine--tRNA ligase alpha subunit n=11 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A1W2CHM4_9RHIZ  ali  12  93............DVTLPVRPASRGRIHPISQVIDEITAIFADMG--FSIAEGPDIETDYYNFTALNFPEGHP-----AREMHDTFF-----------LQP-------------------DAKGERKVLRTHTSPVQIRTME----SQTPPIRIVIPGKTYRQDS-DATHSPMFHQVEGLVVDKTANIAHMKWVLSEFCRAFFEVDMRFRPSFFPFTEPSMEGTDWMEILGCGMVHPNVLRAGGLDPDVFAWGMGIDRIAMLKYGMPDLRAFFDADIR........ 340
336 2.000e-74UniRef50_A0A1V4XC65 Phenylalanine--tRNA ligase alpha subunit n=7 Tax=Bacteria TaxID=2 RepID=A0A1V4XC65_9DELT  ali  15  94............DVTLPGRAFARGTLHPITRVTQEICGIFASLG--FAVAEGPEVELDYYNFEALNMAKDHPS-----RDMQATFYITG-----------------------------------NLLLRTHTSPVQVRVMER----QKPPVRIIAPGKVYRPDA-DISHSPMFHQIEGLYVDRRVTFGDLKGTLTFFLKHVFGEEVRFRPSFFPFTEPSAEVDGWLEILGSGMVDPEVFKAVGYDYTGFAFGLGVERIAMLRYGISDIRLFTEND.......... 331
337 2.000e-74UniRef50_Q7NGP0 Phenylalanine--tRNA ligase alpha subunit n=1949 Tax=root TaxID=1 RepID=SYFA_GLOVI  ali  14  94............DVTMPGRFVPPGRLHPLTATTDRIVDVFVGLG--FTVASGPQIETEYYNFEALNTPADHP-----ARDMQDTFYLSD-----------------------------------GLVLRTQTSSVQIRYMEEND----PPVRICVPGRVYRRDQVTNRHSPVFHQLELLAVDEEITFGDLKGTLTFFTQEMFGDRVRFRPSFFPFTEPSAEVTGWLEIAGCGMVDPNVFQAVGYNPEGFAAGMGIERIAMLLYDINDIRLFYTNDLR........ 333
338 2.000e-74UniRef50_A0A1H3HXW9 Phenylalanine--tRNA ligase alpha subunit n=6 Tax=Clostridiales TaxID=186802 RepID=A0A1H3HXW9_9FIRM  ali  16  101............DVTLPSKKLKKGYLHPNTQVRNQIVDIFGSMG--FSVYEGNEIETDHYNFTALNIPKDHPS-----RDMQDTFY-----------------------------------LSPEFLLRTQTSAGQVHVMESQQ----PPIKIISPGKVFRSDD-DATHSPMFSQMEGLVVDEGITLCDLQGMLDVFVKKIFGEETRLRPSYFPFTEPSCKGTGWIEVLGAGVVNKKVLEGCGIDYSGLAFGIGIDRIAMLKYGINNIKLLFESDLRV....... 341
339 2.000e-74UniRef50_A0A212KTZ2 Phenylalanine--tRNA ligase alpha subunit n=3 Tax=Chlamydiia TaxID=204429 RepID=A0A212KTZ2_9CHLA  ali  14  94............DITLPGRRQFSGRKHPITQMMDVVIEALVEMG--FTVQCGPDIESDYYNFEALNFAKDHP-----ARDMQDTFYI-----------------------------------APEVLLRTHTSNVQVRVME----TSKPPIRVISPGKCYRNETITARSHVFFHQVEALYVDDHVSFADLMSAMNEFLSKLFARKVRFRASYFPFVEPVCKHTGWLEVAGAGMVHPEVLKNGGIDPEGYAWAVGIERLVMIKHGIKDIRLFTENDMR........ 334
340 2.000e-74UniRef50_A0A0M2LRS0 Phenylalanine--tRNA ligase alpha subunit n=25 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A0M2LRS0_9SPHN  ali  15  91..........RIDMTLPVDAPLAGTIHPVSQVMDELAEIFADLG--FAVATGPEMETDWHNFTALNIPETHP-----ARAMHDTFYLAG-----------------DHVPEDR---------ERPRLLRTHTSPVQIRTM----LANKPPIRIIAPGRTYRSDS-DATHTPMFHQVEGLVIDKGITMGHLKWTLETFLKAFFERDLRLRPSYFPFTEPSAEVDGWMEVLGSGMVHPKVIAACGLDPDGFAFGCGIDRLAMLKYGMDDLRAFFDGDIR........ 346
341 2.000e-74UniRef50_B2IUA1 Phenylalanine--tRNA ligase alpha subunit n=34 Tax=Cyanobacteria TaxID=1117 RepID=SYFA_NOSP7  ali  16  98............DVTMPGIYSPQGRIHPLNGIIDRALDIFVGMG--YTVAQGPEMETDYYNFEALNTPPDHP-----ARDMQDTFYLPD-----------------------------------GNLLRTHTSSVQIRYMERE----EPPIRVVAPGRVYRRDNVDATHSAVFHQIELLAIDEGLTFTDLKGTIKVFLQAIFGDPIRFRASYFPFTEPSAEVGRWLEVMGCGMVDPNVLKSVGYDPEVFAAGFGVERFAMVLHQIDDIRRLYASDLR........ 325
342 2.000e-74UniRef50_A0A202DJ26 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=bacterium E08(2017) TaxID=1932693 RepID=A0A202DJ26_9BACT  ali  14  90...........FDCSIPGRWQALGSTHPISAVIKETVDIFRSLG--FTVADGPDIETRYRNYTALNTPEHHPSMDE-----QDTFWIEG----------------------------------DDLLLRTQTSPVQVRVMEK----QEPPVRIVTPGRCYRRDTTDATHSANFHQIEGLYVDRKVSLADLKGVLAHFAHKLMGPKVRFRPHFFPFTEPSCKNSGWIEIAGAGMVDPRVFEMVGYDPEGYAFGMGIERIVMVKYGVPDIRMLYENDLR........ 332
343 3.000e-74UniRef50_A0A2E2WU85 Phenylalanine--tRNA ligase alpha subunit n=4 Tax=unclassified Gammaproteobacteria (miscellaneous) TaxID=33811 RepID=A0A2E2WU85_9G  ali  15  93.........DNFDLSMPGKASSVGSMHPISKTMECAIQIFESL--KFECVEGPEIEDEFHNFTALNIPDSHP-----ARAMHDTFYIEN-----------------------------------NLLLRTHTSSVQVRAMSEKTA----PIRIIAPGKVYRKDS-DITHTPMFHQIEGLYVDKEVSFSNLKSIINIFLKSFFEEKIRFRPSYFPFTEPSAEVKSWLEILGCGMVHPNVLDMANIDYSGYAFGLGVERLAMLKLGITDLRLFYENDLR........ 329
344 3.000e-74UniRef50_R5VJF7 Phenylalanine--tRNA ligase alpha subunit n=26 Tax=Bacteria TaxID=2 RepID=R5VJF7_9CLOT  ali  12  17...EASKELDKLNEIRVS---FLGKKGELTSVLKSMKEVAPEDRPKVGQMXXREEKMKAEVIDVTLPGGHRHPNTITLEEVEKIFIGMGYEVVEGPEVEYDYYFEALNIPANHPAKDEQDTFNDKILLRTQTSSVQVHEMEKGKL----PIRMISPGRVFRSDDVDATHSPSFHQIEGLVIDKNVTFADLKGTLEQFAKKLFGEKVKFRPHHFPFTEPSCKGEGWIEILGCGMVHPHVFEMSGIDPEGFAFGVGLERIALLKYEIDDMRLLYEND.......... 332
345 3.000e-74UniRef50_D9PMA2 Phenylalanyl-tRNA synthetase, alpha subunit n=1 Tax=sediment metagenome TaxID=749907 RepID=D9PMA2_9ZZZZ  ali  14  238............DVTLPGRGDAVAALHPVTRTMARIEALFASIG--FAVADGPEIETDFYNFTALNIPENHP-----ARAMHDTFYLEG-----------------------------------GNLLRTHTSPVQVHYMQKQQ----PPLRIIAPGRVYRCDS-DVTHTPMFHQVEGLWVDESASFADLKGVLADFMARFFERDVRFRPSFFPFTEPSAEMTGWLEVLGCGMVHPNVFGHVGIDYQGFAFGLGVERLAMLRYGVDDLRLFFENDLR........ 478
346 3.000e-74UniRef50_A0A1G2PP39 Phenylalanine--tRNA ligase alpha subunit n=45 Tax=Bacteria TaxID=2 RepID=A0A1G2PP39_9BACT  ali  15  2..ADKSKKF--IDVTAPGKKMERGHLHPLTQAMDKAGDIFQSMG--FEIADGPELETEYYNFDALNIPADHP-----ARAMQDTFWLRXXXXXXXXXXXXXXXXXXXXX--------------------THTSSVQIRYMERNQ----PPFRIISPGRVFRMEATDATHETQFYQIEGLMVDKKTNLANLKAVIKIFLQGFFGDEIRFRASYFPFGVEVDFKGKWLEVAGAGIVHPKVLDNMKLDPNGFAFGMSVDRLAMIKYKIDDIRLFYSGDLR........ 254
347 3.000e-74UniRef50_E0S1Z3 Phenylalanine--tRNA ligase alpha subunit n=95 Tax=root TaxID=1 RepID=E0S1Z3_BUTPB  ali  16  100............DVTMPAKIRYTGNLHPVTQMRETLIDIFAGMG--FEIYEGTEIENDYYNFTALNTPKDHP-----ARDMQDTFY-----------------------------------LSPEFLLRTQTSSGQIHVMEK----SKPPIKILSPGKVFRSDD-DATHSPMFSQMEGLVVDKNITLCDLKGSLELFAQKIFGETTRLRPSYFPFTEPSCKGTGWIEVLGAGVVNKKVLENCGIDYSGFAFGIGIERATMLKYGINNIKLLYESDIDV....... 340
348 3.000e-74UniRef50_Q8ZDX0 Phenylalanine--tRNA ligase alpha subunit n=1241 Tax=root TaxID=1 RepID=SYFA_YERPE  ali  13  93............DVSLPGRRMENGGLHPVTRTIERIETFFGELG--FSVESGPEIEDDYHNFDALNIPAHHPARAD-----HDTFW-----------------------------------FDATRLLRTQTSGVQIRTM----QEQQPPIRIIVPGRVYRND-YDQTHTPMFHQMEGLIVDRDISFTNLKGTLHDFLRNFFEEDIRFRPSYFPFTEPSAEVGKWLEVLGCGMVHPNVLRNVGIDPEGFAFGMGMERLTMLRYGVTDLRAFFENDLR........ 321
349 3.000e-74UniRef50_A0A1G2BBS4 Phenylalanine--tRNA ligase alpha subunit n=3 Tax=root TaxID=1 RepID=A0A1G2BBS4_9BACT  ali  12  92............DLSLPGIKPTSGHLHPLSLAANELMDIFSAMG--FMIYEGPELENDFYNFESLNIPPSHP-----ARDMQDTFFIKD-----------------------HIKRQEKRKFSENWVMRTHTSNMQVRIMEQ----FQPPLRCVVPGRVFRNEATDASHEHTFYQLEGFVVDKNITIGHAMWTLKEILRQVFKKDIRLRPGYFPFVEPGCKRSGWVELVPCGMIHPNVFKAAGYPYTGFAFGLGLSRLTMMKYGISNIRLFTENDLR........ 346
350 4.000e-74UniRef50_A0A1F2R0Q7 Phenylalanine--tRNA ligase alpha subunit n=18 Tax=Bacteria TaxID=2 RepID=A0A1F2R0Q7_9BACT  ali  15  102............DLTLPGRLPPRGRRHPLTVVREELEDAFVAMG--YEVYEGREVEDDYHCFEALNMPPDHP-----ARDMQDTFYLEG----------------------------------GQRLLRTHTSSAQIRYMIENAH--PPSVRIICPGKVYRRDD-DITHSPVFQQIEGLVVGSGITLGHLKGTIEAFLHALFGARVRFRPSFFPYTEPSCKGTGWLEILGSGMVHPAVLEAVNEEVTGFAFGLGIERVAMVRHGIDDIRLFYGGDLR........ 351
351 5.000e-74UniRef50_A0A2S8SXH3 Lysine--tRNA ligase n=3 Tax=Bacteria TaxID=2 RepID=A0A2S8SXH3_9BACT  ali  15  90IGEEKMAEFKLGDILGLSGVVMKSRSGEISIGLEDFTLLATSLPDKYHGLQDVELRYRQRYADLMSNEEVFRKRSQIVREMRSYLDAREFMEVETPMMQAI-----AGGAAAKPFVTHHNALDMELYLRI------APELYLKRLVVGGLERVYEINRNFRNEGIDTRHNPEFTMMELYQAYADYN--DMMDLTETMVRQIA-QKVNGSTTVTYGEHEIDLGQPWRRATMRELVREAI----GLDISG---GMGL.............................. 332
352 5.000e-74UniRef50_UPI00083F8648 phenylalanine--tRNA ligase subunit alpha n=1 Tax=Rhodohalobacter halophilus TaxID=1812810 RepID=UPI00083F8648  ali  12  90............DITLPVEPTYAGSFHPLTQALDEMKQIFLRLG--FNIADGPELENDFHNFTALNFPPDHP-----ARDMQDTFFV----------------------------RKSDDQNEQDLVLRTHTSPVQIRLM----KNQQPPLRSIMPGRVYRNEAVTAKSYFQFNQVEGLYVDKNVNMGELIETLVMFAKLMYGSDVRVRPSYFPFTEPSEKGGQWLEILGAGMVDPNVFESVNVDPEGFAFGMGVDRIAMLRYGIDDIRLLYENDIR........ 329
