current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: PF02826.19; Q98GE4_RHILO/107-283; D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain, from PfamA32U

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .
# Score Template Links and tools%idFirst MFTALALLRQFRRVDRDLRAKGWLAGREHANANIELAGKTIGIVGLGAVGQAVGHIAAHGFDLKVVATTRSMQPAPEKVGFLSIDALVEQSDIIVLCCPLTPETRGLISRERIARMKPNALLINVSRGPVVDDDALIEALREGRIGGAALDVFSTQPLSYNHPYFGFDNVIITPHMALast
1 -67.100[CHR] COG1052 Lactate dehydrogenase and related dehydrogenases  ali follow..  31  111LAAALQLTRHAREIETFVRKRDFR---QKPILSKELRCSRVGILGTGRIGQAAARL-FKGVGAQVVGFDPYPNDAKEWLTYVSMDELLSTSDVISLHMPATKDSHHLINAKTIAQMKDGVYLVNTARGAVIDSQALLDSLDKGKIAGAALDAYEFEGPTVYARLVAHERIIYTPHIA 298
2 -65.900[HE] COG0111 Phosphoglycerate dehydrogenase and related dehydrogenases  ali follow..  34  133LAMMMALARHIPDANKSVKESKWERKQ---FIGTEVYKKTLGVVGLGKIGSHVAG-VAKAMGMKLLAYDPFISQEQIGCTLVDLDLLFSEADFITLHIPKTPETANLINAETLAKMKPTARIINCSRGGIIDEEALVTAIETAQIGGAALDVFAQEP-LGESRLREFSNVILTPHLG 307
3 -65.900[K] KOG0067 Transcription factor CtBP  ali follow..  35  139ICHILNLYRRNTWLYQALREGTRVQSREVASGAARIRGETLGLIGFGRTGQAVAV-RAKAFGFSVIFYDPYLQDGIERSRVYTLQDLLYQSDCVSLHCNLNEHNHHLINDFTIKQMRQGAFLVNAARGGLVDEKALAQALKEGRIRGAALDVHESEPFSAQGPLKDAPNLICTPHTA 323
4 -65.100[C] KOG0069 Glyoxylate/hydroxypyruvate reductase (D-isomer-specific 2-hydroxy acid dehydrogenase superfamily)  ali follow..  32  386VGLLIAAARRFQEGRRKIDSDKWDKDHLNWMLGQDIRDSTVGFYGFGGIGQAVAK-RLMGFDIKRMLYTTRNREERFNAKKVDFETLLAESDFLIIASPLTKETLGLFNATVFNKMKETAVLVNVGRGKIVNQDDLYEALKSNRIFAAGLDVMDPEPLPSNDKLLTLDNVVVTPHVG 566
5 -65.000[E] KOG0068 D-3-phosphoglycerate dehydrogenase, D-isomer-specific 2-hydroxy acid dehydrogenase superfamily  ali follow..  31  187IALLASMARNVAQADASIKAGKWERSK---YVGVSLVGKTLAVMGFGKVGTEVAR-RAKGLGMTVISHDPYAPADALGVDLVSFDQAISTADFVSLHMPLTPATKKVFNDETFSKMKKGVRLINVARGGVIDEDALVRALDAGIVAQAALDVFCEEPPSKDSRLIQHENVTVTPHLG 362
6 -12.300[H] COG0499 S-adenosylhomocysteine hydrolase  ali follow..  24  253................................DMLMGGKNVLVCGYGDVGKGCAE-AFDGQGARVKVTENALQALMDGYSVVTVDEAIEDADIVITAT----GNKDIISFEQMLKMKDHALLGNIGHFDNIDMHSLLHR...................................... 359
7 -12.200[H] KOG1370 S-adenosylhomocysteine hydrolase  ali follow..  20  188...............................TDVMIAGKVAVVAGYGDKGKSCAQ-ALRGFRASVIITKKALQAAMEGYEVTTMDEACQEGDVFVTTT----GCVDIILGQHFEQTKDDTIVCNTGYFDVMDVKWLNKNTVEKVNVKLQVDPYR....................... 310
8 -11.600[EH] COG0059 Ketol-acid reductoisomerase  ali follow..  19  35...................................LKGKKIVIVGCGAQGLNQGLMRDSGLDISYALRPEAIAEKRAGFKVGTYEELIPTADLVVNLTP--DKQHSKVVADVMPLMKKDSAFGYSHGFNIVAPKCPGTEVREEYKRGFGVPTL........................ 174
9 -11.500[E] KOG2380 Prephenate dehydrogenase (NADP+)  ali follow..  22  365......................................LKIGIVGFGNFGQFLGK-TMVKQGHTVLAYSRSDYTDEAAKLGVS-DLFEEHPEVIILCTSIL-STEKVLESLPFQRLKRSTLFVDVLSVKEFPRNLFLQTLPQD------FDILCTHPM-NNLAFVFDKVRIGMD... 506
