current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: PF00244.20; G1K9B0_ANOCA/9-229; 14-3-3 protein, from PfamA32U

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220
# Score Template Links and tools%idFirst KAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDGNDKKMQLVKDYREKVESELKSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVASGDDRKQTIENSQAAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTLast
1 -92.100[O] KOG0841 Multifunctional chaperone (14-3-3 family)  ali follow..  81  10.AKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWT 229
2 -89.700[T] COG5040 14-3-3 family protein  ali follow..  65  12.AKLAEQAERYEEMVENMKTVASSGQELSVEERNLLSVAYKNVIGARRASWRIVSSIEQKEESKEHQVELICSYRSKIETELTKISDDILSVLDSHLIPSATTGESKVFYYKMKGDYHRYLAEFSSGDAREKATNASLEAYKTASEIATTELPPTHPIRLGLALNFSVFYYEIQNSPDKACHLAKQAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWT 234
3 -7.670[A] KOG2162 Nonsense-mediated mRNA decay protein  ali follow..  10  12.PNFLVEVNNIEKQLWTLIHSKTILHTDVSELYAKAGSTYEQIFEVEFCLWKLHHIDEFRKGLKTNDHAKHMKAFKLFLSKAAEFYQNLISKVRGYYHRLSEESGEQKSRFLCHGDLQRYQEQYLKAHEHPNW-STAATYYLEAAKSWPDSGNPHN--QLAVLATYALYHC-------RSL-AVKEPFPGASNNLLLLFEKNRSSPLQSLS.......... 235
4 -7.570[S] KOG3060 Uncharacterized conserved protein  ali follow..  12  91KAMRYEALEQYDEADEVLDAIIAKDETNAAPRKRKIAILKA--RGRRLEAIKELNEYLKKFMSDQEAWHELCNMYLAEGE------GKAAFCMEEVLLHNPHSHL-----------IHQRLAEIRYTMGGVENMESARTYYSQALKLNPHNLRALY---IYLCCNHLDNSRAVSSKRKELQKLSQWALEQLLTKQTIVPLEAAFGNLEI............ 279
5 -7.550[Z] KOG1840 Kinesin light chain  ali follow..  16  366.GDSYLSLSRFDEAICAYQKSLTALKTAKGENHPAVGSVYIRLADLYNRTGKVREAKSYCENALRIYESHNEISPEEIASGLTDISEQAITLLQKAL-DSPGQKIMIAGIEAQMGVLYYMMGKYMESYNTFKSAEEAVELFEEAKCILEQECGPYHPETLGLYSNLAG-AYDAIGRLDDAIKLLGHVVGVREEKLGTANPVTEDEKRRLAQLLKE...... 623
6 -6.980[R] KOG1129 TPR repeat-containing protein  ali follow..  11  243.ARVQEALGEYDESVKLYKRVLDAESNYYGGKPELAMRYYRRILQMGVSSPELFLNIGLCCMAAQQFDFALSSILRAQSTMTDDVAADVWYNIGQILVDIGDLVSAARSFLSHDPDHSESLVNLGILKHREGKIDEARSLYSSATSK--------NPYMFEGNYNLGLVSFT-QGKYHECRELIEKALA----------FPEHEHCKKILNHLKP...... 453
7 -6.440[DO] KOG4322 Anaphase-promoting complex (APC), subunit 5  ali follow..  11  547KAVVLQAQNQMSEAHKLLQKLLVHCQKLKNTEMVISVLLSVAELSSPTIALPMLLQALALSKEYRLQYLASETVLNLAFAQLIL--EQALSLLHMAIILADGAILDKGRAMFLVAKCQVASAASYDQPKKAEALEAAIENLNEAKNYFAK-----CKERIRDVVYFQARLYHTLGKTQER--------NRCAMLFRQLHQELPSHGVPLINHL........ 755
8 -6.380[N] COG5442 Flagellar biosynthesis regulator FlaF  ali follow..  12  1...................................................................................................................................................................MYQFSYAEIMEDGVANAKDRERQALTKSIDLLVEARDSS--SQRHSIEALFYTRRVWI 56
9 -6.290[V] COG3725 Membrane protein required for beta-lactamase induction  ali follow..  10  61...........................LQGVLFNVPTLLVWLLIGKVRLHYHAYLTAASRNDSHARATMAGELTMIHGVPAGCDEREYLRELQNALLWINFRFYLAPLFWLIVGG-TLMGYAFLRAWQYWLARYQTPHHRLQSGIDAVLHVLDPVRLAGVVYALALPAWFASLGDFRTSQYQVLTRLAQFSLAR--EPHVDKVETPKAAVSMAKKTSFVV. 270
10 -6.150[BD] KOG4563 Cell cycle-regulated histone H1-binding protein  ali follow..  10  487......................................................NDKTEEMPNDSVLENKSLQENEEEEIGNLELAWDMLD-LAKIIFKRQETKEAQL-----AAQAHLKLGEVSVESEN----VQAVEEFQSCLNLQEQYLEAHD-YQLGLAYGYNSQYDEAVAQFSKSIEVIENRMAVLNEQVKEAEKKEIEELKELLPEIREKIE... 654

FFAS is supported by the NIH grant R01-GM087218-01
1 3 5 1 4 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Tolerating some redundancy significantly speeds up clustering of large protein databases. Bioinformatics. 2002 Jan;18(1):77-82.