353 5.000e-74UniRef50_Q5SGX2 Phenylalanine--tRNA ligase alpha subunit n=38 Tax=Thermaceae TaxID=188786 RepID=SYFA_THET8  ali  15  87............DVSLPGASLFSGGLHPITLMERELVEIFRALG--YQAVEGPEVESEFFNFDALNIPEHHP-----ARDMWDTFWLEGFR-LEGPLGEEVEG---------------------RLLLRTHTSPMQVRYMVAH----TPPFRIVVPGRVFRFEQTDATHEAVFHQLEGLVVGEGIAMAHLKGAIYELAQALFGSKVRFQPVYFPFVEPGAEGGKWLELGGAGMVHPKVFERLGLPPTGFAFGLGVERLAMLRYGIPDIRYFFGGRL......... 340
354 6.000e-74UniRef50_Q8DMA9 Lysine--tRNA ligase n=139 Tax=cellular organisms TaxID=131567 RepID=SYK_THEEB  ali  15  113.........DVGDILGAVGTLKRTEKGELSVVVESYTMLTKSLPDKWHGLTDVEKRYRQRYVDLIVNPQVRRKRALITAAIRRYLNEQGFIEIETPVLQ-----VEAGGAEARPFITYHNTLEMQLYLRIAT------ELHLKRLIVGGFEKVYELGRIFRNEGISTKHNPEFTSIEVYQAYADYN--DMMTLTEAIITT-GAMEVLGTLKITYQGETIDLTPPWRRVTM----HDAVLAATGIDFRQLG-DLTAAKIAAQKVGVKDL................. 358
355 6.000e-74UniRef50_Q7UP75 Phenylalanine--tRNA ligase alpha subunit n=21 Tax=Planctomycetes TaxID=203682 RepID=SYFA_RHOBA  ali  14  97...........FDPTLPGTRPSLGHIHPITQTISHLTEIMGRMG--FEVAEGPEVEDPWHNFVALNIPEDHPARDPL-----DNFYL-----------------ATAKDPSGKSSVSAGDEGSQ--LLRSQTSTVQIRVM----KQVEPPIRIISLGRVYRPDAPDATHFPMFHQMEGLLVDTNVTMANLKTVLRVFANNYLGEDVRFRPSFFPFTEPSVEVGTWIEFGGAGMIDPNVFAAVGYDPEGFAFGLGVERLCMRRHGITDIRDLYSGDLR........ 342
356 8.000e-74UniRef50_A0A1W9RXM0 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=candidate division Zixibacteria bacterium 4484_93 TaxID=1970780 RepID=A0A1W9RXM0  ali  15  89............DISLPGRKGYLGSRNPIITIIEEITHIFYSMG--FEVIEGPDIETEYYNFDALNTPDYHPS-----RDIQDTFYL------------------------AMPGY----------LLRTQTSPVQIRTMETHPL----PIRMISPGRCYRRDAIDPTHYICFHQVEGLYIDRNVTMAMLKGVLSVFARRLLGKQIRFRPHFFPFTEPSCKNTGWLEISGAGMVHPKVLEISGIDPKGYAFGMGVERLAMIKYQIDDIRHFYNNDIR........ 330
357 8.000e-74UniRef50_A0A2H9LFE2 Phenylalanine--tRNA ligase subunit alpha n=1 Tax=Candidatus Diapherotrites archaeon CG08_land_8_20_14_0_20_30_16 TaxID=1974403 Re  ali  12  203....KKVNFKPYNVVSEVDPLFLGKYQPYLRFLDLVKQKLVGMG--FEEMPTDLITTEFYNFDVPFQPQNHPARTWS-----DTYSLKRPSLGDLPLVNKVKAAHESGGNTGSKGYNWQESIAQKLMPVAHGTAFSARLL---SQGVDSPKRYFAFSRVYRPDVIDATHLSEFNQLEGFVLGKDISFKHLLGLLSQFAKEFAGEEIMFTPCYYPFTEPSASLHGWVELGGSGIFRPEFTETLGIKERVIAWGIGIDRLAMFNLDITDIRDLFSTKLD........ 477
358 8.000e-74UniRef50_A0A2A4MEA2 Phenylalanine--tRNA ligase alpha subunit n=2 Tax=Candidatus Marinimicrobia bacterium TaxID=2026760 RepID=A0A2A4MEA2_9BACT  ali  13  92............DYTLPGDPIPVGSIHPLTQVMEEIKSIFLRLG--FSIXYGPEIDTDFYNFEALNIPXHHP-----ARDMQDTFYITD-----------------------------------NVLLRTHTSDTQIHFMENH----EPPVRIIAPGRVYRNEDVSVRSYCLFHQIEGLYVDSKVTFAELKGTLDYFARELFGQKTRFRPSYFPFTEPICKKTGWLEILGCGMVDPEVYKSVNYXPEGFAFGMGIERMAMLKYGVQDIRLFYSGDVR........ 332
359 1.000e-73UniRef50_A0A2A5AJ95 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Candidatus Cloacimonetes bacterium TaxID=2030808 RepID=A0A2A5AJ95_9BACT  ali  12  88............DLSMPGIQTKTGTLHPISKTIQEVTHIFKKLG--FAVETGPEIENDYYNFEALNIPQHHP-----ARDTQDTFFI-----------------------------------DQKHVLRTQTSGIQIRTMEN----QKPPIRIIAPGKVFRVDH-DVTHSPVFHQIEGLMVDKDINFRHLKYILRLLIHELFGKEVRFRPSFFPFTEPSAEMTGWIEILGCGMVDPNVLTGVGINPDGWAFGVGIERIAMLKYAITDIRLFYENDLR........ 327
360 1.000e-73UniRef50_A0A2E1QNP6 Phenylalanine--tRNA ligase alpha subunit n=2 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A2E1QNP6_9GAMM  ali  16  92............DVSLPVGKIFAGGLHPITKTIDKICSYFSAKGYLIEE--GPEIESEYYNFDALNIPENHP-----ARDMHDTFYV-----------------------------------DSGKLLRTHTSPVQIRSIEKYNV----PLKIICPGKVYRSDS-DPTHTPMFHQIEGLLIDENVNFGNLKKELIDFLNYFFAKKVRFRPSYFPFTXPSAEKNGWLEIMGCGMVHPDVLEMAGIDYSGFAFGLGIERMAKLDYSIKDMRVLFENDL......... 318
361 1.000e-73UniRef50_A0A0B7HIL9 Phenylalanine--tRNA ligase alpha subunit n=64 Tax=cellular organisms TaxID=131567 RepID=A0A0B7HIL9_9FLAO  ali  13  88...........GDLTRPATPISLGARHPISLVKKQIVEIFSNIG--FNVSEGPEIEDDWHNFTALNLPEYHP-----ARDMQDTFFIQ---------------------------------TNPDILLRTHTSSVQVRYMENHQ----PPIRTISPGRVFRNEAISARSHCLFHQVEGLYIDKDVSFADLKQTLLYFTKEMFGKKIRLRPSYFPFTEPSAEGTGWLEIMGCGMVDPNVLKNCNIEYSGFAFGMGVERIAMLLYQIGDIRMFYENDVR........ 330
362 1.000e-73UniRef50_Q8UIN5 Phenylalanine--tRNA ligase alpha subunit n=4856 Tax=root TaxID=1 RepID=SYFA_AGRFC  ali  13  93............DVSLPVRPTERGRIHPISQIVDEITAIFADMG--FSIAEGPDIETDYYNFTALNFPEGHP-----AREMHDTFF-----------FQP-------------------DEKGERKVLRTHTSPVQIRTME----SQKPPIRIVIPGKTYRQDS-DATHSPMFHQVEGLVIDKKAHVGNLRWVLEEFCKTFFEVDMRFRPSFFPFTEPSFEGKDWMEILGCGMVHPNVLRAGGLDPDGFAWGMGLDRIAMLKYGMPDLRDFFNADVR........ 339
363 1.000e-73UniRef50_A0A2V7Z1E6 Phenylalanine--tRNA ligase subunit alpha n=2 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V7Z1E6_9BACT  ali  15  104............DVTLPGRRTRAGSLHPVTLVRRRIEEIFLRMG--YSIADGPEIESDFHNFEALNFPPEHP-----ARDAQDTLFLD--RKAESP-----------------------------LLLRTHTSPVQIREMRKR----GAPLKIIAPGRVYRNESVDATHQPVFHQVEALVVDKEISMADLKGTVEAFFGALFGTRVRIIPTFFPFVEPGCKGSGWMEIAGAGEVHPAVLRACGIDPEGFAFGLGLDRVAMMLYEFPDLRLLFEGD.......... 346
364 1.000e-73UniRef50_A0A1F9YNV1 Phenylalanine--tRNA ligase alpha subunit n=20 Tax=root TaxID=1 RepID=A0A1F9YNV1_9BACT  ali  15  85.............LTLPSIRAPRGRLHPLTTALAEISRIFQLLGYSWAE--GPFVEDERHNFSALNIPEDHP-----ARDSHDTFYLQG----------------------------------LPLLLRTHTSTVQIRTMESR----KPPIRVVCPGRVFRHEQIDATHSAVFHQVEGLVIDSGIGFADLKGHLQAFLQELLGTQTRFRPSYFPFTEPSCKHTGWIEILGAGVVNPAVLRTVDYDPEGFAFGIGVERVAMLLHGVKDLRDFYSNDLR........ 325
365 1.000e-73UniRef50_Q7RSE2 Phenylalanyl-tRNA synthetase, putative (Fragment) n=3 Tax=Eukaryota TaxID=2759 RepID=Q7RSE2_PLAYO  ali  16  18....................................................NYIESSFWCFDALYIPQQHPS-----RDLQDTFFIKHPKYINKEYIENIKRVHTYGDYGSFGWYKWKLEESQKNVLRTHTTANSCRALFKXAKMYKESKKYFSIDRVFRNENLDSTHLAEFHQIEGLVIGKNIGLSQLIAMLSAFYKYIGIHKLKFKPTFNPYTEPSMEVKKWLEVGNSGIFRPEMLMPMGFDVSVMAWGLSLERPTMIKYGINNIRDLFG............ 253
366 2.000e-73UniRef50_A0A0S3QVR8 Lysine--tRNA ligase n=37 Tax=Bacteria TaxID=2 RepID=A0A0S3QVR8_THET7  ali  19  101...EVFKKLDVGDIIGVKGHLFRTKTGELTVNCSEVTLLSKPLPEKWHGLKDIETRYRQRYLDLIVNEDSRRIRSEVIRLIREYLVSKGFIEVETPMMQPIP-----GGAAARPFVTHHNALDIDLYLRI------APELYLKRLVVGGFDRVFELGKCFRNEGISSMHNPEFTMVEFYMAYADY--KDLMELTEDMLSGI-VKKIHGTTKITYQGQEIDFTPPWKKISFC----EALVEIGGVPERVI.................................... 334
367 2.000e-73UniRef50_A0A2G9YE51 Phenylalanine--tRNA ligase alpha subunit n=3 Tax=unclassified Parcubacteria group TaxID=1794840 RepID=A0A2G9YE51_9BACT  ali  15  94............DVTSRVEGLKSGHLHPNSTLQYELEDIFVSMG--FMVLDGPELESDYYNFEALNIPYWHP-----ARDIQDTFYVK--SEILNPKSETNSKSQKTKISILRSSATAKDGQNQDLLLRTQTSSVQVRALEK----YGVPLRAIVPGRCFRNEATDASHEHTFYQLEGLMVDKDISIANLVSVMKALLEGIFKKKIRLRPGYFPFVEPVCKGSGWVELLPCGLVHPNVLKYGGVDPSGLAFGLGLTRLVMMKYGIDDIRLFQSGDLR........ 376
368 3.000e-73UniRef50_A0A1H8G469 Phenylalanine--tRNA ligase alpha subunit n=3 Tax=Betaproteobacteria TaxID=28216 RepID=A0A1H8G469_9BURK  ali  13  93............DVTLPGRTRGAGGLHPVTLTLERIESIFGSMG--FEVARGPEIESDWFNFTALNTPEDHPARS-----MHDTFYVEGGNE------------------------------KAPNLLRTHTSPMQIRHAVQHAGQTMPEIRVIAPGRTYRVDS-DATHSPMFHQCEGLWIGQNISFKDLKVVFTDFCRTFFESDLRFRPSFFPFTEPSAEIGKWLEVAGSGQTHPNVVRNMGLDPEGFAFGMGLDRFTMLRYGVNDLRLFFDGDVR........ 344
369 4.000e-73UniRef50_A0A2H0DLY1 Phenylalanine--tRNA ligase alpha subunit n=7 Tax=Bacteria TaxID=2 RepID=A0A2H0DLY1_9BACT  ali  14  99............DASLPPRDLGLGRRHPITKTIEDMAGILSRLGFAW--ADGPRVESDRYNFTALNIPEDH-----SARDMQDTFYLEN-----------------------------------GQLLRTHTSPVQIRYLEKHA----PPVRIMAPGRVFRHEAEDAGHAAVFHQIEGLYVDRGVTMADLKNTLSVFMKGLFGTKIRMRPSYFPFTEPSCKQSGWMEMLGSGVVNPAVLKGVGLDTEGFAFGVGVERIAMLRLGIPDIRMFYENDLR........ 339
