current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: PF04029.14; H1YDD2_9SPHI/8-231; 2-phosphosulpholactate phosphatase, from PfamA32U

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220
# Score Template Links and tools%idFirst LTPALLPLFNIEGSIVVVIDIFRATSSICYGIENGAEAIIPVAEVAECAAYREKGLDYLLAAERDGKVVDGFDFGNSPFSYTAEKVSGKTVVLTTTNGTHALHMSIKAKRIVIGSFLNLTSLCNWLKQQPENILLVCAGWKNNFNLEDTLFAGAVAEQLKADAYKWDDATIAANDLYQLAQHDLNVYLKKSSHGERMKQLGIMEDIDFCLNVDITTAIPVLEGELast
1 -79.900[HR] COG2045 Phosphosulfolactate phosphohydrolase and related enzymes  ali follow..  30  13.......PKDQVPDCAIAVDVLRATSTIATVLSAGGEAVQVFSDLDELIAVSEAWPKRLRAGERGGGKVTGFELGNSPLDCTPELVEGRRLFISTTNGTRALKRVQDSATVLTAAFINRAAVVQYLLEKQPEVWIVGSGWEGSYSLEDTACAGAIAHSVVEKSQAGNDEVISAIALYSQWQNNLLGLFHHASHGKRLLRLECYEDLKYCSQTDVLTVLPIQQEA 238
2 -6.720[TK] COG4567 Response regulator consisting of a CheY-like receiver domain and a Fis-type HTH domain  ali follow..  4LKQEDTEAIGNDPTLLLVDDDKPFLQRLARAMESRGFQVTTAESVEEGIAAVKTSAPAYAVVDMRLGDGNGLNI----IEAIRSRRADTRAIVLTGYGNTAVNAVKLGAIDYLSKPADADEVFAALTR................................................................................................ 129
3 -6.170[H] COG4547 Cobalamin biosynthesis protein CobT (nicotinate-mononucleotide:5, 6-dimethylbenzimidazole phosphoribosyltransferase)  ali follow..  412......DTKFRDTVVSLVIDNITVAATCADILARTLERSIIYKSADAPWRRARRNLGLMMREGLLKENIDGEALMWAHNRLIGRP-EQRKIMMMISDGAPVDDSTLSVNPGNYLERHLRAVIEQIETRSPVELLAIGIGHD--------------VTRYYRRAVTIVDADELAGAMTEQLAALFEDTSGTSGSSRRIRRAG....................... 639
4 -5.680[H] COG0352 Thiamine monophosphate synthase  ali follow..  13  1MYQPDFPTVPFRLGLYPVVD---SVEWIERLLESGVRTI--EADVIAAIALGRRYNARLFINDY-KHRAYGVHLGQEETTDLKAIQAAGLRLGVSTHDDMEIDVALKPSYIALGHVFPTQT-LASHIERLADYPTVAIGGISLERAPAVLATGVGSIAVVSAITQAADWREATAELLAIAGV.......................................... 208
5 -5.640[O] COG5206 Glycosylphosphatidylinositol transamidase (GPIT), subunit GPI8  ali follow..  10  13LLQIIAAESSHTNNWAVLINVLGIYRSV----RLGISQIILMIADDYACNSRNLFPGTVLTERVPENTPASKRLLTNE--------RSNILIYMTGHGGDGFIKFQDAEELSSEDLADAIEQIHQHKRYNEILFMV-----------DTCQANSLYTKIYSPNVLAIGSSEVGTSSYSHHADI......................................... 220
6 -5.560[R] KOG2695 WD40 repeat protein  ali follow..  10  301....................FSTGLSRRVLLTNVVTGHRQSFGTNSDVLAQQALMAPLLFNGCRSG-EIFAIDL-DSAVTSVRILQDEQYLMASDMAGKIKLWDLRTTKCVRYEGHVNEYAYLPLHVHEEEGI-LVAVGQDCYTRIWS-LHDARLLRTIPSPYPASKADIPSVAFSSRLGGSRGAPGLLMAVGQD............................. 489
7 -5.360[F] COG0035 Uracil phosphoribosyltransferase  ali follow..  14  72...............LAIVPILRAGI----GMVDGLLNLVPAAKVGHIGMYRDEETLQPVE-----------------LVKLPEDIDQRQIFVVDPTGGSAILAVDGASNIKFVCLVSAPEGVKALQEAHPDVEIFTAALDERLNEHGYIVPGL...................................................................... 198
8 -5.290[O] KOG1349 Gpi-anchor transamidase  ali follow..  35...EQFFRSGHTNNWAVLVNTLSVYRSVK---RLGISHIVLMLADDMACNPRNPKPATVLTGRIPPSTPRS--------KRLLSDDRSNILIYMTGHGGNGFLKFQDSEEITNIELADAFEQMWQKRRYNELLFII-----------DTCQGASMYERFYSPNIMALASSQVGEDSLSHQPDP......................................... 239
9 -5.150[R] KOG0509 Ankyrin repeat and DHHC-type Zn-finger domain containing proteins  ali follow..  10  53.....IVKATQYGIFERCKELVEAGYDVRQPDKENVSLLHWAAINNRLDLVR------FYISKGAVVDQLGGDLNSTPLHWAIRQ-HGADPTLIDGEGFSSIHLAVLFQHMIIAYLISKGQSVNMTDVNGQTPLMLSAHKVIGPEPTGFL----LKFNPSLNVVDKIHQNTPLHWAVAAGNVNAVDKLLEAGSSLDIQNVKGETPLDMALQNKNQLIIHMLKTE 272
10 -5.030[T] COG0784 FOG: CheY-like receiver  ali follow..  15  7.............RVLVVEDSMIAMLIEDTLCELGHEVAATASRMQEALD--------IARKGQFDIAIIDVNLDGEPSYPVADILAERNVPFIFATG.............................................................................................................................. 84

FFAS is supported by the NIH grant R01-GM087218-01
1 3 5 0 8 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Pio F, Chu Z, Reed JC, Godzik A. PAAD - a new protein domain associated with apoptosis, cancer and autoimmune diseases. Trends Biochem Sci. 2001 Feb;26(2):85-7.