10 -11.400[G] COG1023 Predicted 6-phosphogluconate dehydrogenase  ali follow..  15  3........................................LGMIGLGRMGANIVRRLAKG-GHDCVVYDHDPDAVKAMAGLRELSQRLSAPRVVWVMVPAGNITTAVIEE--ANTLEAGDIVIDGGNTYYRDDLRHEKLLFKKGIHLLDCGT......................... 121
11 -11.100[R] COG4007 Predicted dehydrogenase related to H2-forming N5,N10-methylenetetrahydromethanopterin dehydrogenase  ali follow..  14  18.................................VDQLNLPEKYGGEAPYGGSRMAIEFAEAGHDVVLAEPARDMLDDAHWTDNDAEAASEAEIAVLFTPFGKKTFEIA-KNITNHLPEGAVIANTCTVSPVVLYYVLEREL--RRDRKDLGIASMHPA................... 149
12 -10.400[E] COG0287 Prephenate dehydrogenase  ali follow..  19  8......................................ERIALIGIGLIGSSIARVRELGLARHVVISTRSEDTLKRAEELVSAAEAVKDADLVIVSVPVGASESVA--QQIAPYLKPSAIVTDVGKASVIAQMAPHMPENVHFIPGHPLAGTEKSGPDAGFALFRERWCIFTP... 152
13 -10.200[I] COG2084 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases  ali follow..  18  2......................................ETIGFIGLGIMGAPMAGHLLDA-GYKVIASDHRSKPLADLVAKSGHAAVAKAADIIITMVPDTPQVADVLFGDNASGLTRGKLVIDMSSISPIETKVFAGKINELGCDYLDAPVSGGEVGAKAASLTIM.......... 136
14 -10.000[G] KOG2653 6-phosphogluconate dehydrogenase  ali follow..  16  3......................................ADFGLIGLAVMGQNLILNAADH-GFTVCAYNRTQSKVDHFLAATSIEDFISKLKRPRKVMLLVKAGAPVDALINVPLLEKGDIIIDGGNSHFPDSNRRYEELKKKGILFVGSGV......................... 127
15 -9.640[R] COG2085 Predicted dinucleotide-binding enzymes  ali follow..  18  6......................................PSIAILGAGRVGSSLARSAVAA-GYEVKVAGSGAVDKIAGAVPSTADQAVKDADIVFLAVPLHK-------RSVNPATLEGKIVIDTMNHWVPVNGELEEIDQDPRSTSEII........................... 118
16 -9.580[G] COG0362 6-phosphogluconate dehydrogenase  ali follow..  18  5......................................GDIGVIGLAVMGQNLILNMNDH-GFKVVAYNRTTSKVDEFLQAYSLEDLAAKLEKPRKVMLMVRAGDVVD-EALLPHLEEGDIIIDGGNSNYPDTNRRVKALAEKGIRFIGSGV......................... 129
17 -9.520[R] COG1712 Predicted dinucleotide-utilizing enzyme  ali follow..  16  3.......................................KIGIVGCGFIGGQICRAIDGG-SAELYALCDSSESKALELAYMKIEELIRGVDLIIESAS-----QNAVRFIVPQALKAGCDVMILSVGALADEELRDTLFGLAKEHNCKLYF......................... 120
18 -9.130[S] COG5495 Uncharacterized conserved protein  ali follow..  12  13.......................................NIAILSTGRVGVALERAVVVACSAVSHASRQWVQFRLPETSVASPPEVASSAELLLLAVPDCEFAGLMSGVAVTSVPRPGTIVAHTS--WANGVGILAQLGKDGCIPLAIHPAMMFSGSDEDLSQCQLRDTYFG.... 146

FFAS is supported by the NIH grant R01-GM087218-01
1 3 5 0 8 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Pio F, Chu Z, Reed JC, Godzik A. PAAD - a new protein domain associated with apoptosis, cancer and autoimmune diseases. Trends Biochem Sci. 2001 Feb;26(2):85-7.