370 4.000e-73UniRef50_A0A0S7H9I7 SYFA (Fragment) n=3 Tax=Bilateria TaxID=33213 RepID=A0A0S7H9I7_9TELE  ali  19  21................................................................................................YLERVKKVHSEGGYGSQGYYDWKMEEAQKNILRTHTTAVSARMLYKLAQQEKFPVKYFSIDRVFRNETLDATHLAEFHQIEGVVADYGLTLGDLMGVLHQFFTKLGITKLRFKPAYNPYTEPSMEVKKWVEVGNSGVFRPEMLLPMGLDVSVIAWGLSLERPTMIKYGINNIRELVGHKVNLQMVYD.. 218
371 4.000e-73UniRef50_A0A136MXA2 Phenylalanine--tRNA ligase alpha subunit n=2 Tax=Bacteria TaxID=2 RepID=A0A136MXA2_9BACT  ali  14  101............DISLPGRDADIGAFHPVSLIIDEIASLFLRMG--YDVYDDREIETDYYNFEALNFPADHP-----ARDMQDTFFLDG-----------------------------------GLLLRSHTSNGQIHYMENH----KPPLKVIVPGRVYRRDS-DPTHLPMFHQVEGLVVGKGVSMANLKWTLETMMKALFGPDLRLRPSFFPFTEPSAEVGRWLEMGGAGLVHPNVLLACQIDPEGFAFGMGVERLAMIRYRVPDIRMFYENDVRV....... 334
372 4.000e-73UniRef50_A0A1W9VTV6 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Candidatus Cloacimonetes bacterium 4572_65 TaxID=1972455 RepID=A0A1W9VTV6_9BACT  ali  13  92..........RIDLTMPGRRTVQGGLHPLTKIWREIEDTFISMG--FEIADGPDVEDEFHNFDALNAPADHPS-----RDLADTFYVKD-----------------------------------NVLLRTQTSTIQIRVAENH----NPPIRIIAPGRCYRNDKMDASHSPVFHQVEAFVIDENVTFADLKDTLNIFVKLMFGKKSRIRPHFFPFTEPICSGSGWLEMGGAGMVDPAVLQNVGIDYTGFAFGLGIDRITMLKYNIPDIRVLFENDLR........ 334
373 4.000e-73UniRef50_G4CQG6 Phenylalanine--tRNA ligase alpha subunit n=12 Tax=Proteobacteria TaxID=1224 RepID=G4CQG6_9NEIS  ali  16  20............DFNSLEKAQYMGKTGELNLLLKQLGQMSPEERKRFQEAYNNEAQLAAEALDVTLPDGGLHPVTLTLQRVVELFHGMGFEVADGPEIEDDFHFQALNIPQNHPARAMQDTFYVENVLRTHTSPIQIRYMLDKK---EPPIRIIAPGRVYRVDS-DATHSPMFHQAEGLWVEEGVTMADLKAVFTDFIRRFFERDVRFRPSFFPFTEPSAEIGKWLEVGGCGMVHPNVLNNVNIDPEGFAFGIGLDRFAMLRYGINDLRLFFDNDLN........ 323
374 5.000e-73UniRef50_T1C074 Phenylalanyl-tRNA synthetase, alpha chain (Fragment) n=1 Tax=mine drainage metagenome TaxID=410659 RepID=T1C074_9ZZZZ  ali  16  2..............................................FTEMRGHYVEYTGWNMDALFIPQDHP-----ARDLQDTFYLESKFK---PEFEHPEILDIVSRSHERGGYKFNLKEAQRLVLRTHTTVSTIRSLYENH---EPPVAIFSVEKVFRHESVDWRHLAELHQVEGAVYAKDANLSTLKGLMRHFYHELGFDDLEFIPSYYPYTEPSMLDEKEIELGGSGIFRPEVTIPVGLKYPVIAWGLGLERLAMILYGLKDIREIYNSDIDLRNFQVRI 242
375 5.000e-73UniRef50_D4TSR1 Phenylalanine--tRNA ligase alpha subunit n=8 Tax=cellular organisms TaxID=131567 RepID=D4TSR1_9CYAN  ali  16  89...ERQLELETLDVTMPGTYRPQGKIHPLNGIIDQAIDIFMGMG--YTVAQGTEMETDYYNFEALNTPPDHP-----ARDMQDTFYLPD-----------------------------------GNLLRTHTSSVQIRYMEKE----EPPVRIVAPGRVYRRDDVDATHSAVFHQIELLAVDEGLTFTDLKGTVKVFLQSMFGDPIRFRASYFPFTEPSAEVGRWLEVMGCGMVDPNVLKSVGYDPEGFAAGFGVERFAMVLHQIDDIRRLYNSDLR........ 325
376 5.000e-73UniRef50_A0A2E7KIM0 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Gimesia sp. TaxID=2024833 RepID=A0A2E7KIM0_9PLAN  ali  15  93............DVTLPGVRTLPGHRHPLIATMEEVKSILLGLGFRYD--DYPEVESEFFNFDALNTPDWHP-----ARDMHDSFYT-----------------------------------TKGNVLRTHTSAFQTRAM---KQFGPPPLRAMTSGRCYRRDEIDASHFPIFHQLDVIAIDENISFADLKWVLYQVASSLFGDDVRFRPSYFPFTTPSMFNGKWLEILGAGMIRPEVLEAGGVDPEGFAFGLGLDRMAMIRHGITDIRYMYENE.......... 320
377 6.000e-73UniRef50_A0A1D8MRN6 Uncharacterized protein n=7 Tax=Nanohaloarchaea TaxID=1051663 RepID=A0A1D8MRN6_9ARCH  ali  15  177...........FNVEAQTSTPKTGKKHYYKNILQYARQTWMEMG--FEEMEGDYVVPSFLNFDALYTPQDHP-----ARELHDTFFVENPEKADLSEVEHVKKTHEAGWSTGSRGYDWSKQEAERNVLRTHTTAISAMTLHEIDNDEELPKKFFIVGRNFRNETVDRTHLAEFYQTDGIVVGKDLNFANLKGYISKFFEKMGYEKFRLIPSYYPYTEMSVEVQVWDEMGGAGMFRPEVVKPMGFEAKVLAWGLGIPRIAFMAAGLSDIRELYRNDIKI....... 451
378 6.000e-73UniRef50_A0A1I5WN64 Phenylalanine--tRNA ligase alpha subunit n=9 Tax=Cytophagales TaxID=768507 RepID=A0A1I5WN64_9BACT  ali  12  91...........FDYTLPTVPNTLGTRHPLSLVREEMMRVFARIG--FAIAEGPEIEDDWHNFTALNFPENHP-----ARDMQDTFFV-------------------APAAGAEPGTQPH-------LLRTHTSTVQVRVMETEPL----PIRKVMPGRVFRNEAISARAHMMFHQVEGIFIDEGVSFADLKQTVYYFVQELFGQDIRFRPSFFPFTEPICKQSGWVEIGGCGMVDPAVLENAKIDYSGYAWGMGIERIAMLKYQIKDLRLFTENDMR........ 341
379 7.000e-73UniRef50_M5TDG7 Phenylalanine--tRNA ligase alpha subunit n=17 Tax=Bacteria TaxID=2 RepID=M5TDG7_9PLAN  ali  15  97...........FDPSLPGARPALGHIHPITQTIDHLTEIMGRMG--FEVAEGPEVEDPWHNFVALNIPEDHPARDPL-----DNFYL-------------AAAGVSSGDASAETGEGES-------LLRSQTSTVQIRVMKSRQ----PPIRIISLGRVYRPDAPDATHFPMFHQMEGLLVDRNVTMANLKTVLRVFANNYLGDDVRFRPSFFPFTEPSVEVGTWIEFGGAGMIDPNVFEAVGYDPEGFAFGLGVERLCMRRHGITDIRDLYSGDLR........ 341
380 7.000e-73UniRef50_A0A2E4HWL3 Phenylalanine--tRNA ligase alpha subunit n=3 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2E4HWL3_9BACT  ali  13  47..........PGEIRGRVGRAANDARQEITRQLEEIK---ASL--------NKDVGNEVPPLDVTLPGGSLHPITLALQEIVDVFTRMGYTVLGGPEVEHDYYFEALNIPRDHPARDSQDTLDSDWLLRTHTSPVQIRTME----EQEPPLAIIVPGRVYRRDTPDATHTPSFVQCEGLLVDRDITMADLRGTLDHFAKALLGTQTRLRPGYFPFTEPSAEMDGWIEMLGCGMVHPAVFEKIGYDPDGFAFGMGVDRIAAMRYGITDIRTLYEND.......... 314
381 7.000e-73UniRef50_A0A2G6EAC6 Phenylalanine--tRNA ligase alpha subunit n=4 Tax=Bacteria TaxID=2 RepID=A0A2G6EAC6_9BACT  ali  13  88.........DYIDLTLPGRNIEIGTTHVLTQTLKEIKEIFKSLG--FSIYTGPEIESDENNFEMLNFPADHP-----ARDMQDTYFLSD-----------------------------------SFLLRTHTSPVQVRLM----KNNKPPYRAIMPGRVYRNEAISAKSYCLFHQVEGLVIDTDITFAELKGTLVYFAKQLFGEDVRFRSSFFPFTEPSAEVGKWLEILGCGMVDPNVLDNLNVDSEGYAFGMGVERMAMLKYGIDDIRLFFDND.......... 322
382 9.000e-73UniRef50_A0A2E1JZ31 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Legionellales bacterium TaxID=2026754 RepID=A0A2E1JZ31_9GAMM  ali  13  105.......................GALHPLTLTLNALKRSLQHMG--FTIAFGPEAETFYYNFTALNTPRYHPAVT-----AQDTLYI-----------------------------------DDDQLLRSHTSCVQIRMLEQQQ----PPLRIFSPGRVFRADTPDATHSPCFMQCEGLVIDHQANLSDLVSTLRCLLENFFGRKMRFRPSYFPFTEPIWFKDKWLEVLGCGMVHPNVLENLGIDYQGYAFGLGIDRLTMLRYQIDDIRALYEGD.......... 320
383 1.000e-72UniRef50_P94282 Phenylalanine--tRNA ligase alpha subunit n=61 Tax=Borreliaceae TaxID=1643685 RepID=SYFA_BORBU  ali  13  239....ENKKFRAYNIHIPSAKTFIGRANSYLDYISKIKDKLVGLG--FQEFDGPLVETEFFNNDALFMPQFHPS-----RDIKDVYYISDPSMQESPYFSNVKLAHETGYATGSRGYSFSEDLSKRLVLRTHGTVLSAKQLIN----AKNPSRYFGVIRCFRYDQVDATHGVDFYQTEGIVIEDGVSIKTLLGLLEIFAKELAGTEIKYVPAYFPFTEPSIEIHGWFELGGSGIFRPEVTKPLGIDLPVIAWGIGIDRMALMHLGLNDLRDLFTYDI......... 511
384 1.000e-72UniRef50_C4QNZ6 Phenylalanyl-tRNA synthetase alpha chain,putative n=12 Tax=Eukaryota TaxID=2759 RepID=C4QNZ6_SCHMA  ali  15  3..................................................TNNYVECSFWNFDSLFQPQQHP-----ARDAHDTFFLSDPEIVETCYIDKVRTVHSQ-GAFGSRGYQWLMEEAEKNLLRTHTTAVSARMLHALSKKNPFPAKYYSIDRVFRNENLDATHLAEFHQVEGLVADFGLSLGHLKSVIRTFFSKLGLTQLRFKPAYNPYTEPSMEIKKWVEIGNSGLFRPEMLRPMGLPESVIAWGLSLER............................ 221
385 1.000e-72UniRef50_A0A1B1FUL0 Phenylalanine--tRNA ligase alpha subunit n=50 Tax=Bacteria TaxID=2 RepID=A0A1B1FUL0_9BACT  ali  12  89............DLTLPNVPNEMGTVHPITKVREEISRIFERVG--FNISEGPEIEDDWHNFSALNFPPNHP-----AREMQDTFFL---------------------------------EKDPDIALRTHTSSVQVRVMEN----QKPPIRTLSPGRVYRNETISARAHCIFHQVEGLYIDKNVSFKDLKDTLYYFAKEFFGTKIRLRPSYFPFTEPICKYTGWVEIGGCGMVDPNVLKASGIDPEGFAFGMGIERMTMLKYRINDLRLFTENDLR........ 331
386 1.000e-72UniRef50_I4BW85 Phenylalanine--tRNA ligase alpha subunit n=17 Tax=Bacteria TaxID=2 RepID=I4BW85_ACEMN  ali  13  93........LDAIDVTQPPKGRPWGGFHPVVEVMHELIDIFLGLG--FSVALGPEVEDDFHNFEALNIPPHHP-----ARDMQDTFYLEG----------------------------------SELLLRTHTSPVQVRSM----LKYGAPLRIVCPGKVYRRDS-DPTHSPMFHQLEGLLVDTDVSVSDLKGCMIHFIDKVFGRKSRFRASYFPFTEPICKGTGWLEVCGMGMVHPNVLRAGGIDPEGFAWGLGIDRVAMLKYGLNDLRMLFSGDI......... 338
387 1.000e-72UniRef50_A0A1F8TJH5 Phenylalanine--tRNA ligase alpha subunit n=2 Tax=unclassified Chloroflexi (miscellaneous) TaxID=189774 RepID=A0A1F8TJH5_9CHLR  ali  12  97............DLTLPPRRVRVGRYHPITQTIREITRIFAGMG--FEAVEGPEVEWDYYNFEALNIPPGHPARDKF-----NTLWIA--QEAAVSMSLAAAAGGRTAAPGGRP---------QPMLLRPHTSPMQIRTMEQRR----PPVRIVVPGRCFRFEATDTTHESVFFQLEGLAIDEQLSMADLKGVLYSFARQLFGRKVRFRPDYFPFTEPSAEITGWIEIAGCGMVHPEALRRVGYDPQGFAWGGGVERIAMLLTGTPDIRLFHQNDLRY....... 368
388 1.000e-72UniRef50_A0A2G6KCL8 Lysine--tRNA ligase n=36 Tax=Bacteria TaxID=2 RepID=A0A2G6KCL8_9BACT  ali  17  99..FDLYKRLDIGDFIGVTGRVFRTKTDELTVLVSELTLLSKSLPEKWHGLKDVETRYRQRYVDLIVNQQTFMKRAQTISAIRTFFSDREFLEVETPMMQPI-----AGGATAKPFVTHHNALDMTLFLRI------APELYLKRLIVGGFERVFEINRNFRNEGISTRHNPEFTMLEFYMAYADY--QDLMTLTEELFSSVA-QDVLETTKITYQGQSIDLTPPWDRLT----VRDGILKYA........................................... 326
389 2.000e-72UniRef50_A0A1E3H8P5 Phenylalanine-tRNA ligase, alpha subunit, variant n=1 Tax=Cryptococcus amylolentus CBS 6039 TaxID=1295533 RepID=A0A1E3H8P5_9TREE  ali  15  209.GAWKSSDFKQYNFAATGVPTDGGALHPLLKVREEFQKIFFDMG--FTEMTNRFVESAFWNFDAMFVPQQHP-----AREMQDTFYVKNPVKALKPDSEYYERVRKIHGGFGSIGYRFNQDESEKLLLRTHTTAVTTDMLYKLANQPGGPAKMFSIDRVFRNETADATHLAEFHQVEGLVADYDITLGHLIAFMQEFFGKTGNTKLRFKPAYNPYTE.................................................................... 424
390 2.000e-72UniRef50_A0A1V5ZVR5 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Parcubacteria group bacterium ADurb.Bin159 TaxID=1852937 RepID=A0A1V5ZVR5_9BACT  ali  17  80.GGEESKYKKDIDITQPGEKIERGNLSLITQMKNEIEMFFLSMG--FDIAEGPNVETEFYNFDALNIPEYHP-----ARDIQDTFWLK-----------------EKGINKE------------KLLLRTHTSPVQIRYMREH----KPPLKMITIGNTFRHEAIDASHEAQFCQMEGLAVDKNISLANLKDVVENFLRHFFGKKIQWRPGYFPFVEPVCKNSGWLEVMGAGMVHPYVLKKGGIDPQGFAFGIGIDRLVMLRHCITDIRVFRGG........... 334
391 2.000e-72UniRef50_A0A2V8LPG2 Phenylalanine--tRNA ligase subunit alpha n=2 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8LPG2_9BACT  ali  11  135............DVTIPGRRPQPGHLHPITLMRQRIEDIFVSLGYAVE--DDREIETDFYNFDALNIPEGHP-----ARDPQDTFYT-----------------------------------TEGFALRSQTSTVQIHAMQRR----GAPVRMIAPGRVFRRDTPDPTHNPMFFQVEGLCVDRGITMAHLKGTLAEFVHRLFGTKTRFRPSYFPFTEPICKHSGWIELGGSGMVHPNVLRTANVDFTGFAFGLGIDRTCARIYQLDDIRLLFENDVR........ 375
392 2.000e-72UniRef50_A0A0G1B862 Phenylalanine--tRNA ligase alpha subunit n=11 Tax=Bacteria candidate phyla TaxID=1783234 RepID=A0A0G1B862_9BACT  ali  12  123.........RIFDPTIPGKKEEAGRLHILTQMRREVEDVCVGMG--FMIVDGPELESEWYNFEAVNVPAWHP-----ARDMQDTFYIKK---------SRNQEIKKSTDQDNHKLTN----LDTNLVLRTHTSNVQVRAMEK----YGVPLRCIAPGRTYRNEATDARHEHTFHQVEGLMVDKNISIANFKAVFDAIVKAILGAKTRIRPGYFPFVEPVCKHTSWVEFCGAGMVHPNVLKTGGVDPSGFAFGFGLERLTMMRYGINDIRLFHSGDLR........ 388
393 3.000e-72UniRef50_Q728R9 Phenylalanine--tRNA ligase alpha subunit n=552 Tax=root TaxID=1 RepID=SYFA_DESVH  ali  10  88......AALSRFDPSLPGRMPWRGSLHPVTLVMEEICSVFGALG--YDIVTGPEVENDYHNFEALNMPPEHP-----ARDMQDTLYI-----------------------------------TESILMRTHTSPLQVRTMKSLR----PPVAAIAPGKVYRRDS-DITHTPMFHQIEGFMVDHNVSMAELRGTLTSFLRTVFGTRVRFRPSFFPFTEPSCKTTGWVEILGCGMIDPEVFKSVGYDPEVFAFGLGVERVAMLKYGIGDLRMFFENDVR........ 339
394 3.000e-72UniRef50_A0A0J6WRB1 Phenylalanine--tRNA ligase alpha subunit n=4 Tax=Actinobacteria TaxID=201174 RepID=A0A0J6WRB1_9MYCO  ali  13  22..........RIDVTLPSTRQPVGARHPITILAEHVADTFVAMG--WELAEGPEVETEQFNFDALNFPPDHPARSE-----QDTF--------------------------------HVAPEGSRQVLRTHTSPVQIRAL----LERELPVYIVSIGRTFRTDELDATHTPVFHQVEGLAVDKGLTMANLRGTLDAFARAEFGPQTRFRPHFFPFTEPSAEGPGWVEWGGCGMVNPNVLRACGIDPSGFAFGMGLERTLQFRNGIPDMRDMVEGDVR........ 260
395 3.000e-72UniRef50_A0A0G0LQX6 Phenylalanine--tRNA ligase alpha subunit n=2 Tax=root TaxID=1 RepID=A0A0G0LQX6_9BACT  ali  17  30....................LFLGRKAELNEILKNIKTLPMSIGAKANLLK-KEIETKIANFDLTLPAAVHPLR-QIQNEITKIFTDLGFEVASGPEIESDWYFEALNIHANHPARDDQDSFNREQLLRTQTSPVQIRVLEK----SKPPVRIICPGKTFRRDASDATHTSMFHQIEGLVVDEDVTFADLKGILIYAAKKLFGEKTRFRISYFPFVEPVCKGTGWIEIVGCGSVHPNVIKNAGLNPQGIAFGMALERPLMIKYQIKDIRLFFENDIR........ 327
396 3.000e-72UniRef50_A0A2V9LVA1 Phenylalanine--tRNA ligase subunit alpha n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V9LVA1_9BACT  ali  12  130............DLTLPGYRRRLGSIHPITRVQREIEDIFLGLGYSIE--TGPEVETAYYNFDALNIPATHPARDDM-----DSLYV-----------------------------------DAETVLRTHTSPVQIRALRKH----GAPLYILAPGRVYRRDNPDASHSPMFHQIEGLAVDADITFADLKGTLDFFCRKFFGEKVRFHPTYFPFTEPSCKASGWIEVMGCGMIHPDVLGHGGVDPEGWAFGLGIDRFAMVKYDIHDIQLFFQSDMR........ 377
397 3.000e-72UniRef50_A0A0S8DPQ3 Lysine--tRNA ligase (Fragment) n=2 Tax=root TaxID=1 RepID=A0A0S8DPQ3_9BACT  ali  17  89.GYWVFENLDIGDIVGLKGKTFKTKTQEPTINVSEITVLSKSLPEKWHGLKDIELRYRQRYLDLLVNKEVREIRSRLISRIRTFLDGKGFLEVETPMMQPLP-----GGATARPFKTHHEALGVDLYLRI------APELYLKRLLVGGFEKVYEINRNFRNEGISPRHNPEFTMLEVYAAYANY--QDMMELACELILD-AAKHIFGKYKVNYKDGDIDLSPPWANLT----FHEAVTKYAGIDYKAVAKGLGL.............................. 336
398 3.000e-72UniRef50_A0A011KXP5 Phenylalanine--tRNA ligase alpha subunit n=3 Tax=Bacteria TaxID=2 RepID=A0A011KXP5_9GAMM  ali  16  34.......................................................................HPVTQVQERICQFFTKAGFTVATGPEVEDDYHFEALNIPGHHPARAMHDTFDATHLLRTHTSGVQIRTME----TSEPPIRIVCPGRVYRCDS-DQTHSPMFHQIEGLYVAENTSFAELKGLLINLLNEFFEKKVRFRPSYFPFTEPSDERGRWLEVLGCGMVHPNVLRAAGIDPDGFAFGLGVERFAMLRYGINDLRMFYQNDVR........ 248
399 4.000e-72UniRef50_A0A0S7X4A4 Phenylalanine--tRNA ligase alpha subunit n=27 Tax=Parcubacteria group TaxID=1794811 RepID=A0A0S7X4A4_9BACT  ali  14  93............DITAPGKKIPIGHLHPITQVKKEVEEIFQSMG--FSVVEGPEIENEWYNFDALNIPKDHPARD---------------------------------------FWDTLWLKLDKLLLRTHTSPVQVRFMEKN----NPPLKIIVPGRVFRHEATDVSHEINFYQVEGLMIGKDISVANFKAIIQEFFRRFFRKKIRLRPSYFPFTEPSCSKTGWMEMMGAGMVHPNVFKNSGLNWQGFAFGMGLDRLAMMKYKINDIRLFYSGDLR........ 334
400 4.000e-72UniRef50_A0A2M7RNW1 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=bacterium (Candidatus Howlettbacteria) CG_4_10_14_0_8_um_filter_40_9 TaxID=20142  ali  12  89............DITAPGSEFPEGHLHPVTQFLEKATSVFQTMG--FEIYESPEVEKAFYNFDAINVPKDHP-----ARDSWDTFYVDDNRTLDDDDKLLL---------------------------RTHTSNAQVRAMADR----KPPVRVIVPGKCFRNEATDASHETTFYQLEGFVIDEGISVSDLIGALTHFAKKMFGNDVRFRPHYYPFTEPSCKKSGWIEVMPCGMIHPNVLKNMNVDYSGFAFGFGIDRLTMLYYGIEDMRLIHSGDLR........ 337
401 4.000e-72UniRef50_V6DKL7 Phenylalanine--tRNA ligase alpha subunit n=3 Tax=Bacteria TaxID=2 RepID=V6DKL7_9DELT  ali  16  97...........FDVTAYKPFTYKGSLHPYTHLIEQVEDIFISMG--YEIIQGPEVETEYHNFDVLNIPSNHP-----AREMQDTFWL------DLP----------------------------DKLMRTHTSTVQVHAMKNR----KPPIAVGSLGRCYRNEATDASHDFMFMQVEILFIDKNVTISNLVATAKTFLQLLFGKDIRLRPSYFPFVEPVCKTTGWIELGGAGLMHPNVLTSCNIDPEGFAFGFGLTRLAMLRYGISDIRLLHSNKID........ 339
402 4.000e-72UniRef50_A0A2E6W9G1 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Legionellales bacterium TaxID=2026754 RepID=A0A2E6W9G1_9GAMM  ali  15  62......................................IKKQLGVIIHERKTVLVELAEQGLDALSTDGALHPLTKTFNQLKRLMYSMGFDVAFGPEAETFYYFTALNTPRHHPAVTLQDTIDDDQLLRSHTSSVQIRMLEK----VKPPVRIFSPGRVFRADTPDATHSPCFMQCEGLVVDQTATLSDLIATLRYLLEGFFGQDLRFRPSYFPFTQPILFKGRWLEVLGCGMVHPDVLDNVGIDYQGYAFGLGIDRLTMLRYHIEDIRQLYDGDL......... 319
403 4.000e-72UniRef50_A0A2W5Z063 Phenylalanine--tRNA ligase subunit alpha n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2W5Z063_9CHLR  ali  12  107............DMTAPGRPVAAGHLHPLMTAEREVREIFH--GFGFEVIEGPEIETDEMNFERLNIPPDHPS-----RDLWDTLYVAEPGSVEA--------------GAPRPAED-------GTILRTHTSPVQIRAM----KALKPPIRVVIPGRCFRYEAVDAGHNFEFFQVEGLVVDRETSLADLKGTLEAYARAMYGTRTRFRPGYYPFTEPSCQRTGWMTILGAGMVHPVVLRNGGLDPEGYAFGMGLDRMTLLRYGIPDLRLLMGSDLR........ 361
404 4.000e-72UniRef50_A7NJ67 Phenylalanine--tRNA ligase alpha subunit n=70 Tax=root TaxID=1 RepID=SYFA_ROSCS  ali  16  96............DVTLPGRAPAVGRLHPTTQMLRTIYTILGEMG--FQVWESPEVETDEFNFQLLNMPPDHP-----ARDMWDTFY------VET----------ASGEPT--------------LLLRTHTSPGQIYAM---RANAPNPVRAILPGKCYRYEQVTARHEMQFFQVEGIAIGERISFADLKGTLVAFAERLYGKKTRFRPSYFPFTEPSCKHSGWLEILGAGMIHPTVLRNGGYDPEGFAFGMGPERMAMLRYGIDDIRWFFSGD.......... 340
405 5.000e-72UniRef50_A0A2H0RFA7 Phenylalanine--tRNA ligase alpha subunit (Fragment) n=1 Tax=Candidatus Vogelbacteria bacterium CG10_big_fil_rev_8_21_14_0_10_51_1  ali  14  15................AGKGVASGHPHPLAIVIREAVEVFAEMG--FAVADGPIVETEYYNFDALNIPKDHP-----ARDAWDTFWLK-------PVASSDRSAQDAVSASGLGLKTQQSASSPQMLLRTHTSPVQIRYMESHQ----PPIRIIAPGRTYRYEATDATHEAQFFQLEGLMVDRDVSVAHLKAVLEKFFSAMFKKEIRMRPSYFPFVEPICKQSGWIEILGAGMVQQSVLANVGIEYRGFAFGCGVERIAMLRYGV.................... 277
406 5.000e-72UniRef50_B3DYQ7 Phenylalanine--tRNA ligase alpha subunit n=10 Tax=Verrucomicrobia TaxID=74201 RepID=B3DYQ7_METI4  ali  16  94............DPTLPGRPIQSGTLHPISIALKKIFEIFKRIGFTLEE--GPEIESEYNNFDALNIPLGHPARNE-----QDTFYLK----------------EKVLLKDNSPG---------KLLLRPQTSPVQVRVMKNK----KPPIRIIAPGRCYRRDEIDATHSIVFYQLEGLVVDKGISLADLKGTLEYFFRELLGSQLRFRPHYFPFTEPSFEVDGWLELCGCGMVHPKVFLNVGIDPEGFAFGFGIERYLMVAHKVPDLRLFTENDIR........ 338
407 6.000e-72UniRef50_A0A2D5NGT4 Phenylalanine--tRNA ligase alpha subunit n=2 Tax=Planctomycetes bacterium TaxID=2026780 RepID=A0A2D5NGT4_9BACT  ali  14  91...........FDPTEPGPRARRGALHPITIVQNELVDLFTSMGFRWE--DGPEIESEYFNFDALNIPGDHP-----ARESQDTFW-----------------------------------LDDGNLLRTHTSPVQVRTLQRLVKAFEPPLKVIVPGRCFRSETVDKTHEHSFYQMEGLVVDRGVSTANLIHTMKTCLRVILEREVRLRPGFFPFVEPVCKQTGWIEILPCGMVHPNVLREGGLDPEGFAFGMGLQRVVMLRYGIDDIRHFMGGDLR........ 347
408 7.000e-72UniRef50_A0A2A4YDH5 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Candidatus Aerophobetes bacterium TaxID=2030807 RepID=A0A2A4YDH5_9BACT  ali  15  94............DVTLPGRKRYLGKEHPISSMMQQVLDILIQMG--FSVQTTPEIESEYYNYGGLNYPEDHP-----ARDMQDTFY-----------------------------------LTKDLLLRSHTTSIQQRIMEKH----TPPIRIVSYGKCYRNETITTRSHVLFHQVDGLYIDKNVTFADLLATKKEFYSKIFEKKVRVRPSYFPFVEPLCKTTGWLEVCGAGMVHPEVLKQGGLDPEVYAWGGGIERLVMLKYGITDIRMFTEND.......... 332
409 7.000e-72UniRef50_A0A0N8HZL6 Phenylalanine--tRNA ligase alpha subunit n=3 Tax=Archaea TaxID=2157 RepID=A0A0N8HZL6_9EURY  ali  15  2............................LRQAAERVKDVLVGMG--FQEMDGPHADADFWINDALFMPQDHPARTHWDRFALDV----DPIE-ELPELQAVENAHREGVGPDGDGYHWSEEFAREVALRGHTTSLSMRYLSGAAEDLEPPQRYFSVEKAYRNDTIDSTHLLEFFQIEGWVMAEELSVRDLMGTFEEFYAQFGITDVQFKPHYNPYTEPSPETDELIEIGNSGIFREEVLSPLGVECDVMAWGLALERLAMLYTGAEDIRDLHGTLADLEFLRN.. 261
410 8.000e-72UniRef50_A0A0A0EJ28 Phenylalanine--tRNA ligase alpha subunit n=33 Tax=Bacteria TaxID=2 RepID=A0A0A0EJ28_9RHOB  ali  11  90............DVTLPGRDRRTGTVHPVSQVWEEVTAIFADMG--FAVAEGPQIETDWYNFDALNIPSHHPARAEM-----DTFY-------------------------------MHRAEGDDRVLRTHTSPVQIRSMEA----QGAPIRTISPGRVYRAD-YDQTHTPMFHQVEGLAIDRDISMANLKWVLEEFFSAYFGTKTRFRASHFPFTEPSAEGDDWLEVLGSGMVHPKVLSAAGVDPQGFAFGMGIDRIAMLKYGIPDLRAFFDSDLR........ 335
411 8.000e-72UniRef50_A0A0G1K082 Phenylalanine--tRNA ligase alpha subunit n=15 Tax=unclassified Bacteria TaxID=2323 RepID=A0A0G1K082_9BACT  ali  13  93...........FDETAPGIPVPRGTKHPLTQFTDRICAVFTSMG--FEIVEDREVEKVEYNFDKLNMPDNHP-----ARDMWDTFYI------------------KSQIPPANGMF-------HEVVLRTHTSPVQLRAMETR----KPPVRLVVPGRCYRHDATDASHETGFYQLEGLVIDKGVSVANMIYVLDSVLKRLFGNKIRIRPSFFPFVEPVCSKTGWLEMMGSGMVHPVVLNNMGVDYTGFAFGMGIDRLMMLYYGVDDIRLSYSGDLR........ 344
412 9.000e-72UniRef50_A0A2D9FU63 Phenylalanine--tRNA ligase alpha subunit n=5 Tax=Bacteria TaxID=2 RepID=A0A2D9FU63_9BACT  ali  13  90............DITLTSPSWPLGSLHPLTQTLEEMKSIFYRLG--FTIADGPEIEDDFHNFTALNFPPNHP-----ARDEQDTFFIR---KSDDPDMQ-------------------------DLVLRTHTSPVQIRLMEN----TEPPIRAIMPGRVYRNEAVSPKSYFLFHQVEALYIDKNVSVADLKETLITFAKLMFGTKYRLRPGFFPFTEPSLEMGKWLEILGSGMVDPNVLKHAGVDPEGFAWGMGVERIAILRHGIDDIRTFYENDVR........ 329
413 1.000e-71UniRef50_T1AR89 Phenylalanyl-tRNA synthetase, alpha chain n=1 Tax=mine drainage metagenome TaxID=410659 RepID=T1AR89_9ZZZZ  ali  17  213..EWKTKEFKSYNVTDPTERAYPARIHPSHRFFSYIRSIFLSMG--FSEVVGPIIDNAFWNFDALFSPQDHPT-----RDMQDTFFLSNPKEIGVSDLEVLSRVRRM---HKKGWKSWRESLAKQALLRTHNTSVSVKNIYGNLADSAYPIKLFSLGKVFRNESIDYKHLNELNQLDGIIIGDSLTLSNLIFTMKEFYSYLGID-VKFKPSYFPFVEPGMEGDDDIELFGSGIIRKEITKAMGTNKTVLAWGIGLDRLMFNYIETDSLSEIYRNQIWLRDVK... 492
414 1.000e-71UniRef50_A0A2D9IM08 Phenylalanine--tRNA ligase alpha subunit n=30 Tax=root TaxID=1 RepID=A0A2D9IM08_9GAMM  ali  16  6.............IYLPSKNKELGSIHPINKVKFSLEKLLCSFG--FEIAEGPEIESEKYNFDMLNIPSTHP-----AREMHDTFYVNN----------------------------------KKSVLRTHTSPVQVRXM----LSNKMPIAFISPGKVYRKDD-DSTHLPMFHQIEGIYVDENVNFAHLKDLIYKICFSLFGDKIRFRPSFFPFTEPSAFGDKWLEILGCGIVNPKVLKNCSIDYSGLAFGLGIERIAMLKYGVKDIRDFYKSNLD........ 233
415 1.000e-71UniRef50_A0A2G9Z071 Phenylalanine--tRNA ligase alpha subunit n=5 Tax=Parcubacteria group TaxID=1794811 RepID=A0A2G9Z071_9BACT  ali  15  95............DITVPGERPVFGHLHPLTITRRKCEEIFQTMG--FTVVEGPEIETEWYNFDALNIPKDHP-----ARDLWDTFFLKN-----------------------------------GLLLRTHTSPVQIRYMEKN----NPPLRIIVPGTIFRHEATDVSHEFQVFQIEGLMVDKKISVANLKAIVGEFFRRFFEKEVRLRPDFFPFVEPVCKKTGWLEMAGAGIVHPNVFKNSKLDWQGWAFGFGLERLTMLKYKINDIRLFRSGDLR........ 335
416 1.000e-71UniRef50_Q72M80 Phenylalanine--tRNA ligase alpha subunit n=232 Tax=root TaxID=1 RepID=SYFA_LEPIC  ali  14  82....KKKLFEKFDVLRPLSKPSNGSLHPITQIQYEIEDIFASMG--FSVMDGPEIETDTNNFGALNFTEDHP-----AREMQDTFYLEN-----------------------------------GNLLRTHTSAIQVRTLRKL----KPPFRIIAPGRVFRYEEVDASHEHTFYQIEGMVVGKDISAANLIDTMQVLLSRIFEKEIRLRPGYFPFVEPVCKQSGWLELLPCGLIHPNVLSHAGLDPTGFAFGLGLDRLVMMRYGIHDIRYFQSGNLR........ 336
417 1.000e-71UniRef50_O88055 Phenylalanine--tRNA ligase alpha subunit n=232 Tax=Actinobacteria TaxID=201174 RepID=SYFA_STRCO  ali  14  95............DVTLPHDRVPAGARHPLTTLSERIEDIFVAMG--YEVAEGPEAEAEWFNFDALNIGPDHPARGEA-----DTFFVQGPE----------------GGAES------------GVVLRTHTSPVQIRS----ALTRELPVYVICPGRVYRTDELDATHTPVFHQVELLAVDEGLTMADLKGTLDHMVQSLFGAKTRLRPNFFPFTEPSAEMDGWIELGGCGMVNPRVLTACGIDPEGFAFGFGIERMLMFRHNVEDMRDMVEGDVR........ 349
418 1.000e-71UniRef50_A0A2W4MHH6 Phenylalanine--tRNA ligase subunit alpha n=1 Tax=Actinobacteria bacterium TaxID=1883427 RepID=A0A2W4MHH6_9ACTN  ali  14  93.........DAIDVTLESVRMPAGSRHLIQQVIDEVVDIFVGLG--YRVAEGPEAELAWYNFDALNTPKTHPSRLES-----DTMYL-----------------------------DWGNPED-EVLLRTQTSPVQARYMESHQ----PPVYIVAPGRTYRTDTVDATHLPVFHQIEGLAVDEGLTLGDLRGTLAHFAREFFGTQVRLRPSFFPFTEPSAEGAGWLEMLGCGMVDPNVLSAAGYDPEVFAFGVGVERLAMVRHGLDSIKNFIDNDIR........ 343
419 1.000e-71UniRef50_A3IQP2 Lysine--tRNA ligase n=63 Tax=cellular organisms TaxID=131567 RepID=A3IQP2_9CYAN  ali  14  118....LKKLTDTGDIIGVKGSIKRTEKGELSVKVKQYQILTKSLPDKWHGLTDTEKRYRQRYVDLIVNPQVRRHRAQITASIRRYLDNQGFIEIETPVLQS-----EAGGAEARPFITYHNTLEMDLYLRIAT------ELHLKRLIVGGFEKVFEMGRIFRNEGVSTKHNPEFTSIEIYQAYADYN--DMMELTEAIITT-AAQEVLGDSKITYQGEKIDISTPWRRVTM----HEIVKEKSGLDFEKF.................................... 350
420 2.000e-71UniRef50_Q9CC17 Phenylalanine--tRNA ligase alpha subunit n=1739 Tax=root TaxID=1 RepID=SYFA_MYCLE  ali  12  94..........RIDVTLPSTRQPTGARHPITILAEHIADTFIAMG--WELVDGPEVETEQFNFDALNFPADHPARSE-----QDTFYI-------APD-------------------------GSRQLLRTHTSPVQVRTL----LERELPVYVISIGRAFRTDEVDATHTPVFHQVEGLAVDRGLSMAHLRGTLDIFARAEFGTRTRIRPHFFPFTEPSAEVDDWVEWGGCGMVHPNVLRATGIDPDGFAFGMGLERTLQFRNSIPNMRDMVEGDVR........ 332
421 2.000e-71UniRef50_A0A1H6DVM2 Phenylalanine--tRNA ligase alpha subunit n=4 Tax=Actinobacteria TaxID=201174 RepID=A0A1H6DVM2_9ACTN  ali  13  110............DVTLPWDRAPRGARHPVTTMQERMTDVFVSMG--FEVAEGPEVDAEWFNFDALNIPLDHPARS-----MQDTFWIAG---QDGPDGSNXXXXXXXXXXXX-------XXXXXXMVLRTHTSPVQIRAL----LSRPLPVYVVSAGRTFRSDEFDATHSPVFHQMEGLAVDEGITMADLRGAIEAFVRGMFGERTRFRPSYFPFTEPSAEVDGWIELGGCGMVNPRVLVACGIDPDGWAFGLGVERTLMFRHGVADMHDMVEGDVR........ 382
422 2.000e-71UniRef50_A5V922 Phenylalanine--tRNA ligase alpha subunit n=57 Tax=root TaxID=1 RepID=SYFA_SPHWW  ali  14  90............DMSLPVSAGMQGSVHPVAQVMDELAEIFADLG--FAVATGPEIEDDWHNFTALNIPETHP-----ARAMHDTFYF--------PDRED----------------------GKKMLLRTHTSPVQIRTMMTE----KPPIRIIAPGRTYRSDS-DATHTPMFHQVEGLVIDRGIHMGHLKWTLETFVKAFFERDLRLRPSFFPFTEPSAEVGGWMEILGSGMVHPRVIANCGLDPDGFAFGCGIDRLAMLKYGMDDLRAFFDGDLR........ 339
423 2.000e-71UniRef50_A0A1Z9FHH1 Phenylalanine--tRNA ligase alpha subunit n=13 Tax=Bacteria TaxID=2 RepID=A0A1Z9FHH1_9RICK  ali  14  94.........DKIDITLPARPIRQGGIHPISKTIDEIVSIMGSLG--FNVEEGPHIEDDYYNFTALNIPEEHPARQE-----HDTFYLNGKH--------------------------------KKKLLRTHTSPVQIRTMKEKV----PPIKIIVPGSTYRCDD-DATHSPMFHQIEGLVVDENISMANLKWVIKKLLSSFFNVKMRFRPSYFPFTEPSAEGKDWLEVLGCGIINPHVFENCTIDYSGFAFGLGVERFAMLKYGITDLRMFYEND.......... 337
424 3.000e-71UniRef50_A0A1W9NBX6 Phenylalanine--tRNA ligase alpha subunit n=2 Tax=Spirochaetaceae TaxID=137 RepID=A0A1W9NBX6_9SPIO  ali  14  92...WTDITLRR---SLMAESVKESGQHPLSIVQRELEDIFLSMG--FDILDGPHIETDWYNFTALNIPESHP-----ARDMQDTFWFK----------------------------------DMKHLLRTHTSTIQIRGMEHK----TPPFRFVAPGKVFRCETTDASHEAVFHQMEGMLVGKDISVAHLIYFEKTLLSEIFQREVRLRPGFFPFVEPVCKQTGWVELLPCGMTHPNVLRYGGIDPEGFAFGLGLDRLVMMRYGIDDIRLIHSGNLD........ 339
425 3.000e-71UniRef50_A7HPL0 Phenylalanine--tRNA ligase alpha subunit n=77 Tax=Bacteria TaxID=2 RepID=A7HPL0_PARL1  ali  15  23............DTLEAVRVAALGKKGRVSDLMKGLGSMSKEMGPKLNGLKDRLTEQRKQALDVTLPAGRIHPLSQVWDEVVAIFADMGFAVEQGPDIETDHYFGALNFPEGHPAREMHDTFGSRMLLRTHTSPVQVRTMEA----GKPPFRFICPGRTYRNDS-DQTHTPQFHQIEGLVVDETTHMGHLKWTLEEFLRAFFGVELRMRPSFFPFTEPSMEGDDWLEILGCGMVHPNVLRAAGIDPEGFAFGMGIDRIAMLKYGIPDLRAFFEADLR........ 340
426 3.000e-71UniRef50_A0A1G0WHU3 Phenylalanine--tRNA ligase alpha subunit n=2 Tax=Bacteria TaxID=2 RepID=A0A1G0WHU3_9BACT  ali  14  96............DITLPGRAWKYGKKHPITQTIDDCVAIFRRIG--FIVADGPCIETIHHCFDALNTPKDHPSREKS-----DTFY-----------------------------------FPDGRLLRTQTSTVQIRVME----SQEPPIRIIAPGPCFRPDTPDATHSANFYQIEGLYIDKNISMADLKSTLMYFARELMGENVRFRPHFFPFTEPSCKRSGWLEMGGAGMVDPNVLRNVGCDPSGFAWGMGVERIAMIRHRINDIRYFYDNDVR........ 336
427 3.000e-71UniRef50_A0A255QM09 Phenylalanine--tRNA ligase alpha subunit n=8 Tax=Bacteria TaxID=2 RepID=A0A255QM09_9PLAN  ali  16  97...........FDPTLPGIRPSIGHVHPITQTINHLMEIMGRMG--FEAAEGPEVEDPHHNFVALNIPEDHPARDPL-----DNFYL----------------ATAASGAE------RQNVEGTRL-LRSQTSTVQIRVMENKQ----PPIRVISLGRVYRPDAPDATHFPMFHQMEGLYVDTNVTMANLKTVLRIFANYLGGDEIRFRPSFFPFTEPSVEVGKWIEFGGAGMVDPNVFRAVGYDPEGFAFGLGVERLCMRRHDIKDIRDLYSGDMR........ 338
428 3.000e-71UniRef50_A8MCE3 Phenylalanyl-tRNA synthetase, alpha subunit n=1 Tax=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) T  ali  15  215.GSWRGGVFKEFDLTVEVPLRPIRRKHPFIQFLNQVRDELVAMG--FEEVKDEHVDAALWNFDTLLVPQYHPARRET-----DVFYVENPREAPGEVMERASEQHRLV-----WSYEWSRDEALRVLLRTHTTLVTIKQIYHR---GPGEYRLFSLDRVYRPDTPDATHFMEFHQLEGIIVGRGVTFRNLLGFFTELANRLRLGRVYFKPAYFPFTEPSVEGYGQLEVFPGGMFRPEVLRIVGLEYKVAAWGVGIDRLAMVVLGVDDIRTLYTNNVKIDSMKTPI 495
429 3.000e-71UniRef50_Q5F9U0 Phenylalanine--tRNA ligase alpha subunit n=2780 Tax=root TaxID=1 RepID=SYFA_NEIG1  ali  16  20............DFNALEKARYLGKTGELTGLLKTLGQMSPEIGAHINECKNRFQTNAKRDLDITLPGGSLHPVTLTLQRVVELFHGMGFEVADGPEIEDDFHFQALNIPANHPARAMQDTFYVENVLRTHTSPIQIRYMLDKK---EPPIRIIAPGRVYRVDS-DATHSPMFHQAEGLWVEEGVTFADLKAVFTDFIRRFFERDVRFRPSFFPFTEPSAEIGKWLEVGGCGMVHPNVLKNVNIDPEGFAFGIGLDRFAMLRYNVNDLRLFFDNDLN........ 323
430 3.000e-71UniRef50_A0A1F4GVD6 Phenylalanine--tRNA ligase alpha subunit n=33 Tax=Proteobacteria TaxID=1224 RepID=A0A1F4GVD6_9BURK  ali  13  93............DVSLPGRQRGQGGLHPVSLTLERIEAIFSSQG--FEVAEGPEIESDWFNFTALNTPEDHPARS-----MHDTFYVEG------------------GSAKA------------PNLLRTHTSPMQIRHAVQHALDAGLPIRVIAPGRTYRVDS-DATHSPMFHQCEGLWIGENVSFKDLKVVFTDFCRTFFESDLRFRPSFFPFTEPSAEIGRWLEVAGSGEVHPNVVRNMGLDPEGFAFGMGPDRLTMLRYGVNDLRLFFDGDIR........ 344
431 3.000e-71UniRef50_R7P9T6 Phenylalanine--tRNA ligase alpha subunit n=3 Tax=Terrabacteria group TaxID=1783272 RepID=R7P9T6_9CLOT  ali  14  95....................VPVGSLHPVTIVAKEITDILKKMG--FTVVSGPEMETEYYNFEALNVPKDHP-----ARDMQDTYY-----------------------------------LDNGTVLRTQTSDNQIHAMEN----YGAPLRICAPGRTFRNEDLDANHENTFFQIEGMVIDEDVSIENLMYIMQELLKSIFKTKVRLRPGFFPFTEPSCKNAGWIELIGCGMVHPNVLRAGGIDPDGFAFGIGLTRLAMMKYKISDIRPLNSGDIRY....... 329
432 4.000e-71UniRef50_A0A2D6ZYP5 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Rickettsiales bacterium TaxID=2026788 RepID=A0A2D6ZYP5_9RICK  ali  14  101............DVSLPALKSHEGYYHPITLTIDHLTKLFGRLG--FSVKKGPDIETDFYNFEALNIAEHHP-----ARDMHDTFYLK-------------------SGA----------------VLRTHTSPVQIRTM----LDQKPPIKIIAPGKVYRCDA-DTSHSPVFHQIEGLYVDEGVRFSDLKGILEFFLRELFGKNIRFRSSYFPFTEPSVEKTKWMEIMGAGMVNREVFRHVNYNPDGFAFGIGIERVAMIKYEIDDIRLFYEND.......... 330
433 4.000e-71UniRef50_A0A1G1X406 Phenylalanine--tRNA ligase alpha subunit n=5 Tax=unclassified Bacteria TaxID=2323 RepID=A0A1G1X406_9BACT  ali  12  105.......................GHLHPITLTIERVQNIFAAMG--FIIADGPEVEEARYNFDALNIPSDHPARG----------------EGDTFMIDPK-----------------SVSGEQDVVLRTQTSPMQIRSVETMRLT--PPFYVIAPGRVYRREKVDATHESTFYQFEGLGIGEDITIADFKGVIAAFFSTFFQKDVRLRPSYFPFVEPVCKYTGWIEVMGAGMVHPNVLKNMNIDPTGFAFGGAIDRLTMIRHGINDIRMFWSGDIR........ 343
434 4.000e-71UniRef50_A0A1A8VK39 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Plasmodium ovale curtisi TaxID=864141 RepID=A0A1A8VK39_9APIC  ali  18  266.....KYDIKKYNFFSSGKKMNKGNIHLLTRQMRAFKDIFISLG--FEEMTQNYVESSFWCFDALYIPQQHPS-----RDLQDTFFIKEPEMIDSDYIANIEKVHTYGDYGSFGWYKWKLEESKKNVLRTHTTANSCRTLFKLAKEYNKPKKYFSIDRVFRNENLDSTHLAEFHQIEGLIIDKNLGLSQLISTLSAFYKYIGIHKLKFKPTFNPYTEPSMEIKKWLEVGNSGVFRPEMLRSMGFDVSVIAWG................................. 526
435 4.000e-71UniRef50_A0A2E0SC12 Phenylalanine--tRNA ligase alpha subunit n=11 Tax=Planctomycetes TaxID=203682 RepID=A0A2E0SC12_9PLAN  ali  15  92..SERDTQFDP---SLPGTGFKIGRAHPITQTIEELKDIMGRLG--FSTADGPEIEDDWHNFVALNIPDDHPARDPLEN-----FYLAT-AEANTGEKTPV-----------------------NLLLRSQTSTVQIRVMEK----TKPPIRIISLGRVYRPDTADATHYPMFHQIEGLMIDTKVTMADLKSVLRLFATSYLGDDVRFRPSFFPFTEPSVEAGQWIEFGGAGMVDPNVLKAVGYDPEGFAFGLGVERLCMRRHGITDIREFYKNDVR........ 338
436 5.000e-71UniRef50_B2J384 Lysine--tRNA ligase n=44 Tax=cellular organisms TaxID=131567 RepID=SYK_NOSP7  ali  15  106....LKQLTDAGDILGVKGTIKRTEKGELSVYVKQYTILTKSLPDKWHGLTDVAKRYRQRYVDLIVNPEVRRRRAQITAGIRRYLEQRDFLEIETPVLQS-----EAGGADARPFITHHNTLEMELYLRIAT------ELHLKRLIVGGFEKVFELGRIFRNEGISTRHNPEFTTIEVYQAYADYN--DMMALTEGIITTVA-QEVLGTLQITYQGEPIDLTPPWRRVTM----HDLVKEFTGLDFNSF.................................... 338
437 5.000e-71UniRef50_A0A1G1E1T6 Lysine--tRNA ligase n=90 Tax=root TaxID=1 RepID=A0A1G1E1T6_9BACT  ali  14  104.......KYDIGDIIGITGKVFRTRTNELTIHAKGITLLTKSLPEKWHGLKDVEIRYRQRYVDLIVNPEVREKRTLIVQKMRDFLNNKGFLEVETPMMQSIP-----GGATAKPFKTHHNALGMDLFLRI------APELYLKRLVVGGLERVYEINRNFRNEGISTQHNPEFTMLEFYMAYADYN--DLISLTEEMFSFL-SKEVLGTSVIEYGSEKIDLTPPWKRYS----FKDSIIELGGVSPDIL.................................... 333
438 5.000e-71UniRef50_A0A2D7ZNP1 Phenylalanine--tRNA ligase alpha subunit n=3 Tax=Caulobacterales TaxID=204458 RepID=A0A2D7ZNP1_9CAUL  ali  13  93............DLSLPAPPRRRGSVHPTMQVMDEMVSIFAEMG--FSVAEGPDIETDFNNFTALNFPPKHP-----AREMHDTFFMA------------------------------ADEAGDRKVLRTHTSPVQVRVMRQINEKVPPPIRVVVPGRTYRCDS-DATHTPMFHQMEGLVIDKAVHMGHLKWTLETFISRFFETESRFRPHHFPFTEPSAEGTDWLEVVGCGMVHPNVLRNCGLDPEVFAFGFGVDRLGMLKYGMPDLRDMFAGD.......... 347
439 5.000e-71UniRef50_Q2RYT4 Phenylalanine--tRNA ligase alpha subunit n=90 Tax=root TaxID=1 RepID=SYFA_SALRD  ali  14  90............DLTLPGRCGFKGSTHPLTQTLDEILRILRGLGFSTHE--GPEVETDWHNFTALNFPPDHP-----ARDMQDTFFLEDPPEGTEP-----------------------------RVLRTHTSPGQIRIMEA----QTPPIRVAVPGRVYRNEAISYKSFCLFHQVELLYVDENVTMAQLKQVLYSLARALFGEDVRFRPSYFPFTEPSDDGGQWMEILGCGMVHPNVFESVDVDPEGYAVGMGVERMAMLRHGIDDIRIFYENDVR........ 331
440 7.000e-71UniRef50_A0A1Q6W8Q2 Lysine--tRNA ligase n=11 Tax=Candidatus Rokubacteria TaxID=1752708 RepID=A0A1Q6W8Q2_9BACT  ali  17  105.......ELDVGDFIGVTGEVFRTRTGELTVAVKSFTFLAKSLPEKWHGLKDVETRYRQRYVDLVVNPDARAIRSRVIQALRKFLDARGFLEVETPMMQPIP-----GGAIARPFKTHHNALDMDLYLRI------APELYLKRLLVGGLDRVYEINRNFRNEGVSTQHNPEFTMLEFYQAYADYT--DLMELTEELFTHLA-ESALGRLTLTWGEHEIDLRRPWTRL----PFFQGLSQALGVTVT...................................... 332
441 9.000e-71UniRef50_A0A2E8AWM2 Phenylalanine--tRNA ligase alpha subunit n=12 Tax=Planctomycetes TaxID=203682 RepID=A0A2E8AWM2_9PLAN  ali  15  99...........FDPTVPGPRPRLGHLHPITQTIEELKDIMGRLG--FSLADGPEIEDEWHNFEALNIPLSHPARDPL-----DNFYL------------------RVGE----------KTYDQALLMRSQTSTVQIRVMENTR----PPVRIISLGRVYRPDTPDATHLPMFHQIEGLLVDRQVTMADLKSVLRLFASYLGADVVRFRPSFFPFTEPSVEVDKWIEMGGAGMVDPAVLKAVGYDPDGFAFGLGIERLCARRHGIDDIREIYKNDVR........ 335
442 9.000e-71UniRef50_F9MTB7 Phenylalanine--tRNA ligase alpha subunit n=79 Tax=Bacteria TaxID=2 RepID=F9MTB7_9FIRM  ali  14  94............DISLDKKQARRGHIHPLSQTKEELEDLFVQMG--FIVYEGPEIESVANNFDALNAPMSHPSRDKT-----DTFYI-----------------------------------DDTTLLRTQTSPVQIRAM----KELGAPLRMVCSGRVFRPDDVDDTHSPMFHQLEGLVVDEKVSMANLIHTLDVFIHEMFGQDTRYRPHYFPFTEPSCHGTGWMELLGAGMVHPNVLRNCGIDPEGFAFGMGIDRIAMVKYGISDIRLLFDND.......... 333
443 9.000e-71UniRef50_A0A2D8GFU5 Phenylalanine--tRNA ligase alpha subunit n=35 Tax=root TaxID=1 RepID=A0A2D8GFU5_9ACTN  ali  15  100............DLSEKLGEIRRGSLHLNTQARDRLEDVFVGMG--FTIAEGPEVETAWYNFEALNIPEWHPARGSF-----DT------------------IFVNLGEP-------------EEVMLRSHTSPVQIRTMEN----QEPPIYIVAPGRTFRTDTADATHLPAFNQIEGLVVDRGITLGDLSGTMDEFVRAFFGVKTRLRPSYFPFTEPSDISRPWLELGGCGMVHPNVLRNCGIDPEGFAFGFGIDRLAVMRYELDDIRELVNNDVR........ 333
444 1.000e-70UniRef50_D5U5C0 Phenylalanine--tRNA ligase alpha subunit n=16 Tax=Brachyspira TaxID=29521 RepID=D5U5C0_BRAM5  ali  19  31.....................YLGRKGKITELLKSLSSIKKEFGKKINEIKNNEISDREKNKIDITMPGRRPKLTSVEEEIVSILTEIGFRVVEGNEIEDDFHFEALNIPYYHPSRDSHDSFSKENVLRTHTSGMQIRTM----LETPPPIAVVSPGKCARRDAIDSKHSPVFHQVEGIMVDSGISFNDLKGILELFCKRMFGDKIRLRPDYFPFVEPGCGGEGWLELMGAGMIHPNVFKHVGYDYTGFAFGMGIERVAMIKYGITDIRMFYENDID........ 334
445 1.000e-70UniRef50_A3PFA8 Lysine--tRNA ligase n=153 Tax=cellular organisms TaxID=131567 RepID=SYK_PROM0  ali  17  102..EDIKEIVDIGDWIGVYGTIKKTNKGELSIKVEKWEMLSKSLPDKWHGLTDIEKRYRQRYLDLIVNPHVFKTRAKCISFIRKWLDNRNFLEIETPILQS-----EAGGAEARPFITHHNTLDIPLYLRIATELHLKRM------VVGGFEKVYELGRIFRNEGISTRHNPEFTSVEIYEAYSDYV--DMMNLTEELIKDI-LADACGSLTINYQNKEIDFSKPWLRISMKDI----VKKYTGIDF....................................... 333
446 1.000e-70UniRef50_C1A492 Phenylalanine--tRNA ligase alpha subunit n=3 Tax=Gemmatimonadetes TaxID=219685 RepID=SYFA_GEMAT  ali  13  95............DATMPARGIWRGSLHPVTLVIDEISEIFRELG--FTIALGPEAETEWYNFGALNFPPDHP-----AMELHDTLY-----------------------------------LGEDTLLRTHTSPVQVRTL----QRYAPPVRVLAPGQVYRRDFFDATHAPAFMQLEGLAVDEGVSFVDLKATLAEFARRFATRRVRFGPSYFPFVEPVDLGDGWVEILGCGMVHPNVIEAAGLDYTGWAFGMGPARIAMSRYGINDIRVLYDSDVR........ 329
447 1.000e-70UniRef50_A0A1H6MC55 Phenylalanine--tRNA ligase alpha subunit n=175 Tax=Bacteria TaxID=2 RepID=A0A1H6MC55_9BACT  ali  13  146............DLTLPARSLPAGGLHPLTLVRDEAVRVLRRMG--FALAEGPEIEDEFHCFDALNTPTDHPARNE-----KDTFY-----------------------------------FDSGKLLRTHTSTVQVRAMEKQA----PPVRIISPGSAYRRDEIDATHLSAFNQIEGLYVDKDVTVGDLKGTLEYFLKALFGTDVRFRPHFFPFTEPSFEIPRWIEIAGCGMIDPAVLEAVDADYSGFAFGIGLERLAMIRWGIRDIRLLIENDVR........ 384
448 1.000e-70UniRef50_A0A1F7WHJ8 Phenylalanine--tRNA ligase alpha subunit n=4 Tax=root TaxID=1 RepID=A0A1F7WHJ8_9BACT  ali  14  122............DVTLPGKFHEIGHRHPISSTIAEIVEIFGRLG--FSVSEGPDIETDYINFDALNMFDWHP-----ARDMQDSFYA---------------------GPNA--------------VLRTHTSGVQIRTM----LKSEPPIKIVAPGRVYRLDEVDASHSPVFHQVEGLLVDKNTNFAAFKGIIASFCREFFGRKVVFRPSYFPFTEPICKNSGFLEVMGAGMVHPNVLKNGNIDPEGFAFGMGVERIAMLRYAIRDIRDFYMNDLRV....... 363
449 1.000e-70UniRef50_A0A1Q7KR81 Lysine--tRNA ligase (Fragment) n=2 Tax=Bacteria TaxID=2 RepID=A0A1Q7KR81_9BACT  ali  19  98.GFELYKLLDLGDHIGVAGYLFRTRTGELSVHVDQITFLSKDLPEKWHGLTDVELRYRQRYLDLIMNPEVREKRSKLVQSLRRSLEAHGFIEVETPMMQPI-----AGGAVARPFVTHHNTLDMNLFLRI------APELYLKRLTVGGLDRVYEINRNFRNEGLGWRWNPEFTMLEFYQAYAD--FRDVMELTQQLIEQ-AAKDVTGGMSTKWGEHEIDWVGNWQRMTMREAIIHYWPRSAGAKPQISDFG................................. 341
450 1.000e-70UniRef50_Q5GTJ5 Phenylalanine--tRNA ligase alpha subunit n=79 Tax=Anaplasmataceae TaxID=942 RepID=SYFA_WOLTR  ali  17  99............DITLPVRPEKIGRAHPLSKVMNEVKLIFAHMG--FRAVNGPDIEDEFHVFDALNTPSHHP-----AREEQDTFYLKNKIN------------------------------DKRMMLRTHTSSMQIRAM---KKAKTFPIKIVAAGRVYRND-FDATHTPMFHQMEGLYVNENVNMGQLKFTIHHFLNKFFGDKIRFRNSFFPFTEPSAEVDKWIEVLGCGIVHPNVFQNVGIDYSGFAFGIGIERLAMLKYQISDLRNFYDNKI......... 333
451 1.000e-70UniRef50_A0A2V9TWA2 Phenylalanine--tRNA ligase subunit alpha n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V9TWA2_9BACT  ali  11  122............DITLPGNRRPLGAEHPVIKTMNEIVSVFRNLGYSVEE--GPIIETDYYNFEALNFPPNHP-----ARDTQDTLFVAN--------------------QESKPLRD-------RLLLRTHTSPVQIRTMEK----IKPPLRIVIPGKVHRNDPPDASHSPMFHQIEGLAVDTNITLGDLKGTLDHAMKALFGSSVKFRPSFFPFTEPSCKQTGWIEILGCGMVDPNVFEFVGYDPSGFAFGMGADRIAILKYGVDDIQLFFQGDVR........ 379
452 1.000e-70UniRef50_A0A1V4IS78 Phenylalanine--tRNA ligase alpha subunit n=10 Tax=root TaxID=1 RepID=A0A1V4IS78_9CLOT  ali  17  32.....................FLGKKGELTNILKSLSKYSIDEREKVEELKDKFEKSDLKSFDITLPASDFHPITIVQREIEEIFKGMGFMIADTDEVETDYYFEALNIPKYHPARDMQDWLENGMVLRSQTSAGQQHIMH----EYKPPIRAIIPGRCFRNEDIDASHENTFYQLEGIVIDKDISVANLMYTMEIMLSEVFGRKVRLRPGYFPFVEPGCKHSGWLELLPCGMIHPNVLKYGGIDYTGFAFGLGLTRLAMMKYGIPDIRVFNSGNLKI....... 330
453 1.000e-70UniRef50_A0A2D8PPV1 Phenylalanine--tRNA ligase alpha subunit n=5 Tax=Bacteria TaxID=2 RepID=A0A2D8PPV1_9PROT  ali  11  2..............TLPVRPESQGRIHPISQTIDEMVAIFCEMG--FTVAEGPHIESDFNNFTALNIPPEHPARQD-----HDTFYL--------------------------PA----DENGERKVLRTHTSPVQIRTMITE----KPPIRIVVPGRTFRADH-DATHSPMFHQIEGLVIDEETHMGHLKGCLIEFCRAFFDVDVRFRPSYFPFTEPSAEVDDWLEILGCGMVNPHVLKNCGIDYQGFAFGLGIERAAMLKYGIPDLRTFYDSDIR........ 249
454 1.000e-70UniRef50_UPI0001593A77 Pyrrolysyl-tRNA synthetase n=10 Tax=Methanosarcina mazei TaxID=2209 RepID=UPI0001593A77  ali  99  14.......LVPRGSHMASAPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL 291
455 2.000e-70UniRef50_A2BTK0 Lysine--tRNA ligase n=18 Tax=Prochloraceae TaxID=1213 RepID=A2BTK0_PROMS  ali  16  87..EDLKEIVDIGDWIGVYGTIKKTNKGELSIKVEKWEMLSKSLPDKWHGLTDIEKRYRQRYLDLIVNPHVFKTRAKCISFIRKWLDNRNFLEIETPILQS-----EAGGAEARPFITHHNTLDIPLYLRIATELHLKRM------VVGGFEKVYELGRIFRNEGISTRHNPEFTSVEIYEAYSDYV--DMMNLTEELIKDI-VADACGSLIINYQNKEIDFSKPWSRISMKAI----VKKYTGIDFDSF.................................... 321
456 2.000e-70UniRef50_A0A1Z8PI36 Phenylalanine--tRNA ligase alpha subunit n=7 Tax=Bacteria TaxID=2 RepID=A0A1Z8PI36_9BACT  ali  12  90............DPTEPGLPPARGRRHPISTTVDAILDVFGRMG--FEVAHGPEVEDEWHNFNALNIPADHPARDPV-----DNFY--------------------MGGSQD----------DVTRLLRTQTSTVQIRTMEAH----KPPLRIVAAGRVYRPDTHDATHYSMFHQVEGLCIDEGVSMVDLKTSLMQFARAMFGPEARMRPSFFPFTEPSAEKTQWMEIGGCGMVDPAVLEAVGIDPEGFAFGLGVERIAMRRYGIADIRWMYEND.......... 325
457 2.000e-70UniRef50_D6TJB3 Lysine--tRNA ligase n=1 Tax=Ktedonobacter racemifer DSM 44963 TaxID=485913 RepID=D6TJB3_9CHLR  ali  19  94LGEESYKLLDLGDFIEARGFLFVTRTGERTLHVKGWRVIGKGLPEKYHGLEDKELRQRKRYLDLIANGEVFETRSRVISAMRRFLEGQGYLEFETPILQPL-----YGGATARPFITHHNTLDRDLYLRIAI------ELYLKRLIVGGFERVYEIGRNFRNEGIDRSHNPEFTMMECYQAYADYN--DMMKLVEEMIAYIA-QEVKGTTRVTYQGTEIDLTPPWPRIPLLEAIH----KYTGIDINAL.................................... 334
458 3.000e-70UniRef50_A0A0G1TVC9 Phenylalanine--tRNA ligase alpha subunit n=28 Tax=unclassified Bacteria TaxID=2323 RepID=A0A0G1TVC9_9BACT  ali  15  37...ELDAIFRKY----------LGKSGELTHFLRSLKDLLKELLAAFSEKSGQEMENSEW-FDITVPGQKRHPLTLVRRQASEIFQQMGFSIALGPEIENEWYFDALNIPKDHPARDIWDTLNKKLLLRTHTSPVQIRHMEKE----NPPLRIIAPGRVFRHEATDASHEVNFYQIEGLMVDKDISVANFKAIIQEFFRRFAGAEIRLRPSYFPFVEPGFEVDGWLEIMGAGMVHPRVLEAVKLDWTGFAFGMGLDRLAMMKYKINDIRLFYGGDLR........ 362
459 3.000e-70UniRef50_A0A2G9YL91 Lysine--tRNA ligase n=2 Tax=unclassified Candidatus Omnitrophica TaxID=1047005 RepID=A0A2G9YL91_9BACT  ali  19  85VGEEKFNTLDIADIISVKGELFKTHAGELTVKAEDFVVLAKALPEKWHGLKDVELRYRQRYLDLIANEEVFLMRSRIIRTIRNFLDDKGFLEVETPMMHPIP-----GGAAGRPFKTHHNEYDSDLYLRI------APELYLKQLLVGGLDKVYEINRSFRNEGVSTKHNPEFTMLEVYRAYANY--EDMMQLAEELIIYVA-KEVLGDLSFLYQGKTVELSPPWQRRSFA----ELVKEKFGIEPDD-------EAPVMLK....................... 330
460 3.000e-70UniRef50_H6Q5P5 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Wigglesworthia glossinidia endosymbiont of Glossina morsitans morsitans (Yale colony  ali  13  96.........DKIDVSLPGKKSELGTLHPISKIILYAENFFQSLG--FSIILGNEIESSFYNFDALNVPKNHPSRTK-----KDTFWI-----------------------------------DKNCLLRTQTSSVQIRVM----QSQNPPLKIISSGRVYRNDH-DKTHTPMFHQMEGLIIDYDVNLSNLKSILYNFCYYLLGEKIRFRPTYFPFTQPSAEIGKWIEILGCGLVHPNVLNNINIKYSGLAFGIGIERLAMLYYRLSDVRLLFMNNL......... 326
461 3.000e-70UniRef50_A0A0G1D9M0 Phenylalanine--tRNA ligase alpha subunit n=3 Tax=Parcubacteria group TaxID=1794811 RepID=A0A0G1D9M0_9BACT  ali  11  85..........RIDMSLPGRIPERGHEHPLYQVMDQVISVFLGMG--FDVVEGPEIELGYYNFSALNIPKDHP-----ARDMWDTFYVR------------------------------HGKEEESVVLRTHTSPVQIRAMEHR----TPPVRLIVPGRVFRHEATDATHGSNFFQLEGLVIDKGIRVTDLMGCLSAAMKGLYGKDIRLRPSYFPFVEPVCKRTGWVEMLGAGMVHPVVLKNMKVDYSGFAFGMGIDRMMMLAYGIPDIRLGYSGDV--EFVR... 348
462 4.000e-70UniRef50_A0A2H0T7E9 Lysine--tRNA ligase n=6 Tax=Parcubacteria group TaxID=1794811 RepID=A0A2H0T7E9_9BACT  ali  17  101.......NLDMGDFIETRGTLFLTHKGEKTLNANNIRLLSKALPEKWHGLSDTEIRFRQRYLDMLANPSVRHTRSIIIKAIRSFLDDKGFLEVDTPILQPL-----AGGATAKPFKTHHNALDIDLYLR------VAPELYLKRLLVGGFEKVYEVSRCFRNEGIDHSHNPEFTQVEFYWAYSDY--EQLMKMTEKFLEYIALRATRQSLQFEFDGKKFSLKAPYKRIT----FREAILKTAKIDID...................................... 336
463 4.000e-70UniRef50_A0A2E5DID6 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2E5DID6_9CHLR  ali  15  82..EEKSKSIKNFDYSLPSVSLGSGSIHPTNQMMEEICSAFSKLG--FNIFEGPEIESEAYAFDKLNIPTDHP-----ARDIWDTIYVNDVKEIH------------------------------SLVLRPHTSPMQIRIMENN----KPPIRVVIPGKCYRYEATDNTHEWHFHQIEGLVIDKNINFANMKSTLFEFARIIFGEDTRFRCDFFPFVEPGAEMSEWLELMGAGMVHPKVLTNVGIDPNGFAFGLGIERAAMIKYGIENIRDFYAND.......... 332
464 4.000e-70UniRef50_A9GN91 Phenylalanine--tRNA ligase alpha subunit n=10 Tax=Bacteria TaxID=2 RepID=SYFA_SORC5  ali  13  99............DITLPGRWRAPGRPHPIMRTLDEIVDIFVGLG--FDVAEGPQIELARYNFDLLGFPADHP-----AMDMHDTFYMAG-----------------------DPG--------QNVLLRTHTSPVQVREMLSH----PPPVMIVAPGVVYRRDD-DASHSPMFVQIEGLVVDRDVSLADLKGLLEVYSRRMFGERTRFRPSYFPFTEPSCKGTGWLEVLGCGMVHPTVLRNVGIDPEGLAFGIGVDRTANMKFAVDDIRAFYENDVR........ 344
465 4.000e-70UniRef50_A0A109W7F1 Phenylalanine--tRNA ligase alpha subunit n=3 Tax=Bacteria TaxID=2 RepID=A0A109W7F1_9FUSO  ali  13  94............DITLPGRVANIGSLHPITKTVMEIKDIVSEMG--FDIVDGPEVEFVKYNFDDLNIPKTHPS-----RELTDTFYIKD-----------------------------------DVVLRTQTSGMQIRYMKDKV----PPFRMISVGKVYRPD-YDVSHTPMFHQVEGLMVGEDVSFANFKAVLENIVKKIFGKDVRFRPHFFPFTEPSCKGTGWLEILGSGMVNSKVLENAGIDYQGFAFGLGLERITMLKYGIDDLRAFFEND.......... 331
466 4.000e-70UniRef50_A0A2E3CLQ8 Phenylalanine--tRNA ligase alpha subunit n=22 Tax=Bacteria TaxID=2 RepID=A0A2E3CLQ8_9ACTN  ali  12  106......................RGHLHLVTQTMERLEDVFVGMG--FTVSEGPQAETDWYNFEALNLPAAHPARS-----MFDTLYL--------------DLGDRTEIGDGEGG------EATNILLRTHTSPVQVRVME----STAPPIYTVCPGRVFRRDTADASHMPVFHQIEGLVVDRGISLADLAGTLNEFTAAYFGGAIRLRPSYFPFTEPSAEFTGWIELGGCGMVHPNVLANCGVDWTGFAFGFGIDRLALMRYGIKDLRDMYTNDVR........ 351
467 4.000e-70UniRef50_A0A1G1JTC9 Phenylalanine--tRNA ligase alpha subunit n=2 Tax=unclassified Candidatus Omnitrophica TaxID=1047005 RepID=A0A1G1JTC9_9BACT  ali  13  79LGASGAVYTKEIDTTMPGTYPAAGSLHPLTLVVQEVTSIFERLG--FRAVDWFEAEDERHNFDALNIPTDHP-----ARDSFDNFYLDDPVDGE------------------------------RNLLRSQTSTVQIRFMWVKETKRRPPFKIIAPGKVYRPDATDATHSFMFHQIEGLYVDEDVSFAHLKGVLERFAKEFFGPETQFRPHFFPFTEPSAESRGWLEILGAGMVHPRVLRAVNIDPSGFAFGMGVERMAMLKYGVKDIRQFFENDIR........ 330
468 4.000e-70UniRef50_A0A086YJM7 Lysine--tRNA ligase (Fragment) n=7 Tax=root TaxID=1 RepID=A0A086YJM7_9FIRM  ali  18  94VGAESYQIFDIGDIIGAEGNLFKTRSGEVTVAVEKFTLLAKSLPEKWHGLRDIELRYRQRYLDLLVNPEVFVLRSKIIQTMRKFLEQRGFLEVETPMMHLIP-----GGANARPFTTHHNALDLDLYLRI------APELYLKRLIIGGLEKIYEINRNFRNEGISTKHNPEFTMLELYQAYADY--HDMLKITEELIYTV-TQEVLGASDVIYEDVTLNLAPPYKKISML----EAVKQYTGIDFSGL.................................... 333
469 4.000e-70UniRef50_V4JS31 Phenylalanyl-tRNA synthetase alpha subunit n=1 Tax=uncultured Acidilobus sp. CIS TaxID=1410574 RepID=V4JS31_9CREN  ali  19  1.......................................MVELG--FVEVEGPLIEVELFNFDALFQPQDHP-----AREIQDTLW---PDLPPSDISVYGGLVERVKETHEKGWYPWNNEIASRRILRSQTTAVSIRVLSGR---PKPPIRFFTIDKVFRADPVDATHLSDFHQLDGIMGWPGYSFRDLLGFLTQFARKLGL-NIKFKPAYFPFTEPSVEGDSLVEVFGAGLFRPEVLRIAGVDYPVGAWGMGVERLALAKYGLKDVRDLYSKD.......... 228
470 4.000e-70UniRef50_A0A2J4UTD5 Lysine--tRNA ligase (Fragment) n=2 Tax=Bacteria TaxID=2 RepID=A0A2J4UTD5_9ENTR  ali  17  22...EQFKKWDLGDIIAARGKLFKTQTGELSIHCTELRLLTKALPDKFHGLQDQEARYRQRYLDLISNEESRHVRSQILATMRQFMVARGFMEVETPMMQVIP-----GGATARPFITHHNALDLDMYLRI------APELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADY--KDLIELTESLFRTLA-QNVLGKTEVPYGDQVFDFGKPFEKLTM----REAIKKY............................................ 247
471 5.000e-70UniRef50_A0A2A4T5E9 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=SAR324 cluster bacterium TaxID=2024889 RepID=A0A2A4T5E9_9DELT  ali  13  94............DITLDPLQTHAGSLHPVSLVQQRLERIFESMG--FQVLDGPHIETEHYNFEALNVPAHHP-----ARDMQDTFY-----------------------------------FEDGHLLRTQTSTIQIHGMENL----EPPIRIIGPGKVFRCERTDASHDSCFHQLEGMMIDKDISVSHLIHFMRTMLGEIFESKVRLRPGYFPFVEPVCKKVGWIELLGCGMVHPNVLRAGNIDPSGFAFGMGLDRLAMMKYGITDIRPLHGGNLN........ 334
472 5.000e-70UniRef50_Q4ULS5 Phenylalanine--tRNA ligase alpha subunit n=87 Tax=root TaxID=1 RepID=SYFA_RICFE  ali  13  90.........DKIDLTIPARRYKQGSIHPITQCSEELIQVFSQFG--FTIENGPNIENDFHNFTSLNFEDDHP-----ARQMHDTFYLKG------------------------------QENNKPLLLRTHTSTVQIRAM----KNGKPPFRFIAPGRTYRSDS-DMTHTPMFHQIEGLVIDKNINMGHLKYVITEFIKSFFENELRFRPSFFPFTEPSNKNDKWLEVLGCGMVHPNVLKNVGIDYQGFAFGLGVERFAMLKYNIKDLRQFFEGDMR........ 328
473 5.000e-70UniRef50_A0A1W6BH74 Phenylalanine--tRNA ligase alpha subunit n=8 Tax=Bacteria TaxID=2 RepID=A0A1W6BH74_9PROT  ali  12  93............DVTLPERDFKQGKIHPVSQVIDEISSIFSEIG--FSVEEGPDVENEYNNFTALNTPDNHP-----ARDMHDTFYL---------------------------------DEKKELLLRTHTSPVQVRTM----LKGKPPFKIIAPGRTYRSDS-DQTHAPMFHQVEGLHIDKDINMGHLKGCLNYFIKEFFEVKMRFRPSHFPFTEPSAEGDKWLEILGCGMVHPNVLKNVNVDPSGYAFGIGIDRLGMLKYGINDLRAFFETD.......... 332
474 5.000e-70UniRef50_A0A1Q3MUV3 Phenylalanine--tRNA ligase alpha subunit n=1 Tax=Alphaproteobacteria bacterium 40-19 TaxID=1895705 RepID=A0A1Q3MUV3_9PROT  ali  16  85..SWQEKLAQSIDVTLPAPYAPWGQMHPLTVVLKRAVEILVGMGFCVH--TGPDVETPFHNFDALNVPLTHPARAPG-----DTFYIKG------------------------------------NLLRTHTSSVQIRVLQEK----EPPLRVISFGSTYRRDECDATHTPMFHQMEMMVVEGGATMAHLKGCLFEFLSLFFQREMRLRPSFFPFTEPSAEVGKWLELLGCGMIHPRVFTQCGENLSGYAFGMGLERLAMLKYELSDIRDFYNND.......... 320
475 5.000e-70UniRef50_T0Z1H8 Phenylalanyl-tRNA synthetase, alpha subunit (Fragment) n=2 Tax=mine drainage metagenome TaxID=410659 RepID=T0Z1H8_9ZZZZ  ali  15  9........................RPHPYAAWLEEFEEILVGLG--FQQSEGPLLETEFWNADVLFMPQDHPARS-----IHDALSVEGAPEIPPPEPERVAAAHELPGHTGSLSRGWSDRYDRRPVLRSQTTAVSARFLAAGPR---PPFRMFSIDRNFRREEVDARHHLEFTQCEGVLGEEDVSIRHVVGMFRELADAIGVRELKLRPSYFPFTEPSIEGYGWIEVFPGGLLRPEVLVPLGVETPVAAWGIGIARLAMVALGINDIRELYDDDYDLRGGR... 272
476 5.000e-70UniRef50_A0A0S7XDT4 Lysine--tRNA ligase n=1 Tax=Latescibacteria bacterium DG_63 TaxID=1703781 RepID=A0A0S7XDT4_9BACT  ali  17  94..YELLAMVDVGDIIGVSGPVFKTKTGEITVKVEAFQLLSKSLPEKWHGLRDVETRYRQRYVDLIVNAEVRETRSRIIKTMRNFLDERGFIEVETPVLQPL-----YGGAFARPFVTRHEALDMDLYLRI------ADELYLKRLIVGGLERVYEIGKDFRNEGIDRTHNPEFTQLELYQAYADY--MDMMELFEEMVCEV-VTELFGELKCVYGEHQLDFSRRWKRFGYF----EALKQHLGVDLQGA.................................... 328
477 6.000e-70